VIVO AND IN VITRO OLEFIN CYCLOPROPANATION CATALYZED BY HEME ENZYMES

20190211367 ยท 2019-07-11

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides methods for catalyzing the conversion of an olefin to any compound containing one or more cyclopropane functional groups using heme enzymes. In certain aspects, the present invention provides a method for producing a cyclopropanation product comprising providing an olefinic substrate, a diazo reagent, and a heme enzyme; and admixing the components in a reaction for a time sufficient to produce a cyclopropanation product. In other aspects, the present invention provides heme enzymes including variants and fragments thereof that are capable of carrying out in vivo and in vitro olefin cyclopropanation reactions. Expression vectors and host cells expressing the heme enzymes are also provided by the present invention.

Claims

1. A heme enzyme variant that can cyclopropanate an olefinic substrate.

2. The heme enzyme variant of claim 1, wherein the heme enzyme variant is a cyctochrome P450 enzyme variant.

3. The heme enzyme variant of claim 2, wherein the cyctochrome P450 enzyme variant is a P450 BM3 enzyme variant.

4. The heme enzyme variant of claim 3, wherein the P450 BM3 enzyme variant comprises at least one mutation in the amino acid sequence set forth in SEQ ID NO:1.

5. The heme enzyme variant of claim 1, wherein the heme enzyme variant comprises a mutation at the axial position of the heme coordination site.

6. The heme enzyme variant of claim 5, wherein the mutation is a substitution of Cys with Ala, Asp, Arg, Asn, Glu, Gln, Gly, His, Ile, Lys, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, or Val at the axial position.

7. The heme enzyme variant of claim 3, wherein the P450 BM3 enzyme variant comprises at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, or all thirteen of the following amino acid substitutions in SEQ ID NO:1: V78A, F87V, P142S, T175I, A184V, S226R, H236Q, E252G, T268A, A290V, L353V, I366V, and E442K.

8. The heme enzyme variant of claim 3, wherein the P450 BM3 enzyme variant comprises at least one, two, or all three of the following amino acid substitutions in SEQ ID NO:1: I263A, A328G, and a T438 mutation.

9. The heme enzyme variant of claim 8, wherein the T438 mutation is T438A, T438S, or T438P.

10. The heme enzyme variant of claim 3, wherein the P450 BM3 enzyme variant comprises from one to five alanine substitutions in the active site of SEQ ID NO:1.

11. The heme enzyme variant of claim 10, wherein the active site alanine substitutions are selected from the group consisting of L75A, M177A, L181A, I263A, L437A, and a combination thereof.

12. The heme enzyme variant of claim 3, wherein the P450 BM3 enzyme variant comprises a T268A mutation and/or a C400X mutation in SEQ ID NO:1, wherein X is any amino acid other than Cys.

13. The heme enzyme variant of claim 1, wherein the heme enzyme variant has a higher total turnover number (TTN) compared to the wild-type sequence.

14. The heme enzyme variant of claim 1, wherein the heme enzyme variant produces a plurality of cyclopropanation products having a Z:E ratio of from 1:99 to 99:1.

15. The heme enzyme variant of claim 1, wherein the heme enzyme variant produces a plurality of cyclopropanation products having at least 30% to at least 90% diasteroselectivity.

16. The heme enzyme variant of claim 1, wherein the heme enzyme variant produces a plurality of cyclopropanation products having at least 30% to at least 90% enantioselectivity.

17. The heme enzyme variant of claim 1, wherein the heme enzyme variant is in lyophilized form.

18. A cell expressing a heme enzyme variant of claim 1.

19. An expression vector comprising a nucleic acid sequence encoding a heme enzyme variant of claim 1.

20. A cell comprising the expression vector of claim 19.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0109] FIG. 1 illustrates the canonical mode of reactivity of cytochrome P450s. (Left): monooxygenation of olefins and CH bonds to epoxides and alcohols catalyzed by the ferryl porphyrin radical intermediate (Compound I). (Right): Artificial mode of formal carbene transfer activity of cytochrome P450s utilizing diazoester reagents as carbene precursors.

[0110] FIG. 2 illustrates the absolute stereoselectivity of select P450.sub.BM3 cyclopropanation catalysts. Reaction conditions: 20 M catalyst, 30 mM styrene, 10 mM EDA, 10 mM Na.sub.2S.sub.2O.sub.4, under argon in aqueous potassium phosphate buffer (pH 8.0) and 5% MeOH cosolvent for 2 hours at 298 K. Enzyme loading is 0.2 mol % with respect to EDA. The structures of each product stereoisomer are shown above the reaction gas chromatograms.

[0111] FIG. 3 illustrates the effect of styrene concentration on cyclopropane yield.

[0112] FIG. 4 illustrates the effect of P450 (H2A10) concentration on cyclopropane yield.

[0113] FIGS. 5A-B illustrate the initial velocities plot for variant 9-10A-TS-F87V-T268A (C3C).sub.heme. (FIG. 5A) EDA concentration was varied at a saturating concentration of styrene (30 mM). (FIG. 5B) Styrene concentration was varied at a fixed concentration of EDA (20 mM). Initial rates were computed as the slope of a zero-intercept linear fit of three different time points from independent reactions. Error bars correspond to 1- (68.3%) confidence intervals for the slope.

[0114] FIG. 6 illustrates the cyclopropanation activities of variant 9-10A-TS-F87V-T268A (also called BM3-CIS or P450.sub.BM3-CIS) and BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-CIS) driven by sodium dithionite under anaerobic and aerobic conditions. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value.

[0115] FIG. 7 illustrates the cyclopropanation and epoxidation activities of variant 9-10A-TS-F87V-T268A (also called BM3-CIS or P450.sub.BM3-CIS) and BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-CIS) driven by NADPH under anaerobic and aerobic conditions. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Reaction conditions: 20 M catalyst, 30 mM styrene, 10 mM EDA, 0.5 mM NADPH, 25 mM glucose, 2 U ml.sup.1 glucose dehydrogenase under argon (or air) in aqueous potassium phosphate buffer (pH 8.0) and 5% MeOH cosolvent for 2 hours at 298 K. Measurements were taken in triplicate and the error bars represent the standard deviation of the measurements.

[0116] FIGS. 8A-B illustrate the initial velocities plot for BM3-CIS-C400S (also called ABC-CIS or P411BM3-CIS).sub.heme. (FIG. 8A) EDA concentration was varied at a saturating concentration of styrene (30 mM). (FIG. 8B) Styrene concentration was varied at a fixed concentration of EDA (20 mM). Initial rates were computed as the slope of a zero-intercept linear fit of three different time points from independent reactions. Error bars correspond to 1- (68.3%) confidence intervals for the slope.

[0117] FIG. 9 illustrates the heme domain active site and protein alignments of variant 9-10A-TS-F87V-T268A (also called BM3-CIS or P450.sub.BM3-CIS) with BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-CIS) and wild type P450.sub.BM3. Top panels shows alignments of P450.sub.BM3-CIS (green) and P411.sub.BM3-CIS (peach) with left, middle and right panels showing active site residues, the active site 1-helix, and global protein fold, respectively. No significant structural changes were observed (RMSD 0.52 ). Middle panels: Large variations are observed upon comparing P411.sub.BM3-CIS with the open (ligand-free) form of wild type P450.sub.BM3 (purple, taken from PDB #2IJ2, RMSD 1.2 ). Pronounced rearrangements are observed in active site side chain residues (left) as well as rotations within the I-helix. Global movements are also observed in the N-terminal beta domain as well as F- and G-helices (right, marked by double headed arrows). These movements are consistent with well-known transitions that occur upon substrate binding and are important for native monooxygenation catalysis. Bottom panels: Alignment of P450.sub.BM3-CIS with a ligand-bound P450.sub.BM3 structure (cyan, taken from PDB #1JPZ, RMSD 0.52 ) demonstrates that P450.sub.BM3-CIS and P411.sub.BM3-CIS mimic the closed protein conformation even in the absence of substrate. Protein alignments were carried out using the align tool of PyMol (PyMOL Molecular Graphics System, Version 1.3 Schrdinger, LLC.).

[0118] FIG. 10 illustrates that whole-cell cyclopropanation catalysts are inhibited under aerobic conditions. Variant 9-10A-TS-F87V-T268A=BM3-CIS and ABC=BM3+C400S. Reaction conditions: 20 mM styrene, 10 mM EDA, under argon (or air) in nitrogen-free medium and 5% MeOH cosolvent for 2 hours at 298 K (OD.sub.60024). Total turnover=concentration of cyclopropanes (mM)/cell density (g cdw/L) in units of mmol/g cdw.

[0119] FIG. 11 illustrates the effect of glucose addition on in vivo cyclopropanation of styrene. Reaction conditions: 20 mM styrene, 10 mM EDA, under argon in nitrogen-free medium and 5% MeOH cosolvent for 2 hours at 298 K (OD.sub.60024). Total turnover=concentration of cyclopropanes (mM)/cell density (g cdw/L) in units of mmol/g cdw. Variant 9-10A-TS-F87V-T268A=BM3-CIS and ABC=BM3+C400S.

[0120] FIG. 12 illustrates the effect of media and comparison of holo vs. heme forms of BM3-CIS-C400S on in vivo cyclopropanation of styrene. Reaction conditions: 20 mM styrene, 10 mM EDA, 2 mM glucose under argon in nitrogen-free medium and 5% MeOH cosolvent for 2 hours at 298 K (OD.sub.60024). Variant 9-10A-TS-F87V-T268A=BM3-CIS and ABC=BM3+C400S.

[0121] FIG. 13 illustrates that increasing ABC catalyst loading (cell density) increases cyclopropanes yield up to approximately 80% at OD.sub.600=50. ABC (BM3-C400S or P411.sub.BM3).

[0122] FIG. 14 illustrates the effect of using 1, 3, 4 and 5 equivalents of styrene on reaction yield. Excess styrene gives only small improvements in yield. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. ABC (BM3-C400S or P411.sub.BM3).

[0123] FIG. 15 illustrates controls for ABC catalyzed cyclopropanation. Variant 9-10A-TS-F87V-T268A=BM3-CIS and ABC=BM3-C400S.

[0124] FIG. 16 illustrates that ABC catalyst is active for 3 hours. At OD.sub.600=25, the P450 concentration in 0.85 M, such that TTN>8,000. Variant 9-10A-TS-F87V-T268A=BM3-CIS and ABC=BM3-C400S.

[0125] FIGS. 17A-D illustrate the proposed substrate scope of P450-catalyzed cyclopropanation. (FIG. 17A) Diazo-compounds that can be used as the carbenoid precursor. (FIG. 17B) Olefin partners for reaction. (FIG. 17C) Cyclopropanation of geranyl acetone for synthesis of anthroplalone and noranthroplone. (FIG. 17D) Cyclopropanation of 2,5-dimethylhexa-2,4-diene in the synthesis of pyrethroid insecticides.

[0126] FIG. 18 illustrates UV-Vis absorption spectra of purified BM3-CIS.sub.heme (3 M, red line) and BM3-CIS-C400S.sub.heme (2 M, green line). Insert shows solutions of both proteins at approximately 1 mM.

[0127] FIGS. 19A-C illustrate (FIG. 19A) Cytochrome P450s inefficiently catalyze cyclopropanation using NAD(P)H as a reductant because the Fe.sup.III/Fe.sup.II redox potential for the low-spin resting state (E.sub.Fc-cys=430 mV) is lower than that of NAD(P).sup.+/NAD(P)H (E.sub.1=320 mV). Replacement of the heme-cysteine ligand (Fe-Cys) with serine (Fe-Ser) increased the resting state reduction potential and allowed reduction by NAD(P)H to the active Fe.sup.II species in vivo. (FIG. 19B) Close-up of the ABC-CIS active site (PDB: 4H24) superimposed with an F.sub.o-F.sub.c simulated annealing omit map contoured at 3 showing electron density (green mesh) corresponding to the bound heme and C400S mutation. Interconnected density between C400S and the heme iron is consistent with proximal heme ligation by the C400S side chain hydroxyl. The heme, C400S and additional active site amino acid side chains are shown as sticks. (FIG. 19C) Potentiometric redox titrations for BM3 (green circles) and ABC (blue triangles) with overlaid one-electron Nernst curves. Insets show spectral changes between ferric (dashed line) and ferrous (solid line) states. The changes in absorbance near 450-470 nm (BM3) and 420-440 (ABC) were used to determine the Fe.sup.II/Fe.sup.III ratio after reduction with dithionite. The reduction is reversible, and reoxidation by potassium ferricyanide shows little or no hysteresis. The midpoint potential of the serine-ligated mutant (293 mV) is shifted 127 mV positive compared to WT (420 mV).

[0128] FIGS. 20A-B illustrate the heme electron density of BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-CIS). Maximum likelihood weighted electron density maps of serine-ligated heme in P411.sub.BM3-CIS. (FIG. 20A) Stereo image of heme bound to P411.sub.BM3-CIS viewed from the top of the heme in the active site. (FIG. 20B) Stereo image of heme bound to P411.sub.BM3-CIS rotated 90 from panel A shows clear indication of heme-iron ligation by the side chain hydroxyl of C400S. All atoms are shown as sticks. All electron density maps were contoured at =1.0. For perspective, in panel B, the main chain atoms of residues 399 and 401 are also shown as sticks.

[0129] FIG. 21 illustrates the absolute spectra for ferric (blue), dithionite reduced ferrous (red) and carbon monoxide bound ferrous (green) ABC-CIS.sub.heme. Soret bands (nm): Fe.sup.III, 404; Fe.sup.II, 410, 425; Fe.sup.IICO, 411. Fe.sup.IICO displays and bands at 532 and 565 nm. Insert shows the carbon monoxide ferrous (pink) and the dithionite reduced ferrous (yellow) enzymes at 4.5 M protein concentration.

[0130] FIG. 22 illustrates the absolute spectra for ferric (blue), dithionite reduced ferrous (red) and carbon monoxide bound ferrous (green) ABC-CIS.sub.holo. Soret bands (nm): Fe.sup.III, 404; Fe.sup.II, 410, 422; Fe.sup.IICO, 411. Fe.sup.IICO displays and bands at 533 and 566 nm. Ferric spectrum displays a broad peak at 465 nm.

[0131] FIGS. 23A-B illustrate the difference spectra for ferrous carbonyl with respect to ferrous for: (FIG. 23A) ABC-CIS.sub.heme and (FIG. 23B) ABC-CIS.sub.holo.

[0132] FIG. 24 illustrates the potentiometric redox titration for P450.sub.BM3-heme with overlaid Nernst curve fit to E=420 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0133] FIG. 25 illustrates the potentiometric redox titration for P411.sub.BM3-heme with overlaid Nernst curve fit to E=293 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0134] FIG. 26 illustrates the potentiometric redox titration for P450.sub.BM3-heme-CIS with overlaid Nernst curve fit to E=360 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0135] FIG. 27 illustrates the potentiometric redox titration for P411.sub.BM3-heme-CIS with overlaid Nernst curve fit to E=265 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0136] FIG. 28 illustrates the cyclopropanation activity under anaerobic vs. aerobic conditions with dithionite in variant 9-10A-TS-F87V-T268A (also called BM3-CIS or P450.sub.BM3-heme-CIS) and BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-heme-CIS). Measurements were taken in triplicate and the error bars represent the standard deviation of the measurements.

[0137] FIG. 29 illustrates the effect of adding exogenous glucose (2 mM) on olefin cyclopropanation catalyzed by E. coli whole cells expressing 9-10A-TS-F87V-T268A (also called BM3-CIS and P450.sub.BM3-CIS) or BM3-CIS-C400S (also called ABC-CIS and P411.sub.BM3-CIS).

[0138] FIG. 30 illustrates the thermostabilities of heme domains of BM3-CIS (P450.sub.BM3-CIS in blue) and ABC-CIS (P411.sub.BM3-CIS in red). The C400S mutation stabilizes the heme domain by +1.7 C. The T.sub.50 is the temperature at which half of the enzyme population has unfolded. Error bars correspond to 1- (68.3%) confidence intervals for the T.sub.50.

[0139] FIG. 31 illustrates the effect of dioxygen exposure on whole-cell catalyzed cyclopropanation. ABC-CIS (P411.sub.BM3-CIS) is strongly inhibited by dioxygen in vivo. All reactions had a cell density equivalent to OD.sub.600=25. Reactions were conducted in the absence of exogenous glucose. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Product formation is defined as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

[0140] FIG. 32 illustrates the empty plasmid, no-induction controls and dithionite addition to whole cells. E. coli cells carrying the ABC-CIS (P411.sub.BM3-CIS) gene but grown without the addition of IPTG (ABC-CIS no induction); E. coli cells carrying the pcWori plasmid but not the ABC-CIS gene (empty pcWori); ABC-CIS reaction with the addition of exogenous dithionite instead of glucose (ABC-CIS+dithionite). Reactions were left for two hours at 298 K. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Product formation is defined as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

[0141] FIG. 33 illustrates that increasing cell density increases cyclopropane yields up 80%. Total turnovers do not increase for cell densities higher than OD.sub.600=20. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Product formation is defined as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

[0142] FIG. 34 illustrates the time-course for in vivo and in vitro ABC-CIS (P411.sub.BM3-CIS)-catalyzed reaction at P411 loading of 1.6 M [.sub.411-490=103 mM.sup.1 cm.sup.1 for the ferrous-CO complex (K. P. Vatsis et al., J. Inorg. Biochem. 91, 542 (2002))]. Reaction conditions were as follows: 40 mM styrene, 20 mM EDA, 2 mM glucose, 10.2 g.sub.cdw L.sup.1 whole-cell ABC-CIS (in vivo), 1.6 M purified ABC-CIS (in vitro) in aqueous nitrogen-free M9 minimal medium and 5% MeOH cosolvent under anaerobic conditions at 298 K. Yields at each time point are reported as averages of two independent reactions.

[0143] FIGS. 35A-C illustrate the contrasting P450- and P411-mediated cyclopropanation. (FIG. 35A) Cytochrome P450s inefficiently catalyze cyclopropanation using NAD(P)H as a reductant because the Fe.sup.III/Fe.sup.II redox potential for the low-spin resting state (E.sub.Fe-cys=430 mV) is lower than that of NAD(P).sup.+/NAD(P)H (E.sub.1=320 mV, right). Mutation of the heme-ligating Cys to Ser allows NAD(P)H-driven cyclopropanation while removing native monooxygenation (left). (FIG. 35B) Close-up of the P411.sub.BM3-heme-CIS active site (PDB: 4H24) superimposed with an F.sub.o-F.sub.c simulated annealing omit map contoured at 3 showing electron density (green mesh) corresponding to the bound heme and C400S mutation. Heme, C400S and additional active site amino acid side chains are shown as sticks. (FIG. 35C) In vitro cyclopropanation vs. epoxidation of styrene catalyzed by P450.sub.BM3-CIS and P411.sub.BM3-CIS under anaerobic and aerobic conditions. Reaction conditions were as follows: 30 mM styrene, 10 mM EDA, 0.5 mM NADPH, 25 mM glucose, 2 U ml.sup.1 glucose dehydrogenase and 20 g enzyme in aqueous potassium phosphate buffer and 5% MeOH cosolvent for six hours at 25 C. Error bars represent the standard deviation of three independent measurements.

[0144] FIGS. 36A-C illustrate the racemic synthesis of milnacipran. (FIG. 36A) Synthesis of key intermediate 1. (FIG. 36B) Routes A-C for conversion of 1 to milnacipran. (FIG. 36C) Route to milnacipran based on selective deprotonation of 5.

[0145] FIGS. 37A-B illustrate the enantioselective synthesis of levomilnacipran using (FIG. 37A) Rh-catalyzed intramolecular cyclopropanation or (FIG. 37B) asymmetric alkylation using tetraamine chiral auxiliary.

[0146] FIG. 38 illustrates the synthesis of levomilnacipran via carbene cyclopropanation by cytochrome P450.sub.BM3 variants.

[0147] FIG. 39 illustrates the gas chromatography trace of reaction of 9b and EDA mediated by BM3-CIS-AxH, using Agilent cycloSil-B column, 30 m0.25 m0.32 mm, method: 90 C. (hold 2 min), 90-110 (6 C./min), 110-190 (40 C./min), and 190-280 (20 C./min). Internal standard at 4.8 min, starting material at 10.4 min, and product at 14.8 min (E-isomer) and 15.4 min (Z-isomer).

[0148] FIG. 40 illustrates the proposed synthesis of bicifadine, DOV-216,303 and derivatives using P450-catalyzed cyclopropanation.

[0149] FIG. 41 illustrates that resting E. coli cells (425 L) were purged with argon, before adding glucose (50 L), 2,5-dimethyl-2,4-hexadiene (12.5 L), and EDA (12.5 L). The reaction was carried out in nitrogen free M9 minimal media with 5% methanol co-solvent for 24 hours at 298 K.

[0150] FIG. 42 illustrates a GC-FID chromatogram showing the two ethyl chrysanthemate diastereomers produced by BM3-T268A-C400S. Oven temperature: 90 C. for 2 min, then 2 C./min to 110 C., then 30 C./min to 230 C. HP-5 column (Agilent) 30 m0.32 mm0.25 m.

[0151] FIG. 43 illustrates a GC-MS ion chromatogram (m=123) showing the two chrysanthemate diastereomers produced by BM3-T268A-C400S. Top insert shows the fragmentation pattern for ethyl chrysanthemate that gives rise to the molecular ion with m=123. Oven temperature: 90 C. for 2 min, then 2 C./min to 110 C., then 30 C./min to 230 C. HP-5 column (Agilent) 30 m0.32 mm0.25 m.

[0152] FIG. 44 illustrates the chemical or enzymatic conversion of ethyl chrysanthemate to pyrethoid and pyrethrin insecticides. (a) Hydrolysis; (b) activation to the acid chloride; (c) coupling of the pyrethrolone alcohol (ROH) to the acid chloride; (d) transesterification.

[0153] FIG. 45A shows the sequence alignment between cytochrome P450 BM3 (SEQ ID NO:76) and CYP2D7 (SEQ ID NO:75). The C400 axial ligand in P450 BM3 corresponds to C461 in CYP2D7. FIG. 45B shows the sequence alignment between cytochrome P450 BM3 (SEQ ID NO:78) and P450C27 (SEQ ID NO:77). The C400 axial ligand in P450 BM3 corresponds to C478 in P450C27.

DETAILED DESCRIPTION OF THE INVENTION

I. INTRODUCTION

[0154] The present invention is based on the surprising discovery that heme enzymes can be used to catalyze the conversion of olefins to any product containing one or more cyclopropane functional groups. In some aspects, cytochrome P450 enzymes (e.g., P450 BM3 (CYP102A1)) and variants thereof were identified as having an unexpectedly improved ability to catalyze the formal transfer of carbene equivalents from diazo reagents to various olefinic substrates, thereby making cyclopropane products with high regioselectivity and/or stereoselectivity. In particular embodiments, the present inventors have discovered that variants of P450.sub.BM3 with at least one or more amino acid mutations such as an axial ligand C400X (e.g., C400S) and/or an T268A amino acid substitution can catalyze cyclopropanation reactions efficiently, displaying increased total turnover numbers (TTN) and demonstrating highly regio- and enantioselective product formation compared to wild-type enzymes.

[0155] As a non-limiting example, axial serine heme ligation (C400S in BM3) in cytochrome P450s creates the homologous cytochrome P411 family, which catalyze the cyclopropanation reaction in vivo in whole cells, providing over 10,000 total turnovers with high stereoselectivity, optical purity and yield, making the cyclopropane product with titers of over 20 g L.sup.1. Thus, the cytochrome P411 family is spectroscopically, electrochemically, and catalytically distinct from cytochrome P450s, providing a scaffold for engineering orthogonal heme-enzyme catalysis. As such, the ability to catalyze this non-natural CC bond forming reaction in vivo advantageously expands the scope of transformations that are accessible to microbial organic synthesis and provides artificial metabolic pathways to complement nature's existing strategies for making cyclopropanes.

II. DEFINITIONS

[0156] The following definitions and abbreviations are to be used for the interpretation of the invention. The term invention or present invention as used herein is a non-limiting term and is not intended to refer to any single embodiment but encompasses all possible embodiments.

[0157] As used herein, the terms comprises, comprising, includes, including, has, having, contains, containing, or any other variation thereof, are intended to cover a non-exclusive inclusion. A composition, mixture, process, method, article, or apparatus that comprises a list of elements is not necessarily limited to only those elements but may include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, or refers to an inclusive or and not to an exclusive or.

[0158] The term cyclopropanation (enzyme) catalyst or enzyme with cyclopropanation activity refers to any and all chemical processes catalyzed by enzymes, by which substrates containing at least one carbon-carbon double bond can be converted into cyclopropane products by using diazo reagents as carbene precursors.

[0159] The terms engineered heme enzyme and heme enzyme variant include any heme-containing enzyme comprising at least one amino acid mutation with respect to wild-type and also include any chimeric protein comprising recombined sequences or blocks of amino acids from two, three, or more different heme-containing enzymes.

[0160] The terms engineered cytochrome P450 and cytochrome P450 variant include any cytochrome P450 enzyme comprising at least one amino acid mutation with respect to wild-type and also include any chimeric protein comprising recombined sequences or blocks of amino acids from two, three, or more different cytochrome P450 enzymes.

[0161] The term whole cell catalyst includes microbial cells expressing heme-containing enzymes, wherein the whole cell catalyst displays cyclopropanation activity.

[0162] As used herein, the terms porphyrin and metal-substituted porphyrins include any porphyrin that can be bound by a heme enzyme or variant thereof. In particular embodiments, these porphyrins may contain metals including, but not limited to, Fe, Mn, Co, Cu, Rh, and Ru.

[0163] The terms carbene equivalent and carbene precursor include molecules that can be decomposed in the presence of metal (or enzyme) catalysts to structures that contain at least one divalent carbon with only 6 valence shell electrons and that can be transferred to CC bonds to form cyclopropanes or to CH or heteroatom-H bonds to form various carbon ligated products.

[0164] The terms carbene transfer and formal carbene transfer as used herein include any chemical transformation where carbene equivalents are added to CC bonds, carbon-heteroatom double bonds or inserted into or heteroatom-H substrates.

[0165] As used herein, the terms microbial, microbial organism and microorganism include any organism that exists as a microscopic cell that is included within the domains of archaea, bacteria or eukarya. Therefore, the term is intended to encompass prokaryotic or eukaryotic cells or organisms having a microscopic size and includes bacteria, archaea and eubacteria of all species as well as eukaryotic microorganisms such as yeast and fungi. Also included are cell cultures of any species that can be cultured for the production of a chemical.

[0166] As used herein, the term non-naturally occurring, when used in reference to a microbial organism or enzyme activity of the invention, is intended to mean that the microbial organism or enzyme has at least one genetic alteration not normally found in a naturally occurring strain of the referenced species, including wild-type strains of the referenced species. Genetic alterations include, for example, modifications introducing expressible nucleic adds encoding metabolic polypeptides, other nucleic acid additions, nucleic acid deletions and/or other functional disruption of the microbial organism's genetic material. Such modifications include, for example, coding regions and functional fragments thereof, for heterologous, homologous or both heterologous and homologous polypeptides for the referenced species. Additional modifications include, for example, non-coding regulatory regions in which the modifications alter expression of a gene or operon. Exemplary non-naturally occurring microbial organism or enzyme activity includes the cyclopropanation activity described above.

[0167] As used herein, the term anaerobic, when used in reference to a reaction, culture or growth condition, is intended to mean that the concentration of oxygen is less than about 25 M, preferably less than about 5 M, and even more preferably less than 1 M. The term is also intended to include sealed chambers of liquid or solid medium maintained with an atmosphere of less than about 1% oxygen. Preferably, anaerobic conditions are achieved by sparging a reaction mixture with an inert gas such as nitrogen or argon.

[0168] As used herein, the term exogenous is intended to mean that the referenced molecule or the referenced activity is introduced into the host microbial organism. The term as it is used in reference to expression of an encoding nucleic acid refers to the introduction of the encoding nucleic acid in an expressible form into the microbial organism. When used in reference to a biosynthetic activity, the term refers to an activity that is introduced into the host reference organism.

[0169] The term heterologous as used herein with reference to molecules, and in particular enzymes and polynucleotides, indicates molecules that are expressed in an organism other than the organism from which they originated or are found in nature, independently of the level of expression that can be lower, equal or higher than the level of expression of the molecule in the native microorganism.

[0170] On the other hand, the term native or endogenous as used herein with reference to molecules, and in particular enzymes and polynucleotides, indicates molecules that are expressed in the organism in which they originated or are found in nature, independently of the level of expression that can be lower equal or higher than the level of expression of the molecule in the native microorganism. It is understood that expression of native enzymes or polynucleotides may be modified in recombinant microorganisms.

[0171] The term homolog, as used herein with respect to an original enzyme or gene of a first family or species, refers to distinct enzymes or genes of a second family or species which are determined by functional, structural or genomic analyses to be an enzyme or gene of the second family or species which corresponds to the original enzyme or gene of the first family or species. Homologs most often have functional, structural, or genomic similarities. Techniques are known by which homologs of an enzyme or gene can readily be cloned using genetic probes and PCR. Identity of cloned sequences as homolog, can be confirmed using functional assays and/or by genomic mapping of the genes.

[0172] A protein has homology or is homologous to a second protein if the amino acid sequence encoded by a gene has a similar amino acid sequence to that of the second gene. Alternatively, a protein has homology to a second protein if the two proteins have similar amino acid sequences. Thus, the term homologous proteins is intended to mean that the two proteins have similar amino acid sequences. In particular embodiments, the homology between two proteins is indicative of its shared ancestry, related by evolution.

[0173] The terms analog and analogous include nucleic acid or protein sequences or protein structures that are related to one another in function only and are not from common descent or do not share a common ancestral sequence. Analogs may differ in sequence but may share a similar structure, due to convergent evolution. For example, two enzymes are analogs or analogous if the enzymes catalyze the same reaction of conversion of a substrate to a product, are unrelated in sequence, and irrespective of whether the two enzymes are related in structure.

[0174] As used herein, the term alkyl refers to a straight or branched, saturated, aliphatic radical having the number of carbon atoms indicated. Alkyl can include any number of carbons, such as C.sub.1-2, C.sub.1-3, C.sub.1-4, C.sub.1-5, C.sub.1-6, C.sub.1-7, C.sub.1-8, C.sub.2-3, C.sub.2-4, C.sub.2-5, C.sub.2-6, C.sub.3-4, C.sub.3-5, C.sub.3-6, C.sub.4-5, C.sub.4-6 and C.sub.5-6. For example, C.sub.1-6 alkyl includes, but is not limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, hexyl, etc. Alkyl can refer to alkyl groups having up to 20 carbons atoms, such as, but not limited to heptyl, octyl, nonyl, decyl, etc. Alkyl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0175] As used herein, the termalkenyl refers to a straight chain or branched hydrocarbon having at least 2 carbon atoms and at least one double bond. Alkenyl can include any number of carbons, such as C.sub.2, C.sub.2-3, C.sub.2-4, C.sub.2-5, C.sub.2-6, C.sub.2-7, C.sub.2-8, C.sub.2-9, C.sub.2-10, C.sub.3, C.sub.3-4, C.sub.3-5, C.sub.3-6, C.sub.4, C.sub.4-5, C.sub.4-6, C.sub.5, C.sub.5-6, and C.sub.6. Alkenyl groups can have any suitable number of double bonds, including, but not limited to, 1, 2, 3, 4, 5 or more. Examples of alkenyl groups include, but are not limited to, vinyl (ethenyl), propenyl, isopropenyl, 1-butenyl, 2-butenyl, isobutenyl, butadienyl, 1-pentenyl, 2-pentenyl, isopentenyl, 1,3-pentadienyl, 1,4-pentadienyl, 1-hexenyl, 2-hexenyl, 3-hexenyl, 1,3-hexadienyl, 1,4-hexadienyl, 1,5-hexadienyl, 2,4-hexadienyl, or 1,3,5-hexatrienyl. Alkenyl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0176] As used herein, the term alkynyl refers to either a straight chain or branched hydrocarbon having at least 2 carbon atoms and at least one triple bond. Alkynyl can include any number of carbons, such as C.sub.2, C.sub.2-3, C.sub.2-4, C.sub.2-5, C.sub.2-6, C.sub.2-7, C.sub.2-8, C.sub.2-9, C.sub.2-10, C.sub.3, C.sub.3-4, C.sub.3-5, C.sub.3-6, C.sub.4, C.sub.4-5, C.sub.4-6, C.sub.5, C.sub.5-6, and C.sub.6. Examples of alkynyl groups include, but are not limited to, acetylenyl, propenyl, 1-butynyl, 2-butynyl, isobutynyl, sec-butynyl, butadiynyl, 1-pentynyl, 2-pentynyl, isopentynyl, 1,3-pentadiynyl,1,4-pentadiynyl, 1-hexynyl, 2-hexynyl, 3-hexynyl, 1,3-hexadiynyl, 1,4-hexadiynyl, 1,5-hexadiynyl, 2,4-hexadiynyl, or 1,3,5-hexatriynyl. Alkynyl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0177] As used herein, the term aryl refers to an aromatic carbon ring system having any suitable number of ring atoms and any suitable number of rings. Aryl groups can include any suitable number of carbon ring atoms, such as, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 ring atoms, as well as from 6 to 10, 6 to 12, or 6 to 14 ring members. Aryl groups can be monocyclic, fused to form bicyclic or tricyclic groups, or linked by a bond to form a biaryl group. Representative aryl groups include phenyl, naphthyl and biphenyl. Other aryl groups include benzyl, having a methylene linking group. Some aryl groups have from 6 to 12 ring members, such as phenyl, naphthyl or biphenyl. Other aryl groups have from 6 to 10 ring members, such as phenyl or naphthyl. Some other aryl groups have 6 ring members, such as phenyl. Aryl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0178] As used herein, the term cycloalkyl refers to a saturated or partially unsaturated, monocyclic, fused bicyclic or bridged polycyclic ring assembly containing from 3 to 12 ring atoms, or the number of atoms indicated. Cycloalkyl can include any number of carbons, such as C.sub.3-6, C.sub.4-6, C.sub.5-6, C.sub.3-8, C.sub.4-8, C.sub.5-8, and C.sub.6-8. Saturated monocyclic cycloalkyl rings include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cyclooctyl. Saturated bicyclic and polycyclic cycloalkyl rings include, for example, norbornane, [2.2.2] bicyclooctane, decahydronaphthalene and adamantane. Cycloalkyl groups can also be partially unsaturated, having one or more double or triple bonds in the ring. Representative cycloalkyl groups that are partially unsaturated include, but are not limited to, cyclobutene, cyclopentene, cyclohexene, cyclohexadiene (1,3- and 1,4-isomers), cycloheptene, cycloheptadiene, cyclooctene, cyclooctadiene (1,3-, 1,4- and 1,5-isomers), norbornene, and norbornadiene. Cycloalkyl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0179] As used herein, the term heterocyclyl refers to a saturated ring system having from 3 to 12 ring members and from 1 to 4 heteroatoms selected from N, O and S. Additional heteroatoms including, but not limited to, B, Al, Si and P can also be present in a heterocycloalkyl group. The heteroatoms can be oxidized to form moieties such as, but not limited to, S(O) and S(O).sub.2. Heterocyclyl groups can include any number of ring atoms, such as, 3 to 6, 4 to 6, 5 to 6, 4 to 6, or 4 to 7 ring members. Any suitable number of heteroatoms can be included in the heterocyclyl groups, such as 1, 2, 3, or 4, or 1 to 2, 1 to 3, 1 to 4, 2 to 3, 2 to 4, or 3 to 4. Examples of heterocyclyl groups include, but are not limited to, aziridine, azetidine, pyrrolidine, piperidine, azepane, azocane, quinuclidine, pyrazolidine, imidazolidine, piperazine (1,2-, 1,3- and 1,4-isomers), oxirane, oxetane, tetrahydrofuran, oxane (tetrahydropyran), oxepane, thiirane, thietane, thiolane (tetrahydrothiophene), thiane (tetrahydrothiopyran), oxazolidine, isoxazolidine, thiazolidine, isothiazolidine, dioxolane, dithiolane, morpholine, thiomorpholine, dioxane, or dithiane. Heterocyclyl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0180] As used herein, the term heteroaryl refers to a monocyclic or fused bicyclic or tricyclic aromatic ring assembly containing 5 to 16 ring atoms, where from 1 to 5 of the ring atoms are a heteroatom such as N, O or S. Additional heteroatoms including, but not limited to, B, Al, Si and P can also be present in a heteroaryl group. The heteroatoms can be oxidized to form moieties such as, but not limited to, S(O) and S(O).sub.2. Heteroaryl groups can include any number of ring atoms, such as, 3 to 6, 4 to 6, 5 to 6, 3 to 8, 4 to 8, 5 to 8, 6 to 8, 3 to 9, 3 to 10, 3 to 11, or 3 to 12 ring members. Any suitable number of heteroatoms can be included in the heteroaryl groups, such as 1, 2, 3, 4, or 5, or 1 to 2, 1 to 3, 1 to 4, 1 to 5, 2 to 3, 2 to 4, 2 to 5, 3 to 4, or 3 to 5. Heteroaryl groups can have from 5 to 8 ring members and from 1 to 4 heteroatoms, or from 5 to 8 ring members and from 1 to 3 heteroatoms, or from 5 to 6 ring members and from 1 to 4 heteroatoms, or from 5 to 6 ring members and from 1 to 3 heteroatoms. Examples of heteroaryl groups include, but are not limited to, pyrrole, pyridine, imidazole, pyrazole, triazole, tetrazole, pyrazine, pyrimidine, pyridazine, triazine (1,2,3-, 1,2,4- and 1,3,5-isomers), thiophene, furan, thiazole, isothiazole, oxazole, and isoxazole. Heteroaryl groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0181] As used herein, the term alkoxy refers to an alkyl group having an oxygen atom that connects the alkyl group to the point of attachment: i.e., alkyl-O. As for alkyl group, alkoxy groups can have any suitable number of carbon atoms, such as C.sub.1-6 or C.sub.1-4. Alkoxy groups include, for example, methoxy, ethoxy, propoxy, iso-propoxy, butoxy, 2-butoxy, iso-butoxy, sec-butoxy, tert-butoxy, pentoxy, hexoxy, etc. Alkoxy groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0182] As used herein, the term alkylthio refers to an alkyl group having a sulfur atom that connects the alkyl group to the point of attachment: i.e., alkyl-S. As for alkyl groups, alkylthio groups can have any suitable number of carbon atoms, such as C.sub.1-6 or C.sub.1-4. Alkylthio groups include, for example, methoxy, ethoxy, propoxy, iso-propoxy, butoxy, 2-butoxy, iso-butoxy, sec-butoxy, tert-butoxy, pentoxy, hexoxy, etc. Alkylthio groups can be optionally substituted with one or more moieties selected from halo, hydroxy, amino, alkylamino, alkoxy, haloalkyl, carboxy, amido, nitro, oxo, and cyano.

[0183] As used herein, the terms halo and halogen refer to fluorine, chlorine, bromine and iodine.

[0184] As used herein, the term haloalkyl refers to n alkyl moiety as defined above substituted with at least one halogen atom.

[0185] As used herein, the term alkylsilyl refers to a moiety SiR.sub.3, wherein at least one R group is alkyl and the other R groups are H or alkyl. The alkyl groups can be substituted with one more halogen atoms.

[0186] As used herein, the term acyl refers to a moiety C(O)R, wherein R is an alkyl group.

[0187] As used herein, the term oxo refers to an oxygen atom that is double-bonded to a compound (i.e., O).

[0188] As used herein, the term carboxy refers to a moiety C(O)OH. The carboxy moiety can be ionized to form the carboxylate anion.

[0189] As used herein, the term amino refers to a moiety NR.sub.3, wherein each R group is H or alkyl.

[0190] As used herein, the term amido refers to a moiety NRC(O)R or C(O)NR.sub.2, wherein each R group is H or alkyl.

III. DESCRIPTION OF THE EMBODIMENTS

[0191] In some aspects, the present invention provides methods for catalyzing the conversion of an olefin to any compound (e.g., any intermediate or final compound) containing one or more cyclopropane functional groups using heme enzymes. In certain aspects, the present invention provides a method for producing a cyclopropanation product, the method comprising: [0192] (a) providing an olefinic substrate, a diazo reagent, and a heme enzyme; and [0193] (b) admixing the components of step (a) in a reaction for a time sufficient to produce a cyclopropanation product.

[0194] In certain instances, the cyclopropanation product is produced via an intermolecular cyclopropanation reaction between the olefinic substrate and diazo reagent as separate distinct substrates. In other instances, the cyclopropanation product is produced via an intramolecular cyclopropanation reaction, e.g., wherein the olefinic substrate and diazo reagent are part of the same substrate.

[0195] The methods of the invention can be used to provide a vast number of cyclopropanation products. The cyclopropanation products include classes of compounds such as, but not limited to, insecticides (e.g., pyrethroid compounds), active pharmaceutical agents having chiral and/or achiral cyclopropane moieties (e.g., milnacipran, levomilnacipran, and other active ingredients such as antibiotics, antivirals, etc.), commodity and fine chemicals, plant hormones, flavors and scents, and fatty acids. The cyclopropanation products can also serve as intermediates for the synthesis of compounds belonging to these and other classes (e.g., chrysanthemate esters for the synthesis of pyrethroid compounds).

[0196] In other aspects, the present invention provides heme enzymes including variants and fragments thereof (e.g., truncated forms) as well as chimeric heme enzymes that are capable of carrying out the cyclopropanation reactions described herein. Expression vectors and host cells expressing the heme enzymes are also provided by the present invention.

[0197] The following sections provide a description of exemplary and preferred embodiments including heme enzymes, expression vectors, host cells, cyclopropanation products such as, e.g., compounds comprising one or more cyclopropane functional groups, starting materials such as, e.g., olefinic substrates and diazo reagents, and characteristics and reaction conditions for the in vitro and in vivo cyclopropanation reactions described herein.

[0198] A. Heme Enzymes

[0199] In certain aspects, the present invention provides compositions comprising one or more heme enzymes that catalyze the conversion of an olefinic substrate to products containing one or more cyclopropane functional groups. In particular embodiments, the present invention provides heme enzyme variants comprising at least one or more amino acid mutations therein that catalyze the formal transfer of carbene equivalents from a diazo reagent (e.g., a diazo ester) to an olefinic substrate, making cyclopropane products with high stereoselectivity. In preferred embodiments, the heme enzyme variants of the present invention have the ability to catalyze cyclopropanation reactions efficiently, display increased total turnover numbers, and/or demonstrate highly regio- and/or enantioselective product formation compared to the corresponding wild-type enzymes.

[0200] The terms heme enzyme and heme protein are used herein to include any member of a group of proteins containing heme as a prosthetic group. Non-limiting examples of heme enzymes include globins, cytochromes, oxidoreductases, any other protein containing a heme as a prosthetic group, and combinations thereof. Heme-containing globins include, but are not limited to, hemoglobin, myoglobin, and combinations thereof. Heme-containing cytochromes include, but are not limited to, cytochrome P450, cytochrome b, cytochrome c1, cytochrome c, and combinations thereof. Heme-containing oxidoreductases include, but are not limited to, a catalase, an oxidase, an oxygenase, a haloperoxidase, a peroxidase, and combinations thereof.

[0201] In certain instances, the heme enzymes are metal-substituted heme enzymes containing protoporphyrin IX or other porphyrin molecules containing metals other than iron, including, but not limited to, cobalt, rhodium, copper, ruthenium, and manganese, which are active cyclopropanation catalysts.

[0202] In some embodiments, the heme enzyme is a member of one of the enzyme classes set forth in Table 1. In other embodiments, the heme enzyme is a variant or homolog of a member of one of the enzyme classes set forth in Table 1. In yet other embodiments, the heme enzyme comprises or consists of the heme domain of a member of one of the enzyme classes set forth in Table 1 or a fragment thereof (e.g., a truncated heme domain) that is capable of carrying out the cyclopropanation reactions described herein.

TABLE-US-00001 TABLE 1 Heme enzymes identified by their enzyme classification number (EC number) and classification name. EC Number Name 1.1.2.3 L-lactate dehydrogenase 1.1.2.6 polyvinyl alcohol dehydrogenase (cytochrome) 1.1.2.7 methanol dehydrogenase (cytochrome c) 1.1.5.5 alcohol dehydrogenase (quinone) 1.1.5.6 formate dehydrogenase-N: 1.1.9.1 alcohol dehydrogenase (azturin): 1.1.99.3 gluconate 2-dehydrogenase (acceptor) 1.1.99.11 fructose 5-dehydrogenase 1.1.99.18 cellobiose dehydrogenase (acceptor) 1.1.99.20 alkan-1-ol dehydrogenase (acceptor) 1.2.1.70 glutamyl-tRNA reductase 1.2.3.7 indole-3-acetaldehyde oxidase 1.2.99.3 aldehyde dehydrogenase (pyrroloquinoline-quinone) 1.3.1.6 fumarate reductase (NADH): 1.3.5.1 succinate dehydrogenase (ubiquinone) 1.3.5.4 fumarate reductase (menaquinone) 1.3.99.1 succinate dehydrogenase 1.4.9.1 methylamine dehydrogenase (amicyanin) 1.4.9.2. aralkylamine dehydrogenase (azurin) 1.5.1.20 methylenetetrahydrofolate reductase [NAD(P)H] 1.5.99.6 spermidine dehydrogenase 1.6.3.1 NAD(P)H oxidase 1.7.1.1 nitrate reductase (NADH) 1.7.1.2 Nitrate reductase [NAD(P)H] 1.7.1.3 nitrate reductase (NADPH) 1.7.1.4 nitrite reductase [NAD(P)H] 1.7.1.14 nitric oxide reductase [NAD(P), nitrous oxide-forming] 1.7.2.1 nitrite reductase (NO-forming) 1.7.2.2 nitrite reductase (cytochrome, ammonia-forming) 1.7.2.3 trimethylamine-N-oxide reductase (cytochrome c) 1.7.2.5 nitric oxide reductase (cytochrome c) 1.7.2.6 hydroxylamine dehydrogenase 1.7.3.6 hydroxylamine oxidase (cytochrome) 1.7.5.1 nitrate reductase (quinone) 1.7.5.2 nitric oxide reductase (menaquinol) 1.7.6.1 nitrite dismutase 1.7.7.1 ferredoxin-nitrite reductase 1.7.7.2 ferredoxin-nitrate reductase 1.7.99.4 nitrate reductase 1.7.99.8 hydrazine oxidoreductase 1.8.1.2 sulfite reductase (NADPH) 1.8.2.1 sulfite dehydrogenase 1.8.2.2 thiosulfate dehydrogenase 1.8.2.3 sulfide-cytochrome-c reductase (flavocytochrome c) 1.8.2.4 dimethyl sulfide:cytochrome c2 reductase 1.8.3.1 sulfite oxidase 1.8.7.1 sulfite reductase (ferredoxin) 1.8.98.1 CoB-CoM heterodisulfide reductase 1.8.99.1 sulfite reductase 1.8.99.2 adenylyl-sulfate reductase 1.8.99.3 hydrogensulfite reductase 1.9.3.1 cytochrome-c oxidase 1.9.6.1 nitrate reductase (cytochrome) 1.10.2.2 ubiquinol-cytochrome-c reductase 1.10.3.1 catechol oxidase 1.10.3.B1 caldariellaquinol oxidase (H+-transporting) 1.10.3.3 L-ascorbate oxidase 1.10.3.9 photosystem II 1.10.3.10 ubiquinol oxidase (H+-transporting) 1.10.3.11 ubiquinol oxidase 1.10.3.12 menaquinol oxidase (H+-transporting) 1.10.9.1 plastoquinol-plastocyanin reductase 1.11.1.5 cytochrome-c peroxidase 1.11.1.6 catalase 1.11.1.7 peroxidase 1.11.1.B2 chloride peroxidase (vanadium-containing) 1.11.1.B7 bromide peroxidase (heme-containing) 1.11.1.8 iodide peroxidase 1.11.1.10 chloride peroxidase 1.11.1.11 L-ascorbate peroxidase 1.11.1.13 manganese peroxidase 1.11.1.14 lignin peroxidase 1.11.1.16 versatile peroxidase 1.11.1.19 dye decolorizing peroxidase 1.11.1.21 catalase-peroxidase 1.11.2.1 unspecific peroxygenase 1.11.2.2 myeloperoxidase 1.11.2.3 plant seed peroxygenase 1.11.2.4 fatty-acid peroxygenase 1.12.2.1 cytochrome-c3 hydrogenase 1.12.5.1 hydrogen:quinone oxidoreductase 1.12.99.6 hydrogenase (acceptor) 1.13.11.9 2,5-dihydroxypyridine 5,6-dioxygenase 1.13.11.11 tryptophan 2,3-dioxygenase 1.13.11.49 chlorite O2-lyase 1.13.11.50 acetylacetone-cleaving enzyme 1.13.11.52 indoleamine 2,3-dioxygenase 1.13.11.60 linoleate 8R-lipoxygenase 1.13.99.3 tryptophan 2-dioxygenase 1.14.11.9 flavanone 3-dioxygenase 1.14.12.17 nitric oxide dioxygenase 1.14.13.39 nitric-oxide synthase (NADPH dependent) 1.14.13.17 cholesterol 7alpha-monooxygenase 1.14.13.41 tyrosine N-monooxygenase 1.14.13.70 sterol 14alpha-demethylase 1.14.13.71 N-methylcoclaurine 3-monooxygenase 1.14.13.81 magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase 1.14.13.86 2-hydroxyisoflavanone synthase 1.14.13.98 cholesterol 24-hydroxylase 1.14.13.119 5-epiaristolochene 1,3-dihydroxylase 1.14.13.126 vitamin D3 24-hydroxylase 1.14.13.129 beta-carotene 3-hydroxylase 1.14.13.141 cholest-4-en-3-one 26-monooxygenase 1.14.13.142 3-ketosteroid 9alpha-monooxygenase 1.14.13.151 linalool 8-monooxygenase 1.14.13.156 1,8-cineole 2-endo-monooxygenase 1.14.13.159 vitamin D 25-hydroxylase 1.14.14.1 unspecific monooxygenase 1.14.15.1 camphor 5-monooxygenase 1.14.15.6 cholesterol monooxygenase (side-chain-cleaving) 1.14.15.8 steroid 15beta-monooxygenase 1.14.15.9 spheroidene monooxygenase 1.14.18.1 tyrosinase 1.14.19.1 stearoyl-CoA 9-desaturase 1.14.19.3 linoleoyl-CoA desaturase 1.14.21.7 biflaviolin synthase 1.14.99.1 prostaglandin-endoperoxide synthase 1.14.99.3 heme oxygenase 1.14.99.9 steroid 17alpha-monooxygenase 1.14.99.10 steroid 21-monooxygenase 1.14.99.15 4-methoxybenzoate monooxygenase (O-demethylating) 1.14.99.45 carotene epsilon-monooxygenase 1.16.5.1 ascorbate ferrireductase (transmembrane) 1.16.9.1 iron:rusticyanin reductase 1.17.1.4 xanthine dehydrogenase 1.17.2.2 lupanine 17-hydroxylase (cytochrome c) 1.17.99.1 4-methylphenol dehydrogenase (hydroxylating) 1.17.99.2 ethylbenzene hydroxylase 1.97.1.1 chlorate reductase 1.97.1.9 selenate reductase 2.7.7.65 diguanylate cyclase 2.7.13.3 histidine kinase 3.1.4.52 cyclic-guanylate-specific phosphodiesterase 4.2.1.B9 colneleic acid/etheroleic acid synthase 4.2.1.22 Cystathionine beta-synthase 4.2.1.92 hydroperoxide dehydratase 4.2.1.212 colneleate synthase 4.3.1.26 chromopyrrolate synthase 4.6.1.2 guanylate cyclase 4.99.1.3 sirohydrochlorin cobaltochelatase 4.99.1.5 aliphatic aldoxime dehydratase 4.99.1.7 phenylacetaldoxime dehydratase 5.3.99.3 prostaglandin-E synthase 5.3.99.4 prostaglandin-I synthase 5.3.99.5 Thromboxane-A synthase 5.4.4.5 9,12-octadecadienoate 8-hydroperoxide 8R-isomerase 5.4.4.6 9,12-octadecadienoate 8-hydroperoxide 8S-isomerase 6.6.1.2 cobaltochelatase

[0203] In particular embodiments, the heme enzyme is a variant or a fragment thereof (e.g., a truncated variant containing the heme domain) comprising at least one mutation such as, e.g., a mutation at the axial position of the heme coordination site. :In some instances, the mutation is a substitution of the native residue with Ala, Asp, Arg, Asn, Cys, Glu, Gin, Gly, His, Ile, Lys, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, or Val at the axial position. In certain instances, the mutation is a substitution of Cys with any other amino acid such as Ser at the axial position.

[0204] In certain embodiments, the in vitro methods for producing a cyclopropanation product comprise providing a heme enzyme, variant, or homolog thereof with a reducing agent such as NADPH or a dithionite salt (e.g., Na.sub.2S.sub.2O.sub.4). In certain other embodiments, the in vivo methods for producing a cyclopropanation product comprise providing whole cells such as E. coli cells expressing a heme enzyme, variant, or homolog thereof.

[0205] In some embodiments, the heme enzyme, variant, or homolog thereof is recombinantly expressed and optionally isolated and/or purified for carrying out the in vitro cyclopropanation reactions of the present invention. In other embodiments, the heme enzyme, variant, or homolog thereof is expressed in whole cells such as E. coli cells, and these cells are used for carrying out the in vivo cyclopropanation reactions of the present invention.

[0206] In certain embodiments, the heme enzyme, variant, or homolog thereof comprises or consists of the same number of amino acid residues as the wild-type enzyme (e.g., a full-length polypeptide). In some instances, the heme enzyme, variant, or homolog thereof comprises or consists of an amino acid sequence without the start methionine (e.g., P450 BM3 amino acid sequence set forth in SEQ ID NO:1). In other embodiments, the heme enzyme comprises or consists of a heme domain fused to a reductase domain. In yet other embodiments, the heme enzyme does not contain a reductase domain, e.g., the heme enzyme contains a heme domain only or a fragment thereof such as a truncated heme domain.

[0207] In some embodiments, the heme enzyme, variant, or homolog thereof has an enhanced cyclopropanation activity of at least about 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 fold compared to the corresponding wild-type heme enzyme.

[0208] In some embodiments, the heme enzyme, variant, or homolog thereof has a resting state reduction potential higher than that of NADH or NADPH.

[0209] In particular embodiments, the heme enzyme comprises a cyctochrome P450 enzyme. Cytochrome P450 enzymes constitute a large superfamily of heme-thiolate proteins involved in the metabolism of a wide variety of both exogenous and endogenous compounds. Usually, they act as the terminal oxidase in multicomponent electron transfer chains, such as P450-containing monooxygenase systems. Members of the cytochrome P450 enzyme family catalyze myriad oxidative transformations, including, e.g., hydroxylation, epoxidation, oxidative ring coupling, heteroatom release, and heteroatom oxygenation (E. M. Isin et al., Biochim. Biophys, Acta 1770, 314 (2007)). The active site of these enzymes contains an Fe.sup.III-protoporphyrin IX cofactor (heme) ligated proximally by a conserved cysteine thiolate (M. T. Green, Current Opinion in Chemical Biology 13, 84 (2009)). The remaining axial iron coordination site is occupied by a water molecule in the resting enzyme, but during native catalysis, this site is capable of binding molecular oxygen. In the presence of an electron source, typically provided by NADH or NADPH from an adjacent fused reductase domain or an accessory cytochrome P450 reductase enzyme, the heme center of cytochrome P450 activates molecular oxygen, generating a high valent iron(IV)-oxo porphyrin cation radical species intermediate (Compound I, FIG. 1) and a molecule of water.

[0210] One skilled in the art will appreciate that the cytochrome P450 enzyme superfamily has been compiled in various databases, including, but not limited to, the P450 homepage (available at http://drnelson.uthsc.edu/CytochromeP450.html; see also, D. R. Nelson, Hum. Genomics 4, 59 (2009)), the cytochrome P450 enzyme engineering database (available at http://www.cyped.uni-stuttgart.de/cgi-bin/CYPED5/index.pl; see also, D. Sirim et al., BMC Biochem 10, 27 (2009)), and the SuperCyp database (available at http://bioinformatics.charite.de/supercyp/; see also, S. Preissner et al., Nucleic Acids Res. 38, D237 (2010)), the disclosures of which are incorporated herein by reference in their entirety for all purposes.

[0211] In certain embodiments, the cytochrome P450 enzymes of the invention are members of one of the classes shown in Table 2 (see, http://www.icgeb.org/p450srv/P450enzymes.html, the disclosure of which is incorporated herein by reference in its entirety for all purposes).

TABLE-US-00002 TABLE 2 Cytochrome P450 enzymes classified by their EC number, recommended name, and family/gene name. Family/ EC Recommended name gene 1.3.3.9 secologanin synthase CYP72A1 1.14.13.11 trans-cinnamate 4-monooxygenase CYP73 1.14.13.12 benzoate 4-monooxygenase CYP53 1.14.13.13 calcidiol 1-monooxygenase CYP27 1.14.13.15 cholestanetriol 26-monooxygenase CYP27 1.14.13.17 cholesterol 7-monooxygenase CYP7 1.14.13.21 flavonoid 3-monooxygenase CYP75 1.14.13.28 3,9-dihydroxypterocarpan 6a-monooxygenase CYP93A1 1.14.13.30 leukotriene-B.sub.4 20-monooxygenase CYP4F 1.14.13.37 methyltetrahydroprotoberberine 14- CYP93A1 monooxygenase 1.14.13.41 tyrosine N-monooxygenase CYP79 1.14.13.42 hydroxyphenylacetonitrile 2-monooxygenase 1.14.13.47 (-)-limonene 3-monooxygenase 1.14.13.48 (-)-limonene 6-monooxygenase 1.14.13.49 (-)-limonene 7-monooxygenase 1.14.13.52 isoflavone 3-hydroxylase 1.14.13.53 isoflavone 2-hydroxylase 1.14.13.55 protopine 6-monooxygenase 1.14.13.56 dihydrosanguinarine 10-monooxygenase 1.14.13.57 dihydrochelirubine 12-monoxygenase 1.14.13.60 27-hydroxycholesterol 7-monooxygenase 1.14.13.70 sterol 14-demethylase CYP51 1.14.13.71 N-methylcoclaurine 3-monooxygenase CYP80B1 1.14.13.73 tabersonine 16-hydroxylase CYP71D12 1.14.13.74 7-deoxyloganin 7-hydroxylase 1.14.13.75 vinorine hydroylase 1.14.13.76 taxane 10-hydroxylase CYP725A1 1.14.13.77 taxane 13-hydroxylase CYP725A2 1.14.13.78 ent-kaurene oxidase CYP701 1.14.13.79 ent-kaurenoic acid oxidase CYP88A 1.14.14.1 unspecific monooxygenase multiple 1.14.15.1 camphor 5-monooxygenase CYP101 1.14.15.3 alkane 1-monooxygenase CYP4A 1.14.15.4 steroid 11-monooxygenase CYP11B 1.14.15.5 corticosterone 18-monooxygenase CYP11B 1.14.15.6 cholesterol monooxygenase (side-chain- CYP11A cleaving) 1.14.21.1 (S)-stylopine synthase 1.14.21.2 (S)-cheilanthifoline synthase 1.14.21.3 berbamunine synthase CYP80 1.14.21.4 salutaridine synthase 1.14.21.5 (S)-canadine synthase 1.14.99.9 steroid 17-monooxygenase CYP17 1.14.99.10 steroid 21-monooxygenase CYP21 1.14.99.22 ecdysone 20-monooxygenase 1.14.99.28 linalool 8-monooxygenase CYP111 4.2.1.92 hydroperoxide dehydratase CYP74 5.3.99.4 prostaglandin-I synthase CYP8 5.3.99.5 thromboxane-A synthase CYP5

[0212] Table 3 below lists additional cyctochrome P450 enzymes that are suitable for use in the cyclopropanation reactions of the present invention. The accession numbers in Table 3 are incorporated herein by reference in their entirety for all purposes. The cytochrome P450 gene and/or protein sequences disclosed in the following patent documents are hereby incorporated by reference in their entirety for all purposes: WO 2013/076258; CN 103160521; CN 103223219; KR 2013081394; JP 5222410; WO 2013/073775; WO 2013/054890; WO 2013/048898; WO 2013/031975; WO 2013/064411; U.S. Pat. No. 8,361,769; WO 2012/150326, CN 102747053; CN 102747052; JP 2012170409; WO 2013/115484; CN 103223219; KR 2013081394; CN 103194461; JP 5222410 ; WO 2013/086499; WO 2013/076258; WO 2013/073775; WO 2013/064411; WO 2013/054890; WO 2013/031975; U.S. Pat. No. 8,361,769; WO 2012/156976; WO 2012/150326; CN 102747053; CN 102747052; US 20120258938; JP 2012170409; CN 102399796; JP 2012055274; WO 2012/029914; WO 2012/028709; WO 2011/154523; JP 2011234631; WO 2011/121456; EP 2366782; WO 2011/105241; CN 102154234; WO 2011/093185; WO 2011/093187; WO 2011/093186; DE 102010000168; CN 102115757; CN 102093984; CN 102080069; JP 2011103864; WO 2011/042143; WO 2011/038313; JP 2011055721; WO 2011/025203; JP 2011024534; WO 2011/008231; WO 2011/008232; WO 2011/005786; IN 2009DE01216; DE 102009025996; WO 2010/134096; JP 2010233523; JP 2010220609; WO 2010/095721; WO 2010/064764; US 20100136595; JP 2010051174; WO 2010/024437; WO 2010/011882; WO 2009/108388; US 20090209010; US 20090124515; WO 2009/041470; KR 2009028942; WO 2009/039487; WO 2009/020231; JP 2009005687; CN 101333520; CN 101333521; US 20080248545; JP 2008237110; CN 101275141; WO 2008/118545; WO 2008/115844; CN 101255408; CN 101250506; CN 101250505; WO 2008/098198; WO 2008/096695; WO 2008/071673; WO 2008/073498; WO 2008/065370; WO 2008/067070; JP 2008127301; JP 2008054644; KR 794395; EP 1881066; WO 2007/147827; CN 101078014; JP 2007300852; WO 2007/048235; WO 2007/044688; WO 2007/032540; CN 1900286; CN 1900285; JP 2006340611; WO 2006/126723; KR 2006029792; KR 2006029795; WO 2006/105082; WO 2006/076094; US 2006/0156430; WO 2006/065126; JP 2006129836; CN 1746293; WO 2006/029398; JP 2006034215; JP 2006034214; WO 2006/009334; WO 2005/111216; WO 2005/080572; US 2005/0150002; WO 2005/061699; WO 2005/052152; WO 2005/038033; WO 2005/038018; WO 2005/030944; JP 2005065618; WO 2005/017106; WO 2005/017105; US 20050037411; WO 2005/010166; JP 2005021106; JP 2005021104; JP 2005021105; WO 2004/113527; CN 1472323; JP 2004261121; WO 2004/013339; WO 2004/011648; DE 10234126; WO 2004/003190; WO 2003/087381; WO 2003/078577; US 20030170627; US 20030166176; US 20030150025; WO 2003/057830; WO 2003/052050; CN 1358756; US 20030092658; US 20030078404; US 20030066103; WO 2003/014341; US 20030022334 ; WO 2003/008563; EP 1270722; US 20020187538; WO 2002/092801; WO 2002/088341; US 20020160950; WO 2002/083868; US 20020142379; WO 2002/072758; WO 2002/064765; US 20020076777; US 20020076774; US 20020076774; WO 2002/046386; WO 2002/044213; US 20020061566; CN 1315335; WO 2002/034922; WO 2002/033057; WO 2002/029018; WO 2002/018558; JP 2002058490; US 20020022254; WO 2002/008269; WO 2001/098461; WO2001/081585; WO 2001/051622; WO 2001/034780; CN 1271005; WO 2001/011071; WO 2001/007630; WO 2001/007574; WO 2000/078973; U.S. Pat. No. 6,130,077; JP 2000152788; WO2000/031273; WO 2000/020566; WO 2000/000585; DE 19826821; JP 11235174; U.S. Pat. No. 5,939,318; WO 99/19493; WO 99/18224; US 5886157; WO 99/08812; U.S. Pat. No. 5,869,283; JP 10262665; WO 98/40470; EP 776974; DE 19507546; GB 2294692; U.S. Pat. No. 5,516,674; JP 07147975; WO 94/29434; JP 06205685; JP 05292959; JP 04144680; DD 298820; EP 477961; SU 1693043; JP 01047375; EP 281245; JP 62104583; JP 63044888; JP 62236485; JP 62104582; and JP 62019084.

TABLE-US-00003 TABLE 3 Additional cytochrome P450 enzymes of the present invention. SEQ ID Species Cyp No. Accession No. NO Bacillus megaterium 102A1 AAA87602 1 Bacillus megaterium 102A1 ADA57069 2 Bacillus megaterium 102A1 ADA57068 3 Bacillus megaterium 102A1 ADA57062 4 Bacillus megaterium 102A1 ADA57061 5 Bacillus megaterium 102A1 ADA57059 6 Bacillus megaterium 102A1 ADA57058 7 Bacillus megaterium 102A1 ADA57055 8 Bacillus megaterium 102A1 ACZ37122 9 Bacillus megaterium 102A1 ADA57057 10 Bacillus megaterium 102A1 ADA57056 11 Mycobacterium sp. HXN-1500 153A6 CAH04396 12 Tetrahymena thermophile 5013C2 ABY59989 13 Nonomuraea dietziae AGE14547.1 14 Homo sapiens 2R1 NP_078790 15 Macca mulatta 2R1 NP_001180887.1 16 Canis familiaris 2R1 XP_854533 17 Mus musculus 2R1 AAI08963 18 Bacillus halodurans C-125 152A6 NP_242623 19 Streptomyces parvus aryC AFM80022 20 Pseudomonas putida 101A1 P00183 21 Homo sapiens 2D7 AAO49806 22 Rattus norvegicus C27 AAB02287 23 Oryctolagus cuniculus 2B4 AAA65840 24 Bacillus subtilis 102A2 O08394 25 Bacillus subtilis 102A3 O08336 26 B. megaterium DSM 32 102A1 P14779 27 B. cereus ATCC14579 102A5 AAP10153 28 B. licheniformis ATTC1458 102A7 YP 079990 29 B. thuringiensis serovar X YP 037304 30 konkukian str. 97-27 R. metallidurans CH34 102E1 YP 585608 31 A. fumigatus Af293 505X EAL92660 32 A. nidulans FGSC A4 505A8 EAA58234 33 A. oryzae ATCC42149 505A3 Q2U4F1 34 A. oryzae ATCC42149 X Q2UNA2 35 F. oxysporum 505A1 Q9Y8G7 36 G. moniliformis X AAG27132 37 G. zeae PH1 505A7 EAA67736 38 G. zeae PH1 505C2 EAA77183 39 M. grisea 70-15 syn 505A5 XP 365223 40 N. crassa OR74 A 505A2 XP 961848 41 Oryza sativa* 97A Oryza sativa* 97B Oryza sativa 97C ABB47954 42 The start methionine (M) may be present or absent from these sequences. *See, M. Z. Lv et al., Plant Cell Physiol., 53(6): 987-1002 (2012).

[0213] In certain embodiments, the present invention provides amino acid substitutions that efficiently remove monooxygenation chemistry from cytochrome P450 enzymes. This system permits selective enzyme-driven cyclopropanation chemistry without competing side reactions mediated by native P450 catalysis. The invention also provides P450-mediated catalysis that is competent for cyclopropanation chemistry but not able to carry out traditional P450-mediated monooxygenation reactions as orthogonal P450 catalysis and respective enzyme variants as orthogonal P450s. In some instances, orthogonal P450 variants comprise a single amino acid mutation at the axial position of the heme coordination site (e.g., a C400S mutation in the P450 BM3 enzyme) that alters the proximal heme coordination environment. Accordingly, the present invention also provides P450 variants that contain an axial heme mutation in combination with one or more additional mutations described herein to provide orthogonal P450 variants that show enriched diastereoselective and/or enantioselective product distributions. The present invention further provides a compatible reducing agent for orthogonal P450 cyclopropanation catalysis that includes, but is not limited to, NAD(P)H or sodium dithionite.

[0214] In particular embodiments, the cytochrome P450 enzyme is one of the P450 enzymes or enzyme classes set forth in Table 2 or 3. In some embodiments, the cytochrome P450 enzyme is a variant or homolog of one of the P450 enzymes or enzyme classes set forth in Table 2 or 3. In preferred embodiments, the P450 enzyme variant comprises a mutation at the conserved cysteine (Cys or C) residue of the corresponding wild-type sequence that serves as the heme axial ligand to which the iron in protoporphyrin IX is attached. As non-limiting examples, axial mutants of any of the P450 enzymes set forth in Table 2 or 3 can comprise a mutation at the axial position (AxX) of the heme coordination site, wherein X is selected from Ala, Asp, Arg, Asn, Glu, Gln, Gly, His, Ile, Lys, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val.

[0215] In certain embodiments, the conserved cysteine residue in a cytochrome P450 enzyme of interest that serves as the heme axial ligand and is attached to the iron in protoporphyrin IX can be identified by locating the segment of the DNA sequence in the corresponding cytochrome P450 gene which encodes the conserved cysteine residue. In some instances, this DNA segment is identified through detailed mutagenesis studies in a conserved region of the protein (see, e.g., Shimizu et al., Biochemistry 27, 4138-4141, 1988). In other instances, the conserved cysteine is identified through crystallographic study (see, e.g., Poulos et al., J. Mol. Biol 195:687-700, 1987).

[0216] In situations where detailed mutagenesis studies and crystallographic data are not available for a cytochrome P450 enzyme of interest, the axial ligand may be identified through phylogenetic study. Due to the similarities in amino acid sequence between P450 enzymes, standard protein alignment algorithms may show a phylogenetic similarity between a P450 enzyme for which crystallographic or mutagenesis data exist and a new P450 enzyme for which such data do not exist. Thus, the polypeptide sequences of the present invention for which the heme axial ligand is known can be used as a query sequence to perform a search against a specific new cytochrome P450 enzyme of interest or a database comprising cytochrome P450 sequences to identify the heme axial ligand. Such analyses can be performed using the BLAST programs (see, e.g., Altschul et al., J Mol Biol. 215(3):403-10(1990)). Software for performing BLAST analyses publicly available through the National Center for Biotechnology Information (http://ncbi.nlm.nih.gov). BLASTP is used for amino acid sequences.

[0217] Exemplary parameters for performing amino acid sequence alignments to identify the heme axial ligand in a P450 enzyme of interest using the BLASTP algorithm include E value=10, word size=3, Matrix=Blosum62, Gap opening=11, gap extension=1, and conditional compositional score matrix adjustment. Those skilled in the art will know what modifications can be made to the above parameters, e.g., to either increase or decrease the stringency of the comparison and/or to determine the relatedness of two or more sequences.

[0218] In preferred embodiments, the cytochrome P450 enzyme is a cytochrome P450 BM3 enzyme or a variant, homolog, or fragment thereof. The bacterial cytochrome P450 BM3 from Bacillus megaterium is a water soluble, long-chain fatty acid monooxygenase. The native P450 BM3 protein is comprised of a single polypeptide chain of 1048 amino acids and can be divided into 2 functional subdomains (see, L. O. Narhi et al. J. Biol. Chem. 261, 7160 (1986)). An N-terminal domain, amino acid residues 1-472, contains the heme-bound active site and is the location for monoxygenation catalysis. The remaining C-terminal amino acids encompass a reductase domain that provides the necessary electron equivalents from NADPH to reduce the heme cofactor and drive catalysis. The presence of a fused reductase domain in P450 BM3 creates a self-sufficient monooxygenase, obviating the need for exogenous accessory proteins for oxygen activation (see, id.). It has been shown that the N-terminal heme domain can be isolated as an individual, well-folded, soluble protein that retains activity in the presence of hydrogen peroxide as a terminal oxidant under appropriate conditions (P. C. Cirino et al., Angew. Chem., Int. Ed. 42, 3299 (2003)).

[0219] In certain instances, the cytochrome P450 BM3 enzyme comprises or consists of the amino acid sequence set forth in SEQ ID NO: 1. In certain other instances, the cytochrome P450 BM3 enzyme is a natural variant thereof as described, e.g., in J. Y. Kang et al., AMB Express 1:1 (2011), wherein the natural variants are divergent in amino acid sequence from the wild-type cytochrome P450 BM3 enzyme sequence (SEQ ID NO:1) by up to about 5% (e.g., SEQ ID NOS:2-11).

[0220] In particular embodiments, the P450 BM3 enzyme variant comprises or consists of the heme domain of the wild-type P450 BM3 enzyme sequence (e.g., amino acids 1-463 of SEQ ID NO:1) and optionally at least one mutation as described herein. In other embodiments, the P450 BM3 enzyme variant comprises or consists of a fragment of the heme domain of the wild-type P450 BM3 enzyme sequence (SEQ ID NO:1), wherein the fragment is capable of carrying out the cyclopropanation reactions of the present invention. In some instances, the fragment includes the heme axial ligand and at least one, two, three, four, or five of the active site residues.

[0221] In certain embodiments, the P450 BM3 enzyme variant comprises a mutation at the axial position (AxX) of the heme coordination site, wherein X is selected from Ala, Asp, Arg, Asn, Glu, Gln, Gly, His, Ile, Lys, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val. The conserved cysteine (Cys or C) residue in the wild-type P450 BM3 enzyme is located at position 400 in SEQ ID NO:1. As used herein, the terms AxX and C400X refer to the presence of an amino acid substitution X located at the axial position (i.e., residue 400) of the wild-type P450 BM3 enzyme (i.e., SEQ ID NO:1). In some instances, X is Ser (S). In other instances, X is Ala (A), Asp (D), His (H), Lys (K), Asn (N), Met (M), Thr (T), or Tyr (Y). In some embodiments, the P450 BM3 enzyme variant comprises or consists of the heme domain of the wild-type P450 BM3 enzyme sequence (e.g., amino acids 1-463 of SEQ ID NO:1) or a fragment thereof and an AxX mutation (i.e., WT-AxX heme).

[0222] In other embodiments, the P450 BM3 enzyme variant comprises at least one or more (e.g., at least two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, or all thirteen) of the following amino acid substitutions in SEQ ID NO:1: V78A, F87V, P142S, T175I, A184V, S226R, H236Q, E252G, T268A, A290V, L353V, I366V, and E442K. In certain instances, the P450 BM3 enzyme variant comprises a T268A mutation alone or in combination with one or more additional mutations such as a C400X mutation (e.g., C400S) in SEQ ID NO:1. In other instances, the P450 BM3 enzyme variant comprises all thirteen of these amino acid substitutions (i.e., V78A, F87V, P142S, T175I, A184V, S226R, H236Q, E252G, T268A, A290V, L353V, I366V, and E442K; BM3-CIS) in combination with a C400X mutation (e.g., C400S) in SEQ ID NO:1. In some instances, the P450 BM3 enzyme variant comprises or consists of the heme domain of the BM3-CIS enzyme sequence (e.g., amino acids 1-463 of SEQ ID NO:1 comprising all thirteen of these amino acid substitutions) or a fragment thereof and an AxX mutation (i.e., BM3-CIS-AxX heme).

[0223] In some embodiments, the P450 BM3 enzyme variant further comprises at least one or more (e.g., at least two, or all three) of the following amino acid substitutions in SEQ ID NO:1: I263A, A328G, and a T438 mutation. In certain instances, the T438 mutation is T438A, T438S, or T438P. In some instances, the P450 BM3 enzyme variant comprises a T438 mutation such as T438A, T438S, or T438P alone or in combination with one or more additional mutations such as a C400X mutation (e.g., C400S) in SEQ ID NO:1 or a heme domain or fragment thereof. In other instances, the P450 BM3 enzyme variant comprises a T438 mutation such as T438A, T438S, or T438P in a BM3-CIS backbone alone or in combination with a C400X mutation (e.g., C400S) in SEQ ID NO:1 (i.e., BM3-CIS-T438S-AxX). In yet other instances, the P450 BM3 enzyme variant comprises or consists of the heme domain of the BM3-CIS enzyme sequence or a fragment thereof in combination with a T438 mutation and an AxX mutation (e.g., BM3-CIS-T438S-AxX heme)

[0224] In other embodiments, the P450 BM3 enzyme variant further comprises from one to five (e.g., one, two, three, four, or five) active site alanine substitutions in the active site of SEQ ID NO:1. In certain instances, the active site alanine substitutions are selected from the group consisting of L75A, M177A, L181A, I263A, L437A, and a combination thereof.

[0225] In further embodiments, the P450 BM3 enzyme variant comprises at least one or more (e.g., at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22) of the following amino acid substitutions in SEQ ID NO:1: R47C, L52I, I58V, L75R, F81 (e.g., F81L, F81W), A82 (e.g., A82S, A82F, A82G, A82T, etc.), F87A, K94I, I94K, H100R, S106R, F107L, A135S, F162I, A197V, F205C, N239H, R255S, S274T, L324I, A328V, V340M, and K434E. In particular embodiments, the P450 BM3 enzyme variant comprises any one or a plurality of these mutations alone or in combination with one or more additional mutations such as those described above, e.g., an AxX mutation and/or at least one or more mutations including V78A, F87V, P142S, T175I, A184V, S226R, H236Q, E252G, T268A, A290V, L353V, I366V, and E442K.

[0226] Table 4 below provides non-limiting examples of cytochrome P450 BM3 variants of the present invention. Each P450 BM3 variant comprises one or more of the listed mutations (Variant Nos. 1-31), wherein a + indicates the presence of that particular mutation(s) in the variant. Any of the variants listed in Table 4 can further comprise an I263A and/or an A328G mutation and/or at least one, two, three, four, or five of the following alanine substitutions, in any combination, in the P450 BM3 enzyme active site: L75A, M177A, L181A, I263A, and L437A. In particular embodiments, the P450 BM3 variant comprises or consists of the heme domain of any one of Variant Nos. 1-31 listed in Table 4 or a fragment thereof, wherein the fragment is capable of carrying out the cyclopropanation reactions of the present invention.

TABLE-US-00004 TABLE 4 Exemplary cytochrome P450 BM3 enzyme variants of the present invention. P450.sub.BM3 variant Mutation 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 C400X + + + + + + T268A + + + + + + F87V + + + + + + 9-10A-TS + + + + + T438Z + + + + + P450.sub.BM3 variant Mutation 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 C400X + + + + + + + + + + T268A + + + + + + + + + + F87V + + + + + + + + + + 9-10A-TS + + + + + + + + + + + T438Z + + + + + + + + + + + Mutations relative to the wild-type P450.sub.BM3 amino acid sequence (SEQ ID NO: 1); X is selected from Ala, Asp, Arg, Asn, Glu, Gln, Gly, His, Ile, Lys, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val; Z is selected from Ala, Ser, and Pro; 9-10A-TS includes the following amino acid substitutions in SEQ ID NO: 1: V78A, P142S, T175I, A184V, S226R, H236Q, E252G, A290V, L353V, I366V, and E442K.

[0227] One skilled in the art will understand that any of the mutations listed in Table 4 can be introduced into any cytochrome P450 enzyme of interest by locating the segment of the DNA sequence in the corresponding cytochrome P450 gene which encodes the conserved amino acid residue as described above for identifying the conserved cysteine residue in a cytochrome P450 enzyme of interest that serves as the heme axial ligand. In certain instances, this DNA segment is identified through detailed mutagenesis studies in a conserved region of the protein (see, e.g., Shimizu et al., Biochemistry 27, 4138-4141, 1988). In other instances, the conserved amino acid residue is identified through crystallographic study (see, e.g., Poulos et al., J. Mol. Biol 195:687-700, 1987). In yet other instances, protein sequence alignment algorithms can be used to identify the conserved amino acid residue. As non-limiting examples, the use of BLAST alignment with the P450 BM3 amino acid sequence as the query sequence to identify the heme axial ligand site and/or the equivalent T268 residue in other cytochrome P450 enzymes is illustrated in Examples 3 and 9.

[0228] Table 5A below provides non-limiting examples of preferred cytochrome P450 BM3 variants of the present invention. Table 5B below provides non-limiting examples of preferred chimeric cytochrome P450 enzymes of the present invention.

TABLE-US-00005 TABLE 5A Exemplary preferred cytochrome P450 BM3 enzyme variants of the invention. P450.sub.BM3 variants Mutations compared to wild-type P450.sub.BM3 (SEQ ID NO: 1) P450.sub.BM3-T268A T268A P450.sub.BM3-T268A-C400H T268A + C400H P411.sub.BM3 (ABC) C400S P411.sub.BM3-T268A T268A + C400S P450.sub.BM3-T268A-F87V T268A + F87V 9-10A TS V78A, P142S, T175I, A184V, S226R, H236Q, E252G, A290V, L353V, I366V, E442K 9-10A-TS-F87V 9-10A TS + F87V H2A10 9-10A TS + F87V, L75A, L181A, T268A H2A10-C400S 9-10A TS + F87V, L75A, L181A, T268A, C400S H2A10-C400H 9-10A TS + F87V, L75A, L181A, T268A, C400H H2A10-C400M 9-10A TS + F87V, L75A, L181A, T268A, C400M H2-5-F10 9-10A TS + F87V, L75A, I263A, T268A, L437A H2-5-F10-C400S 9-10A TS + F87V, L75A, I263A, T268A, L437A, C400S H2-5-F10-C400H 9-10A TS + F87V, L75A, I263A, T268A, L437A, C400H H2-5-F10-C400M 9-10A TS + F87V, L75A, I263A, T268A, L437A, C400M H2-4-D4 9-10A TS + F87V, L75A, M177A, L181A, T268A, L437A H2-4-D4-C400S 9-10A TS + F87V, L75A, M177A, L181A, T268A, L437A, C400S H2-4-D4-C400H 9-10A TS + F87V, L75A, M177A, L181A, T268A, L437A, C400H H2-2-A1 9-10A TS + F87A, L75A, L181A, L437A H2-2-A1-C400S 9-10A TS + F87A, L75A, L181A, L437A, C400S H2-2-A1-C400H 9-10A TS + F87A, L75A, L181A, L437A, C400H H2-8-C7 9-10A TS + L75A, F87V, L181A H2-5-F10-A75L 9-10A TS + F87V-I263A-T268A-L437A CH F8 R47C, V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, F81W, A82S, F87A, A197V BM3-CIS (P450.sub.BM3-CIS; C3C) 9-10A TS + F87V, T268A BM3-C1S-I263A BM3-CIS + I263A BM3-CIS-A328G BM3-CIS + A328G BM3-CIS-T438S BM3-CIS + T438S BM3-CIS-C400S (P411.sub.BM3-CIS; BM3-CIS + C400S ABC-CIS) BM3-CIS-C400D (BM3-CIS-AxD) BM3-CIS + C400D BM3-CIS-C400Y (BM3-CIS-AxY) BM3-CIS + C400Y BMS-CIS-C400K (BM3-CIS-AxK) BM3-CIS + C400K BM3-CIS-C400H (BM3-CIS-AxH) BM3-CIS + C400H BM3-CIS-C400M (BM3-CIS-AxM) BM3-CIS + C400M WT-AxA (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400A WT-AxD (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400D WT-AxH (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400H WT-AxK (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400K WT-AxM (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400M WT-AxN (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400N WT-AxY (heme) WT heme domain (amino acids 1-463 of SEQ ID NO: 1) + C400Y BM3-CIS-T438S-AxA BM3-CIS-T438S + C400A BM3-CIS-T438S-AxD BM3-CIS-T438S + C400D BM3-CIS-T438S-AxM BM3-CIS-T438S + C400M BM3-CIS-T438S-AxY BM3-CIS-T438S + C400Y BM3-CIS-T438S-AxT BM3-CIS-T438S + C400T 7-11D R47C, V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, A82F, A328V 7-11D-C400S R47C, V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, A82F, A328V, C400S 12-10C R47C, V78A, A82G, F87V, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V A328V, L353V 22A3 L52I, I58V, L75R, F87A, H100R, S106R, F107L A135S, F162I, A184V, N239H, S274T, L324I, V340M, I366V, K434E Man1 V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, F81L, A82T, F87A, I94K

TABLE-US-00006 TABLE 5B Exemplary preferred chimeric cytochrome P450 enzymes of the invention. Chimeric P450s Heme domain block sequence SEQ ID NO C2G9 22223132 43 X7 22312333 44 X7-12 12112333 45 C2E6 11113311 46 X7-9 32312333 47 C2B12 32313233 48 TSP234 22313333 49

[0229] In particular embodiments, cytochrome P450 BM3 variants with at least one or more amino acid mutations such as, e.g., C400X (AxX), BM3-CIS, T438, and/or T268A amino acid substitutions catalyze cyclopropanation reactions efficiently, displaying increased total turnover numbers and demonstrating highly regio- and/or enantioselective product formation compared to the wild-type enzyme.

[0230] As a non-limiting example, the cytochrome P450 BM3 variants of the present invention are cis-selective catalysts that demonstrate diastereomeric ratios at least comparable to wild-type P450 BM3, e.g., at least 37:63 cis:trans, at least 50:50 cis:trans, at least 60:40 cis:trans, or at least 95:5 cis:trans. Particular mutations for improving cis-selective catalysis include at least one mutation comprising T268A, C400X, and T438S, but preferably one, two, or all three of these mutations in combination with additional mutations comprising V78A, P142S, T175I, A184V, S226R, H236Q, E252G, A290V, L353V, I366V, E442K, and F87V derived from P450 BM3 variant 9-10A-TS. These mutations are isolated to the heme domain of P450 BM3 and are located in various regions of the heme domain structure including the active site and periphery.

[0231] As another non-limiting example, the cytochrome P450 BM3 variants of the present invention are trans-selective catalysts that demonstrate diastereomeric ratios at least comparable to wild-type P450 BM3, e.g., at least 37:63 cis:trans, at least 20:80 cis:trans, or at least 1:99 cis:trans. Particular mutations for improving trans-selective catalysis include at least one mutation comprising including T268A and C400X, but preferably one or both of these mutations in the background of wild-type P450 BM3. In certain embodiments, trans-preferential mutations in combination with additional mutations such as V78A, P142S, T175I, A184V, S226R, H236Q, E252G, A290V, L353V, I366V, E442K, and F87V (from 9-10-A-TS) are also tolerated when in the presence of additional mutations including, but not limited to, I263A, L437A, L181A and/or L75A. These mutations are isolated to the heme domain of P450 BM3 and are located in various regions of the heme domain structure including the active site and periphery.

[0232] In certain embodiments, the present invention also provides P450 variants that catalyze enantioselective cyclopropanation with enantiomeric excess values of at least 30% (comparable with wild-type P450 BM3), but more preferably at least 80%, and even more preferably at least >95% for preferred product diastereomers.

[0233] In other aspects, the present invention provides chimeric heme enzymes such as, e.g., chimeric P450 proteins comprised of recombined sequences from P450 BM3 and at least one, two, or more distantly related P450 enzymes from Bacillus subtillis or any other organism that are competent cyclopropanation catalysts using similar conditions to wild-type P450 BM3 and highly active P450 BM3 variants. As a non-limiting example, site-directed recombination of three bacterial cytochrome P450s can be performed with sequence crossover sites selected to minimize the number of disrupted contacts within the protein structure. In some embodiments, seven crossover sites can be chosen, resulting in eight sequence blocks. One skilled in the art will understand that the number of crossover sites can be chosen to produce the desired number of sequence blocks, e.g., 1, 2, 3, 4, 5, 6, 7, 8, or 9 crossover sites for 2, 3, 4, 5, 6, 7, 8, 9, or 10 sequence blocks, respectively. In other embodiments, the numbering used for the chimeric P450 refers to the identity of the parent sequence at each block. For example, 12312312 refers to a sequence containing block 1 from P450 #1, block 2 from P450 #2, block 3 from P450 #3, block 4 from P450 #1, block 5 from P450 #2, and so on. A chimeric library useful for generating the chimeric heme enzymes of the invention can be constructed as described in, e.g., Otey et al., PLoS Biology, 4(5):e112 (2006), following the SISDC method (see, Hiraga et al., J. Mol. Biol., 330:287-96 (2003)) using the type IIb restriction endonuclease BsaXI, ligating the full-length library into the pCWori vector and transforming into the catalase-deficient E. coli strain SN0037 (see, Nakagawa et al., Biosci. Biotechnol. Biochem., 60:415-420 (1996)); the disclosures of these references are hereby incorporated by reference in their entirety for all purposes.

[0234] As a non-limiting example, chimeric P450 proteins comprising recombined sequences or blocks of amino acids from CYP102A1 (Accession No. J04832), CYP102A2 (Accession No. CAB12544), and CYP102A3 (Accession No. U93874) can be constructed. In certain instances, the CYP102A1 parent sequence is assigned 1, the CYP102A2 parent sequence is assigned 2, and the CYP102A3 is parent sequence assigned 3. In some instances, each parent sequence is divided into eight sequence blocks containing the following amino acids (aa): block 1: aa 1-64; block 2: aa 65-122; block 3: aa 123-166; block 4: aa 167-216; block 5: aa 217-268; block 6: aa 269-328; block 7: aa 329-404; and block 8: aa 405-end. Thus, in this example, there are eight blocks of amino acids and three fragments are possible at each block. For instance, 12312312 refers to a chimeric P450 protein of the invention containing block 1 (aa 1-64) from CYP102A1, block 2 (aa 65-122) from CYP102,A2, block 3 (aa 123-166) from CYP102A3, block 4 (aa 167-216) from CYP102A1, block 5 (aa 217-268) from CYP102A2, and so on. See, e.g., Otey et al., PLoS Biology, 4(5):e112 (2006). Non-limiting examples of chimeric P450 proteins include those set forth in Table 5B (C2G9, X7, X7-12, C2E6, X7-9, C2B12, TSP234) and Table 13. In some embodiments, the chimeric heme enzymes of the invention can comprise at least one or more of the mutations described herein.

[0235] In some embodiments, the present invention provides the incorporation of homologous or analogous mutations to C400X (AxX) and/or T268A in other cytochrome P450 enzymes and heme enzymes in order to impart or enhance cyclopropanation activity.

[0236] As non-limiting examples, the cytochrome P450 can be a variant of CYP101A1 (SEQ ID NO:25) comprising a C357X (e.g., C357S) mutation, a T252A mutation, or a combination of C357X (e.g., C357S) and T252A mutations, wherein X is any amino acid other than Cys, or the cytochrome P450 can be a variant of CYP2B4 (SEQ ID NO:28) comprising a C436X (e.g., C436S) mutation, a T302A mutation, or a combination of C436X (e.g., C436S) and 1302A mutations, wherein X is any amino acid other than Cys, or the cytochrome P450 can be a variant of CYP2D7 (SEQ ID NO:26) comprising a C461X (e.g., C461S) mutation, wherein X is any amino acid other than Cys, or the cytochrome P450 can be a variant of P450C27 (SEQ ID NO:27) comprising a C478X (e.g., C478S) mutation, wherein X is any amino acid other than Cys.

[0237] An enzyme's total turnover number (or TTN) refers to the maximum number of molecules of a substrate that the enzyme can convert before becoming inactivated. In general, the TTN for the heme enzymes of the invention range from about 1 to about 100,000 or higher. For example, the TTN can be from about 1 to about 1,000, or from about 1,000 to about 10,000, or from about 10,000 to about 100,000, or from about 50,000 to about 100,000, or at least about 100,000. In particular embodiments, the TTN can be from about 100 to about 10,000, or from about 10,000 to about 50,000, or from about 5,000 to about 10,000, or from about 1,000 to about 5,000, or from about 100 to about 1,000, or from about 250 to about 1,000, or from about 100 to about 500, or at least about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 15,000, 20,000, 25,000, 30,000, 35,000, 40,000, 45,000 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, 100,000, or more. In certain embodiments, the variant or chimeric heme enzymes of the present invention have higher TTNs compared to the wild-type sequences. In some instances, the variant or chimeric heme enzymes have TTNs greater than about 100 (e.g., at least about 100, 150, 200, 250, 300, 325, 350, 400, 450, 500, or more) in carrying out in vitro cyclopropanation reactions. In other instances, the variant or chimeric heme enzymes have TTNs greater than about 1000 (e.g., at least about 1000, 2500, 5000, 10,000, 25,000, 50,000, 75,000, 100,000, or more) in carrying out in vivo whole cell cyclopropanation reactions.

[0238] When whole cells expressing a heme enzyme are used to carry out a cyclopropanation reaction, the turnover can be expressed as the amount of substrate that is converted to product by a given amount of cellular material. In general, in vivo cyclopropanation reactions exhibit turnovers from at least about 0.01 to at least about 10 mmol.Math.g.sub.cdw.sup.1, wherein g.sub.cdw is the mass of cell dry weight in grams. For example, the turnover can be from about 0.1 to about 10 mmol.Math.g.sub.cdw.sup.1, or from about 1 to about 10 mmol.Math.g.sub.cdw.sup.1, or from about 5 to about 10 mmol.Math.g.sub.cdw.sup.1, or from about 0.01 to about 1 mmol.Math.g.sub.cdw.sup.1, or from about 0.01 to about 0.1 mmol.Math.g.sub.cdw.sup.1, or from about 0.1 to about 1 mmol.Math.g.sub.cdw.sup.1, or greater than 1 mmol.Math.g.sub.cdw.sup.1. The turnover can be about 0.01, 0.015, 0.02, 0.025, 0.03, 0.035, 0.04, 0.045, 0.05, 0.055, 0.06, 0.065, 0.07, 0.075, 0.08, 0.085, 0.09, 0.095, 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, 0.5, 0.55, 0.6, 0.65, 0.7, 0.75, 0.8, 0.85, 0.9, 0.95, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, or about 10 mmol.Math.g.sub.cdw.sup.1.

[0239] When whole cells expressing a heme enzyme are used to carry out a cyclopropanation reaction, the activity can further be expressed as a specific productivity, e.g., concentration of product formed by a given concentration of cellular material per unit time, e.g., in g/L, of product per g/L of cellular material per hour (g g.sub.cdw.sup.1 h.sup.1). In general, in vivo cyclopropanation reactions exhibit specific productivities from at least about 0.01 to at least about 0.5 g.Math.g.sub.cdw.sup.1 h.sup.1, wherein g.sub.cdw is the mass of cell dry weight in grams. For example, the specific productivity can be from about 0.01 to about 0.1 g g.sub.cdw.sup.1 h.sup.1, or from about 0.1 to about 0.5 g g.sub.cdw.sup.1 h.sup.1, or greater than 0.5 g g.sub.cdw.sup.1 h.sup.1. The specific productivity can be about 0.01, 0.015, 0.02, 0.025, 0.03, 0.035, 0.04, 0.045, 0.05, 0.055, 0.06, 0.065, 0.07, 0.075, 0.08, 0.085, 0.09, 0.095, 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, or about 0.5 g g.sub.cdw.sup.1 h.sup.1.

[0240] In certain embodiments, mutations can be introduced into the target gene using standard cloning techniques (e.g., site-directed mutagenesis) or by gene synthesis to produce the heme enzymes (e.g., cytochrome P450 variants) of the present invention. The mutated gene can be expressed in a host cell (e.g., bacterial cell) using an expression vector under the control of an inducible promoter or by means of chromosomal integration under the control of a constitutive promoter. Cyclopropanation activity can be screened in vivo or in vitro by following product formation by GC or HPLC as described herein.

[0241] The expression vector comprising a nucleic acid sequence that encodes a heme enzyme of the invention can be a viral vector, a plasmid, a phage, a phagemid, a cosmid, a fosmid, a bacteriophage (e.g., a bacteriophage P1-derived vector (PAC)), a baculovirus vector, a yeast plasmid, or an artificial chromosome (e.g., bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a mammalian artificial chromosome (MAC), and human artificial chromosome (HAC)). Expression vectors can include chromosomal, non-chromosomal, and synthetic DNA sequences. Equivalent expression vectors to those described herein are known in the art and will be apparent to the ordinarily skilled artisan.

[0242] The expression vector can include a nucleic acid sequence encoding a heme enzyme that is operably linked to a promoter, wherein the promoter comprises a viral, bacterial, archaeal, fungal, insect, or mammalian promoter. In certain embodiments, the promoter is a constitutive promoter. In some embodiments, the promoter is an inducible promoter. In other embodiments, the promoter is a tissue-specific promoter or an environmentally regulated or a developmentally regulated promoter.

[0243] It is understood that affinity tags may be added to the N- and/or C-terminus of a heme enzyme expressed using an expression vector to facilitate protein purification. Non-limiting examples of affinity tags include metal binding tags such as His6-tags (SEQ ID NO:74) and other tags such as glutathione S-transferase (GST).

[0244] Non-limiting expression vectors for use in bacterial host cells include pCWori, pET vectors such as pET22 (EMD Millipore), pBR322 (ATCC37017), pQE vectors (Qiagen), pBluescript vectors (Stratagene), pNH vectors, lambda-ZAP vectors (Stratagene); ptrc99a, pKK223-3, pDR540, pRIT2T (Pharmacia), pRSET, pCR-TOPO vectors, pET vectors, pSyn_1 vectors, pChlamy_1 vectors (Life Technologies, Carlsbad, Calif.), pGEM1 (Promega, Madison, Wis.), and pMAL (New England Biolabs, Ipswich, Mass.). Non-limiting examples of expression vectors for use in eukaryotic host cells include pXT1, pSG5 (Stratagene), pSVK3, pBPV, pMSG, pSVLSV40 (Pharmacia), pcDNA3.3, pcDNA4/TO, pcDNA6/TR, pLenti6/TR, pMT vectors (Life Technologies), pKLAC1 vectors, pKLAC2 vectors (New England Biolabs), pQE vectors (Qiagen), BacPak baculoviral vectors, pAdeno-X adenoviral vectors (Clontech), and pBABE retroviral vectors. Any other vector may be used as long as it is replicable and viable in the host cell.

[0245] The host cell can be a bacterial cell, an archaeal cell, a fungal cell, a yeast cell, art insect cell, or a mammalian cell.

[0246] Suitable bacterial host cells include, but are not limited to, BL21 E. coli, DE3 strain E. coli, E. coli M15, DH5, DH10, HB101, T7 Express Competent E. coli (NEB), B. subtilis cells, Pseudomonas fluorescens cells, and cyanobacterial cells such as Chlamydomonas reinhardtii cells and Synechococcus elongates cells. Non-limiting examples of archaeal host cells include Pyrococcus furiosus, Metallosphera sedula, Thermococcus litoralis, Methanobacterium thermoautotrophicum, Methanococcus jannaschii, Pyrococcus abyss, Sulfolobus solfataricus, Pyrococcus woesei, Sulfolobus shibatae, and variants thereof. Fungal host cells include, but are not limited to, yeast cells from the genera Saccharomyces (e.g., S. cerevisiae), Pichia (P. Pastoris), Kluyveromyces (e.g., K. lactis), Hansenula and Yarrowia, and filamentous fungal cells from the genera Aspergillus, Trichoderma, and Myceliophthora. Suitable insect host cells include, but are not limited to, Sf9 cells from Spodoptera frugiperda, Sf21 cells from Spodoptera frugiperda, Hi-Five cells, BTI-TN-5B1-4Trichophusia ni cells, and Schneider 2 (S2) cells and Schneider 3 (S3) cells from Drosophila melanogaster. Non-limiting examples of mammalian host cells include HEK293 cells, HeLa cells, CHO cells, COS cells, Jurkat cells, NS0 hybridoma cells, baby hamster kidney (BHK) cells, MDCK cells, NIH-3T3 fibroblast cells, and any other immortalized cell line derived from a mammalian cell.

[0247] In certain embodiments, the present invention provides heme enzymes such as the P450 variants described herein that are active cyclopropanation catalysts inside living cells. As a non-limiting example, bacterial cells (e.g., E. coli) can be used as whole cell catalysts for the in vivo cyclopropanation reactions of the present invention. In some embodiments, whole cell catalysts containing P450 enzymes with the equivalent C400X mutation are found to significantly enhance the total turnover number (TTN) compared to in vitro reactions using isolated P450 enzymes.

[0248] B. Compounds

[0249] The methods of the invention can be used to provide a number of cyclopropanation products. The cyclopropanation products include several classes of compound including, but not limited to, commodity and fine chemicals, flavors and scents, insecticides, and active ingredients in pharmaceutical compositions. The cyclopropanation products can also serve as starting materials or intermediates for the synthesis of compounds belonging to these and other classes.

[0250] In some embodiments, the cyclopropanation product is a compound according to formula I

##STR00017##

[0251] For compounds of Formula I, R.sup.1 is independently selected from H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, halo, cyano, C(O)OR.sup.1a, C(O)N(R.sup.7).sub.2, C(O)R.sup.8, C(O)C(O)OR.sup.8, and Si(R.sup.8).sub.3; and R.sup.2 is independently selected from H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, halo, cyano, C(O)OR.sup.2a, C(O)N(R.sup.7).sub.2, C(O)R.sup.8, C(O)C(O)OR.sup.8, and Si(R.sup.8).sub.3. R.sup.1a and R.sup.2a are independently selected from H, optionally substituted C.sub.1-18 alkyl and LR.sup.C.

[0252] When the moiety LR.sup.C is present, L is selected from a bond, C(R.sup.L).sub.2, and NR.sup.LC(R.sup.L).sub.2. Each R.sup.L is independently selected from H, C.sub.1-6 alkyl, halo, CN, and SO.sub.2, and each R.sup.C is selected from optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroraryl, and optionally substituted 6- to 10-membered heterocyclyl.

[0253] For compounds of Formula I, R.sup.3, R.sup.4, R.sup.5 and R.sup.6 are independently selected from H, C.sub.1-18 alkyl, C.sub.2-18 alkenyl, C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted C.sub.1-C.sub.6 alkoxy, halo, hydroxy, cyano, C(O)N(R.sup.7).sub.2, NR.sup.7C(O)R.sup.8, C(O)R.sup.8, C(O)OR.sup.8, and N(R.sup.9).sub.2. Each R.sup.7 and R.sup.8 is independently selected from H, optionally substituted C.sub.1-12 alkyl, optionally substituted C.sub.2-12 alkenyl, and optionally substituted C.sub.6-10 aryl. Each R.sup.9 is independently selected from H, optionally substituted C.sub.6-10 aryl, and optionally substituted 6- to 10-membered heteroaryl. Alternatively, two R.sup.9 moieties, together with the nitrogen atom to which they are attached, can form 6- to 18-membered heterocyclyl.

[0254] Alternatively, R.sup.3 forms an optionally substituted 3- to 18-membered ring with R.sup.4, or R.sup.5 forms an optionally substituted 3-to 18-membered ring with R.sup.3 or R.sup.4 can also form a double bond with R.sup.5 or R.sup.6, R.sup.3 or R.sup.4 forms an optionally substituted 5- to 6-membered ring with R.sup.5 or R.sup.6.

[0255] In some embodiments, the cyclopropanation product is a compound of formula I as described above, wherein R.sup.1 is C(O)OLR.sup.c; R.sup.2 is selected from H and optionally substituted C.sub.6-10 aryl; and R.sup.3, R.sup.4, R.sup.5, and R.sup.6 are independently selected from H, optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.2-6 alkynyl, optionally substituted C.sub.6-10 aryl, and halo. Alternatively, R.sup.3 can form an optionally substituted 3-to 18-membered ring with R.sup.4, or R.sup.5 can form an optionally substituted 3-to 18-membered ring with R.sup.6. In such embodiments, the cyclopropanation product can be a pyrethroid or a pyrethroid precursor.

[0256] In general, pyrethroids are characterized by an ester core having a structure according to Formula III:

##STR00018##

[0257] Formula III is presented above as a cyclopropyl carboxylate moiety (A) esterified with an LR.sup.1c moiety (B), with R.sup.1c defined as for R.sup.C. The methods of the invention can be used to prepare pyrethroids and pyrethroid intermediates having a variety of A moieties connected to any of a variety of B moieties. For example, the pyrethroids can have an A moiety selected from:

##STR00019## ##STR00020## ##STR00021## ##STR00022##

[0258] For the A moieties listed above, X.sup.1 is selected from H, optionally substituted C.sub.1-6 alkyl, haloC.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkoxy, haloC.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkylthio, C.sub.1-6 alkylsilyl, halo, and cyano. X.sup.2 is selected from H, chloro, and methyl. X.sup.3 is selected from H, methyl, halo, and CN. Each X.sup.4 is independently halo. Each X.sup.5 is independently selected from methyl and halo. X.sup.6 is selected from halo, optionally substituted C.sub.1-6 alkyl, and optionally substituted C.sub.1-6 alkoxy. X.sup.7 is selected from H, methyl, and halo. X.sup.8 is selected from H, halo, and optionally substituted. C.sub.1-6 alkyl. X.sup.9 is selected from H, halo, optionally substituted C.sub.1-6 alkyl, C(O)O(C.sub.1-6 alkyl), C(O)N(C.sub.1-6 alkyl).sub.2, and cyano. Z.sup.1, Z.sup.2, and Z.sup.3 are independently selected from H, halo, optionally substituted C.sub.1-6 alkyl, and optionally substituted C.sub.6-10 aryl, or Z.sup.1 and Z.sup.2 are taken together to form an optionally substituted 5- to 6-membered cycloalkyl or heterocyclyl group. The wavy line at the right of each structure represents the point of connection between the A moiety and a B moiety.

##STR00023## ##STR00024##

[0259] For the B moieties listed above, each Y.sup.1 is independently selected from optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.2-6 alkynyl, phenyl, and (phenyl)C.sub.1-6 alkoxy. Each Y.sup.2 is independently selected from halo, optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.1-6 alkoxy, and nitro. Each Y.sup.3 is independently optionally substituted C.sub.1-6 alkyl. Each Y.sup.4 is independently selected from optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.2-6 alkynyl, C.sub.6-10 aryl-C.sub.1-6 alkyl, furfuryl, C.sub.1-6 alkoxy, (C.sub.2-6 alkenyl)oxy, C.sub.1-12 acyl, and halo. Y.sup.5 is selected from the group consisting of optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkoxy, and halo. The subscript m is an integer from 1 to 3, the subscript n is an integer from 1 to 5, the subscript p is an integer from 1 to 4, and the subscript q is an integer from 0 to 3. The wavy line at the left of each structure represents the point of connection between the B moiety and an A moiety.

[0260] The methods of the invention can be used to prepare pyrethroids having any A moiety joined to any B moiety. A given pyrethroid can have a structure selected from: A1-B1, A2-B1, A3-B1, A4-B1, A5-B1, A6-B1, A7-B1, A8-B1, A9-B1, A10-B1, A11-B1, A12-B1, A13-B1, A14-B1, A15-B1, A16-B1, A17-B1, A18-B1, A19-B1, A20-B1, A21-B1, A22-B1, A23-B1, A24-B1, A25-B1, A26-B1, A27-B1, A28-B1, A29-B1, A30-B1, A31-B1, A32-B1, A33-B1, A1-B2, A2-B2, A3-B2, A4-B2, A5-B2, A6-B2, A7-B2, A8-B2, A9-B2, A10-B2, A11-B2, A12-B2, A13-B2, A14-B2, A15-B2, A16-B2, A17-B2, A18-B2, A19-B2, A20-B2, A21-B2, A22-B2, A23-B2, A24-B2, A25-B2, A26-B2, A27-B2, A28-B2, A29-B2, A30-B2, A31-B2, A32-B2, A33-B2, A1-B3, A2-B3, A3-B3, A4-B3, A5-B3, A6-B3, A7-B3, A8-B3, A9-B3, A10-B3, A11-B3, A12-B3, A13-B3, A14-B3, A15-B3, A16-B3, A17-B3, A18-B3, A19-B3, A20-B3, A21-B3, A22-B3, A23-B3, A24-B3, A25-B3, A26-B3, A27-B3, A28-B3, A29-B3, A30-B3, A31-B3, A32-B3, A33-B3, A1-B4, A2-B4, A3-B4, A4-B4, A5-B4, A6-B4, A7-B4, A8-B4, A9-B4, A10-B4, A11-B4, A12-B4, A13-B4, A14-B4, A15-B4, A16-B4, A17-B4, A18-B4, A19-B4, A20-B4, A21-B4, A22-B4, A23-B4, A24-B4, A25-B4, A26-B4, A27-B4, A28-B4, A29-B4, A30-B4, A31-B4, A32-B4, A33-B4, A1-B5, A2-B5, A3-B5, A4-B5, A5-B5, A6-B5, A7-B5, A8-B5, A9-B5, A10-B5, A11-B5, A12-B5, A13-B5, A14-B5, A15-B5, A16-B5, A17-B5, A18-B5, A19-B5, A20-B5, A21-B5, A22-B5, A23-B5, A24-B5, A25-B5, A26-B5, A27-B5, A28-B5, A29-B5, A30-B5, A31-B5, A32-B5, A33-B5, A1-B6, A2-B6, A3-B6, A4-B6, A5-B6, A6-B6, A7-B6, A8-B6, A9-B6, A10-B6, A11-B6, A12-B6, A13-B6, A14-B6, A15-B6, A16-B6, A17-B6, A18-B6, A19-B6, A20-B6, A21-B6, A22-B6, A23-B6, A24-B6, A25-B6, A26-B6, A27-B6, A28-B6, A29-B6, A30-B6, A31-B6, A32-B6, A33-B6, A1-B7, A2-B7, A3-B7, A4-B7, A5-B7, A6-B7, A7-B7, A8-B7, A9-B7, A10-B7, A11-B7, A12-B7, A13-B7, A14-B7, A15-B7, A16-B7, A17-B7, A18-B7, A19-B7, A20-B7, A21-B7, A22-B7, A23-B7, A24-B7, A25-B7, A26-B7, A27-B7, A28-B7, A29-B7, A30-B7, A31-B7, A32-B7, A33-B7, A1-B8, A2-B8, A3-B8, A4-B8, A5-B8, A6-B8, A7-B8, A8-B8, A9-B8, A10-B8, A11-B8, A12-B8, A13-B8, A14-B8, A15-B8, A16-B8, A17-B8, A18-B8, A19-B8, A20-B8, A21-B8, A22-B8, A23-B8, A24-B8, A25-B8, A26-B8, A27-B8, A28-B8, A29-B8, A30-B8, A31-B8, A32-B8, A33-B8, A1-B9, A2-B9, A3-B9, A4-B9, A5-B9, A6-B9, A7-B9, A8-B9, A9-B9, A10-B9, A11-B9, A12-B9, A13-B9, A14-B9, A15-B9, A16-B9, A17-B9, A18-B9, A19-B9, A20-B9, A21-B9, A22-B9, A23-B9, A24-B9, A25-B9, A26-B9, A27-B9, A28-B9, A29-B9, A30-B9, A31-B9, A32-B9, A33-B9, A1-B10, A2-B10, A3-B10, A4-B10, A5-B10, A6-B10, A7-B10, A8-B10, A9-B10, A10-B10, A11-B10, A12-B10, A13-B10, A14-B10, A15-B10, A16-B10, A17-B10, A18-B10, A19-B10, A20-B10, A21-B10, A22-B10, A23-B10, A24-B10, A25-B10, A26-B10, A27-B10, A28-B10, A29-B10, A30-B10, A31-B10, A32-B10, A33-B10, A1-B11, A2-B11, A3-B11, A4-B11, A5-B11, A6-B11, A7-B11, A8-B11, A9-B11, A10-B11, A12-B11, A13-B11, A14-B11, A15-B11, A16-B11, A17-B11, A18-B11,A19-B11, A20-B11, A21-B11, A22-B11, A23-B11, A24-B11, A25-B11, A26-B11, A27-B11, A28-B11, A29-B11, A30-B11, A31-B11, A32-B11, A33-B11, A1-B12, A2-B12, A3-B12, A4-B12, A5-B12, A6-B12, A7-B12, A8-B12, A9-B12, A10-B12, A11-B12, A12-B12, A13-B12, A14-B12, A15-B12, A16-B12, A17-B12, A18-B12, A19-B12, A20-B12, A21-B12, A22-B12, A23-B12, A24-B12, A25-B12, A26-B12, A27-B12, A28-B12, A29-B12, A30-B12, A31-B12, A32-B12, A33-B12, A1-B13, A2-B13, A3-B13, A4-B13, A5-B13, A6-B13, A7-B13, A8-B13, A9-B13, A10-B13, A11-B13, A12-B13, A13-B13, A14-B13, A15-B13, A16-B13, A17-B13, A18-B13, A19-B13, A20-B13, A21-B13, A22-B13, A23-B13, A24-B13, A25-B13, A26-B13, A27-B13, A28-B13, A29-B13, A30-B13, A31-B13, A32-B13, A33-B13, A1-B14, A2-B14, A3-B14, A4-B14, A5-B14, A6-B14, A7-B14, A8-B1.4, A9-B14, A10-B14, A11-B14, A12-B14, A13-B14, A14-B14, A15-B14, A16-B14, A17-B14, A18-B14, A19-B14, A20-B14, A21-B14, A22-B14, A23-B14, A24-B14, A25-B14, A26-B14, A27-B14, A28-B14, A29-B14, A30-B14, A31-B14, A32-B14, A33-B14, A1-B15, A2-B15, A3-B15, A4-B15, A5-B15, A6-B15, A7-B15, A8-B15, A9-B15A,10-B15, A11-B15, A12-B15, A13-B15, A14-B15, A15-B15, A16-B15, A17-B15, A18-B15, A19-B15, A20-B15, A21-B15, A22-B15, A23-B15, A24-B15, A25-B15, A26-B15, A27-B15, A28-B15, A29-B15, A30-B15, A31-B15, A32-B15, A33-B15, A1-B16, A2-B16, A3-B16, A4-B16, A5-B16, A6-B16, A7-B16, A8-B16, A9-B16, A10-B16, A11-B16, A12-B16, A13-B16, A14-B16, A15-B16, A16-B16, A17-B16, A18-B16, A19-B16, A20-B16, A21-B16, A22-B16, A23-B16, A24-B16, A25-B16, A26-B16, A27-B16, A28-B16, A29-B16, A30-B16, A31-B16, A32-B16, A33-B16, A1-B17, A2-B17, A3-B17, A4-B17, A5-B17, A6-B17, A7-B17, A8-B17, A9-B17, A10-B17, A11-B17, A12-B17, A13-B17, A14-B17, A15-B17, A16-B17, A17-B17, A18-B17, A19-B17, A20-B17, A21-B17, A22-B17, A23-B17, A24-B17, A25-B17, A26-B17, A27-B17, A28-B17, A29-B17, A30-B17, A31-B17, A32-B17, A33-B17, A1-B18, A2-B18, A3-B18, A4-B18, A5-B18, A6-B18, A7-B18 A8-B18, A9-B18, A10-B18, A11-B18, A12-B18, A13-B18, A14-B18, A15-B18, A16-B18, A17-B18, A18-B18, A19-B18 A20-B18, A21-B18, A22-B18, A23-B18, A24-B18 A25-B18, A26-B18, A27-B18, A28-B18, A29-B18, A30-B18, A31-B18, A32-B18, A33-B18, A2-B19, A3-B19, A4-B19, A5-B19, A6-B19, A7-B19, A8-B19, A9-B19, A10-B19, A11-B19, A12-B19, A13-B19, A14-B19, A15-B19, A16-B19, A17-B19, A18-B19, A19-B19, A20-B19, A21-B19, A22-B19, A23-B19, A24-B19, A25-B19, A26-B19, A27-B19, A28-B19, A29-B19, A30-B19, A31-B19, A32-B19, A33-B19, A1-B20,, A2-B20, A3-B20, A4-B20, A5-B20, A6-B20, A7-B20, A8-B20, A9-B20, A10-B20, A11-B20, A12-B20, A13-B20, A14-B20, A15-B20, A16-B20, A17-B20, A18-B20, A19-B20, A20-B20, A21-B20, A22-B20, A23-B20, A24-B20, A25-B20, A26-B20, A27-B20, A28-B20, A29-B20, A30-B20, A31-B20, A32-B20, A33-B20, A1-B21, A2-B21, A3-B21, A4-B21, A5-B21, A6-B21, A7-B21, A8-B21, A9-B21, A10-B21, A11-B21, A12-B21, A13-B21, A14-B21, A15-B21, A16-B21, A17-B21, A18-B21, A19-B21, A20-B21, A21-B21, A22-B21, A23-B21, A24-B21, A25-B21, A26-B21, A27-B21, A28-B21, A29-B21, A30-B21, A31-B21, A32-B21, A33-B21, A1-B22, A2-B22, A3-B22, A4-B22, A5-B22, A6-B22, A7-B22, A8-B22, A9-B22, A10-B22, A11-B22, A12-B22, A13-B22, A14-B22, A15-B22, A16-B22, A17-B22, A18-B22, A19-B22, A20-B22, A21-B22, A22-B22, A23-B22, A24-B22, A25-B22, A26-B22, A27-B22, A28-B22, A29-B22, A30-B22, A31-B22, A32-B22, A33-B22, A1-B23, A2-B23, A3-B23, A4-B23, A5-B23, A6-B23, A7-B23, A8-B23, A9-B23, A10-B23, A11-B23, A12-B23, A13-B23, A14-B23, A15-B23, A16-B23, A17-B23, A18-B23, A19-B23, A20-B23, A21-B23, A22-B23, A23-B23, A24-B23, A25-B23, A26-B23, A27-B23, A28-B23, A29-B23, A30-B23, A31-B23, A32-B23, A33-B23, A1-B24, A2-B24, A3-B24, A4-B24, A5-B24, A6-B24, A7-B24, A8-B24, A9-B24, A10-B24, A11-B24, A12-B24, A13-B24, A14-B24, A15-B24, A16-B24, A17-B24, A18-B24, A19-B24, A20-B24, A21-B24, A22-B24, A23-B24, A24-B24, A25-B24, A26-B24, A27-B24, A28-B24, A29-B24, A30-B24, A31-B24, A32-B24, A33-B24, A1-B25, A2-B25, A3-B25, A4-B25, A5-B25, A6-B25, A7-B25, A8-B25, A9-B25, A10-B25, A11-B25, A12-B25, A13-B25, A14-B25, A15-B25, A16-B25, A17-B25, A18-B25, A19-B25, A20-B25, A21-B25, A22-B25, A23-B25, A24-B25, A25-B25, A26-B25, A27-B25, A28-B25, A29-B25, A30-B25, A31-B25, A32-B25, A33-B25, A1-B26, A2-B26, A3-B26, A4-B26, A5-B26, A6-B26, A7-B26, A8-B26, A9-B26, A10-B26, A11-B26, A12-B26, A13-B26, A14-B26, A15-B26, A16-B26, A17-B26, A18-B26, A19-B26, A20-B26, A21-B26, A22-B26, A23-B26, A24-B26, A25-B26, A26-B26, A27-B26, A28-B26, A29-B26, A30-B26, A31-B26, A32-B26, A33-B26, A1-B27, A2-B27, A3-B27, A4-B27, A5-B27, A6-B27, A7-B27, A8-B27, A9-B27, A10-B27, A11-B27, A12-B27, A13-B27, A14-B27, A15-B27, A16-B27, A17-B27, A18-B27, A19-B27, A20-B27, A21-B27, A22-B27, A23-B27, A24-B27, A25-B27, A26-B27, A27-B27, A28-B27, A29-B27, A30-B27, A31-B27, A32-B27, A33-B27, A1-B28, A2-B28, A3-B28, A4-B28, A5-B28, A6-B28, A7-B28, A8-B28, A9-B28, A10-B28, A11-B28, A12-B28, A13-B28, A14-B28, A15-B28, A16-B28, A17-B28, A18-B28, A20-B28, A21-B28, A22-B28, A23-B28, A24-B28, A25-B28, A26-B28, A27-B28, A28-B28, A29-B28, A30-B28, A31-B28, A32-B28, A33-B28, A1-B29, A2-B29, A3-B29, A4-B29, A5-B29, A6-B29, A7-B29, A8-B29, A9-B29, A10-B29, A11-B29, A12-B29, A13-B29, A14-B29, A15-B29, A16-B29, A17-B29, A18-B29, A19-B29, A20-B29, A21-B29, A22-B29, A23-B29, A24-B29, A25-B29, A26-B29, A27-B29, A28-B29, A29-B29, A30-B29, A31-B29, A32-B29, A33-B29, A1-B30, A2-B30, A3-B30, A4-B30, A5-B30, A6-B30, A7-B30, A8-B30, A9-B30, A10-B30, A11-B30, A12-B30, A13-B30, A14-B30, A15-B30, A16-B30, A17-B30, A18-B30, A19-B30, A20-B30, A21-B30, A22-B30, A23-B30, A24-B30, A25-B30, A26-B30, A27-B30, A28-B30, A29-B30, A30-B30, A31-B30, A32-B30, A33-B30, A1-B31, A2-B31, A3-B31, A4-B31, A5-B31, A6-B31, A7-B31, A8-B31, A9-B31, A10-B31, A11-B31, A12-B31, A13-B31, A14-B31, A15-B31, A16-B31, A17-B31, A18-B31, A19-B31, A20-B31, A21-B31, A22-B31, A23-B31, A24-B31, A25-B31, A26-B31, A27-B31, A28-B31, A29-B31, A30-B31, A31-B31, A32-B31, A33-B31, A1-B32, A2-B32, A3-B32, A4-B32, A5-B32, A6-B32, A7-B32, A8-B32, A9-B32, A10-B32, A11-B32, A12-B32, A13-B32, A14-B32, A15-B32, A16-B32, A17-B32, A18-B32, A19-B32, A20-B32, A21-B32, A22-B32, A23-B32, A24-B32, A25-B32, A26-B32, A27-B32, A28-B32, A29-B32, A30-B32, A31-B32, A32-B32, A33-B32, A1-B33, A2-B33, A3-B33, A4-B33, A5-B33, A6-B33, A7-B33, A8-B33, A9-B33, A10-B33, A11-B33, A12-B33, A13-B33, A14-B33, A15-B33, A16-B33, A17-B33, A18-B33, A19-B33, A20-B33, A21-B33, A22-B33, A23-B33, A24-B33, A25-B33, A26-B33, A27-B33, A28-B33, A29-B33, A30-B33, A31-B33, A32-B33, A33-B33, A1-B34, A2-B34, A3-B34, A4-B34, A5-B34, A6-B34, A7-B34, A8-B34, A9-B34, A10-B34, A11-B34, A12-B34, A13-B34, A14-B34, A15-B34, A16-B34, A17-B34, A18-B34, A19-B34, A20-B34, A21-B34, A22-B34, A23-B34, A24-B34, A25-B34, A26-B34, A27-B34, A28-B34, A29-B34, A30-B34, A31-B34, A32-B34, A33-B34, A1-B35, A2-B35, A3-B35, A4-B35, A5-B35, A6-B35, A7-B35, A8-B35, A9-B35, A10-B35, A11-B35, A12-B35, A13-B35, A14-B35, A15-B35, A16-B35, A17-B35, A18-B35, A19-B35, A20-B35, A21-B35, A22-B35, A23-B35, A24-B35, A25-B35, A26-B35, A27-B35, A28-B35, A29-B35, A30-B35, A31-B35, A32-B35, A33-B35, A1-B36, A2-B36, A3-B36, A4-B36, A5-B36, A6-B36, A7-B36, A8-B36, A9-B36, A10-B36, A11-B36, A12-B36, A13-B36, A14-B36, A15-B36, A16-B36, A17-B36, A18-B36, A19-B36, A20-B36, A21-B36, A22-B36, A23-B36, A24-B36, A25-B36, A26-B36, A27-B36, A28-B36, A29-B36, A30-B36, A31-B36, A32-B36, A33-B36, A1-B37, A2-B37, A3-B37, A4-B37, A5-B37, A6-B37, A7-B37, A8-B37, A9-B37, A10-B37, A11-B37, A12-B37, A13-B37, A14-B37, A15-B37, A16-B37, A17-B37, A18-B37, A19-B37, A20-B37, A21-B37, A22-B37, A23-B37, A24-B37, A25-B37, A26-B37, A27-B37, A28-B37, A29-B37, A30-B37, A31-B37, A32-B37, A33-B37, A1-B38, A2-B38, A3-B38, A4-B38, A5-B38, A6-B38, A7-B38, A8-B38, A9-B38, A10-B38, A11-B38, A12-B38, A13-B38, A14-B38, A15-B38, A16-B38, A17-B38, A18-B38, A19-B38, A20-B38, A21-B38, A22-B38, A23-B38, A24-B38, A25-B38, A26-B38, A27-B38, A28-B38, A29-B38, A30-B38, A31-B38, A32-B38, A33-B38, A2-B39, A3-B39, A4-B39, A5-B39, A6-B39, A7-B39, A8-B39, A9-B39, A10-B39, A11-B39, A12-B39, A13-B39, A14-B39, A15-B39, A16-B39, A17-B39, A18-B39, A19-B39, A20-B39, A21-B39, A22-B39, A23-B39, A24-B39, A25-B39, A26-B39, A27-B39, A28-B39, A29-B39, A30-B39, A31-B39, A32-B39, and A33-B39. The A moiety is joined to the B moiety to form the ester bond as shown in Formula Ill above.

[0261] A pyrethroid prepared according to the methods of the invention can have, for example, a structure selected from:

##STR00025##

Z.sup.1, Z.sup.2, and Z.sup.3 are independently selected from H, halo, optionally substituted C.sub.1-6 alkyl, and optionally substituted C.sub.6-10 aryl. Z.sup.1 and Z.sup.2 can also be taken together to form an optionally substituted 5- to 6-membered cycloalkyl or heterocyclyl group.

[0262] In some embodiments, the methods of the invention can be used to prepare pyrethroid intermediate compounds that can be converted to the pyrethroid compounds described above. Alkyl esters of cyclopropanecarboxylic acid and cyclopropanecarboxylic acid derivatives can be converted to a variety of pyrethroid compounds via reaction with appropriate alcohols.

[0263] Accordingly, some embodiments of the invention provide methods as wherein the cyclopropanation product is a compound according to formula II:

##STR00026##

For compounds of formula II: R.sup.1a is C.sub.1-6 alkyl and R.sup.2 is selected from H and optionally substituted C.sub.6-10 aryl. In some embodiments, R.sup.2 is H. In some embodiments, the compound of formula II is selected from:

##STR00027## ##STR00028## ##STR00029##

[0264] In such embodiments, X.sup.1 is selected from H, optionally substituted C.sub.1-6 alkyl, haloC.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkoxy, optionally substituted C.sub.1-6 alkylthio, C.sub.1-6 alkylsilyl, halo, and cyano. X.sup.2 is selected from H, chloro, and methyl. X.sup.3 is selected from H, methyl, halo, and CN. Each X.sup.4 is independently halo. Each X.sup.5 is independently selected from methyl and halo. X.sup.6 is selected from halo, optionally substituted C.sub.1-6 alkyl, and optionally substituted C.sub.1-6 alkoxy. X.sup.7 is selected from H, methyl, and halo. X.sup.8 is selected from H, halo, and optionally substituted C.sub.1-6 alkyl, X.sup.9 is selected from H, halo, optionally substituted C.sub.1-6 alkyl, C(O)O(C.sub.1-6 alkyl), C(O)N(C.sub.1-6 alkyl).sub.2, and cyano. Z.sup.1, Z.sup.2, and Z.sup.3 are independently selected from H, halo, optionally substituted C.sub.1-6 alkyl, and optionally substituted C.sub.6-10 aryl. Z.sup.1 and Z.sup.2 can also be taken together to form an optionally substituted 5- to 6-membered cycloalkyl or heterocyclyl group

[0265] In some embodiments, the methods of the invention include converting the cyclopropanation product according to formula II to a compound according to formula III:

##STR00030##

[0266] For compounds of formula III, L is selected from a bond, C(R.sup.L).sub.2 and NR.sup.LC(R.sup.L).sub.2. Each R.sup.L is independently selected from H, CN, and SO.sub.2. R.sup.1c is selected from optionally subsistuted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroraryl, and optionally substituted 6- to 10-membered heterocyclyl. In some embodiments, L in the compounds of formula III is selected from a bond, CH.sub.2, CH(CN), and N(SO.sub.2)CH.sub.2.

[0267] In some embodiments, the moiety LR.sup.1c in the compounds according to formula III has a structure selected from:

##STR00031## ##STR00032## ##STR00033##

[0268] In such embodiments, each Y.sup.1 is independently selected from optionally substituted. C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.2-6 alkynyl, phenyl, and (phenyl)C.sub.1-6 alkoxy. Each Y.sup.2 is independently selected from halo, optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.1-6 alkoxy, and nitro. Each Y.sup.3 is independently optionally substituted C.sub.1-6 alkyl. Each Y.sup.4 is independently selected from optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.2-6 alkenyl, optionally substituted C.sub.2-6 alkynyl, C.sub.6-10 aryl-C.sub.1-6 alkyl, furfuryl, C.sub.1-6 alkoxy, (C.sub.2-6 alkenyl)oxy, C.sub.1-12 acyl, and halo. Y.sup.5 is selected from the group consisting of optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkoxy, and halo. The subscript m is an integer from 1 to 3, the subscript n is an integer from 1 to 5, the subscript p is an integer from 1 to 4, and the subscript q is an integer from 0 to 3. The wavy line at the left of each structure represents the point of connection between the moiety and the rest of the compound according to formula III.

[0269] In some embodiments, the compound of formula III is selected from:

##STR00034##

[0270] In some embodiments, the compound of formula III is resmethrin.

[0271] As for the pyrethroids discussed herein, a number of other compounds can be synthesized via processes that include a cyclopropanation product. Such processes are generalized in Scheme 1 showing the enzyme-catalyzed formation of a cyclopropanation product from an olefinic substrate and a diazo reagent, followed by chemical conversion of to a final product such as a pharmaceutical agent. Depending on the particular final product, the process can include conversion of the cyclopropanation product to one or more synthetic intermediates prior to preparation of the final product. Non-limiting examples of cyclopropanation products useful in such processes are summarized in Table 6.

##STR00035##

TABLE-US-00007 TABLE 6 Cyclopropanation for synthesis of intermediates en route to biologically active compounds. Cyclopropanation Olefinic Substrate Diazo Reagent Product/Intermediate Final Product [00036]embedded image [00037]embedded image [00038]embedded image milnacipran [00039]embedded image [00040]embedded image milnacipran [00041]embedded image [00042]embedded image [00043]embedded image milinacipran; bicifidine; 1-(3,4- dichloro- phenyl)-3- azabi- cyclo[3.1.0] hexane [00044]embedded image [00045]embedded image [00046]embedded image milinacipran; bicifidine; 1-(3,4- dichloro- phenyl)-3- azabi- cyclo[3.1.0] hexane [00047]embedded image [00048]embedded image [00049]embedded image cilastain [00050]embedded image [00051]embedded image [00052]embedded image boceprevir [00053]embedded image [00054]embedded image [00055]embedded image boceprevir [00056]embedded image [00057]embedded image [00058]embedded image boceprevir [00059]embedded image [00060]embedded image [00061]embedded image 1R,2S- fluorocyclo- propyl- amine, sitafloxacin [00062]embedded image [00063]embedded image [00064]embedded image 1R,2S- fluorocyclo- propyl- amine, sitafloxacin [00065]embedded image [00066]embedded image [00067]embedded image anthoplalone, norantho- plone [00068]embedded image [00069]embedded image [00070]embedded image odanacatib [00071]embedded image [00072]embedded image [00073]embedded image odanacatib [00074]embedded image [00075]embedded image [00076]embedded image montekulast [00077]embedded image [00078]embedded image [00079]embedded image montekulast [00080]embedded image [00081]embedded image [00082]embedded image carene [00083]embedded image [00084]embedded image [00085]embedded image pyrethrin II

[0272] In some embodiments, the cyclopropanation product is a compound having a structure according to the formula:

##STR00086##

wherein R.sup.1a is optionally substituted C.sub.1-6 alkyl, and R.sup.5 and R.sup.6 are independently selected from H, optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.6-10 aryl, C(O)N(R.sup.7).sub.2, C(O)OR.sup.8 and NR.sup.7C(O)R.sup.8.

[0273] In some embodiments, the cyclopropanation product has the structure selected from:

##STR00087##

In such embodiments, the methods of the invention can include converting the cyclopropanation product to a compound selected from milcanipran, levomilnacipran, bicifadine, and 1-(3,4-dichlorophenyl)-3-azabicyclo[3.1.0]hexane.

[0274] The methods of the invention can be used to prepare several different types of compounds having cyclopropane functional groups. The compounds include, but are not limited to, pharmaceutical agents having chiral cyclopropane moieties, pharmaceutical agents having achiral cyclopropane moieties, insecticides, plant hormones, flavors, scents, and fatty acids.

[0275] In some embodiments, the methods of the invention are used to prepare a compound selected from:

##STR00088## ##STR00089## ##STR00090##

[0276] Synthesis of prostratin, a protein kinase C activator, is shown as a non-limiting example in Scheme 2. The prostratin cyclopropane moiety can be installed by heme enzyme-catalyzed intramolecular or intermolecular cyclopropanation reactions.

##STR00091##

[0277] Some embodiments of the invention provide a method as described above, wherein the olefinic substrate is selected from the group consisting of an alkene, a cycloalkane, and an arylalkene. In some embodiments, the olefinic substrate is an arylalkene. In some embodiments, the arylalkene is a styrene.

[0278] In some embodiments, the styrene has the formula:

##STR00092##

R.sup.3 is selected from the H, optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 alkoxy, C(O)N(R.sup.7).sub.2, C(O)OR.sup.8, N(R.sup.9).sub.2, halo, hydroxy, and cyano. R.sup.5 and R.sup.6 are independently selected from H, optionally substituted C.sub.1-6 alkyl, and halo. R.sup.10 is selected from optionally substituted C.sub.1-C.sub.6 alkyl, optionally substituted C.sub.1-C.sub.6 alkoxy, halo, and haloalkyl, and the subscript r is an integer from 0 to 2.

[0279] In general, the diazo reagents useful in the methods of the invention have the structure:

##STR00093##

wherein R.sup.1 and R.sup.2 are defined as for the cyclopropanation products. Any diazoreagent can be added to the reaction as a reagent itself, or the diazoreagent can be prepared in situ.

[0280] In some embodiments, the diazo reagent is selected from an -diazoester, an -diazoamide, an -diazonitrile, an -diazoketone, an -diazoaldehyde, and an -diazosilane. In some embodiments, the diazo reagent has a formula selected from:

##STR00094##

wherein R.sup.1a is selected from H and optionally substituted C.sub.1-C.sub.6 alkyl; and each R.sup.7 and R.sup.8 is independently selected from H, optionally substituted C.sub.1-12 alkyl, optionally substituted C.sub.2-12 alkenyl, and optionally substituted C.sub.6-10 aryl.

[0281] In some embodiments, the diazo reagent is selected from the group consisting of diazomethane, ethyl diazoacetate, and (trimethylsilyl)diazomethane.

[0282] In some embodiments, the diazo reagent is an -diazoester. In some embodiments, the diazo reagent has the formula:

##STR00095##

[0283] In some embodiments, the cyclopropanation product has a formula selected from:

##STR00096##

[0284] One of skill in the art will appreciate that stereochemical configuration of the cyclopropanation product will be determined in part by the orientation of the diazo reagent with respect to the position of an olefinic substrate such as styrene during the cyclopropanation step. For example, any substituent originating from the olefinic substrate can be positioned on the same side of the cyclopropyl ring as a substituent origination from the diazo reagent. Cyclopropanation products having this arrangement are called cis compounds or Z compounds. Any substituent originating from the olefinic substrate and any substituent originating from the diazo reagent can also be on opposite sides of the cyclopropyl ring. Cyclopropanation products having this arrangement are called trans compounds or E compounds. An example of such arrangements is shown in the reaction scheme of FIG. 29.

[0285] As shown in FIG. 29, two cis isomers and two trans isomers can arise from the reaction of an olefinic substrate with a diazo reagent. The two cis isomers are enantiomers with respect to one another, in that the structures are non-superimposable mirror images of each other. Similarly, the two trans isomers are enantiomers. One of skill in the art will appreciate that the absolute stereochemistry of a cyclopropranation product that is, whether a given chiral center exhibits the right-handed R configuration or the left-handed S configuration will depend on factors including the structures of the particular olefinic substrate and diazo reagent used in the reaction, as well as the identity of the enzyme. This is also true for the relative stereochemistrythat is, whether a cyclopropanation product exhibits a cis or trans configurationas well as for the distribution of cyclopropanation product mixtures will also depend on such factors.

[0286] In general, cyclopropanation product mixtures have cis:trans ratios ranging from about 1:99 to about 99:1. The cis:trans ratio can be, for example, from about 1:99 to about 1:75, or from about 1:75 to about 1:50, or from about 1:50 to about 1:25, or from about 99:1 to about 75:1, or from about 75:1 to about 50:1, or from about 50:1 to about 25:1. The cis:trans ratio can be from about 1:80 to about 1:20, or from about 1:60 to about 1:40, or from about 80:1 to about 20:1 or from about 60:1 to about 40:1. The cis:trans ratio can be about 1:5, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, or about 1:95. The cis:trans ratio can be about 5:1, 10:1, 15:1, 20:1, 25:1, 30:1, 35:1, 40:1, 45:1, 50:1, 55:1, 60:1, 65:1, 70:1, 75:1, 80:1, 85:1, 90:1, or about 95:1.

[0287] The distribution of a cyclopropanation product mixture can be assessed in terms of the enantiomeric excess, or flee, of the mixture. The enantiomeric excess refers to the difference in the mole fractions of two enantiomers in a mixture. Taking the reaction scheme in FIG. 29 as a non-limiting example, for instance, the enantiomeric excess of the E or trans (R,R) and (S,S) enantiomers can be calculated using the formula: % ee.sub.E=[(.sub.R,R.sub.S,S)/(.sub.R,R+.sub.S,S)]100%, wherein is the mole fraction for a given enantiomer. The enantiomeric excess of the Z or cis enantiomers (% ee.sub.Z) can be calculated in the same manner.

[0288] In general, cyclopropanantion product mixtures exhibit % ee values ranging from about 1% to about 99%, or from about 1% to about 99%. The closer a given % ee value is to 99% (or 99%), the purer the reaction mixture is. The % ee can be, for example, from about 90% to about 90%, or from about 80% to about 80%, or from about 70% to about 70%, l or from about 60% to about 60%, or from about 40% to about 40%, or from about 20% to about 20%. The % ee can be from about 1% to about 99%, or from about 20% to about 80%, or from about 40% to about 60%, or from about 1% to about 25%, or from about 25% to about 50%, or from about 50% to about 75%. The % ee can be from about 1% to about 99%, or from about 20% to about 80%, or from about 40% to about 60%, or from about 1% to about 25%, or from about 25% to about 50%, or from about 50% to about 75%. The % ee can be about 99%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or about 95%. Any of these values can be % ee.sub.E values or % ee.sub.Z values.

[0289] Accordingly, some embodiments of the invention provide methods for producing a plurality of cyclopropanation products having a % ee.sub.Z of from about 90% to about 90%. In some embodiments, the % ee.sub.Z is at least 90%. In some embodiments, the % ee.sub.Z is at least 99%. In some embodiments, the % ee.sub.E is from about 90% to about 90%. In some embodiments, the % ee.sub.E is at least 90%. In some embodiments, the % ee.sub.E is at least 99%.

[0290] In a related aspect, certain embodiments of the invention provide cyclopropane-containing compounds according to any of Formulas I, II, III as described herein. The compounds are prepared using the methods of the invention. In some embodiments, the invention provides a pyrethroid prepared according to the methods of the invention. In some embodiments, the invention provides milnacipran, levomilnacipran, bicifadine, or 1-(3,4-dichlorophenyl)-3-azabicyclo[3.1.0]hexane prepared according to the methods of the invention. In some embodiments, the invention provides any of the compounds illustrated in Table 6, which compounds are prepared according to the methods of the invention. The invention can provide other compounds prepared according to the methods described herein.

[0291] C. Reaction Conditions

[0292] The methods of the invention include forming reaction mixtures that contain the heme enzymes described herein. The heme enzymes can be, for example, purified prior to addition to a reaction mixture or secreted by a cell present in the reaction mixture. The reaction mixture can contain a cell lysate including the enzyme, as well as other proteins and other cellular materials. Alternatively, a heme enzyme can catalyze the reaction within a cell expressing the heme enzyme. Any suitable amount of heme enzyme can be used in the methods of the invention. In general, cyclopropanation reaction mixtures contain from about 0.01 mol % to about 10 mol % heme enzyme with respect to the diazo reagent and/or olefinic substrate. The reaction mixtures can contain, for example, from about 0.01 mol % to about 0.1 mol % heme enzyme, or from about 0.1 mol % to about 1 mol % heme enzyme, or from about 1 mol % to about 10 mol % heme enzyme. The reaction mixtures can contain from about 0.05 mol % to about 5 mol % heme enzyme, or from about 0.05 mol % to about 0.5 mol % heme enzyme. The reaction mixtures can contain about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or about 1 mol % heme enzyme.

[0293] The concentration of olefinic substrate and diazo reagent are typically in the range of from about 100 M to about 1 M. The concentration can be, for example, from about 100 M to about 1 mM, or about from 1 mM to about 100 mM, or from about 100 mM to about 500 mM, or from about 500 mM to 1 M. The concentration can be from about 500 M to about 500 mM, 500 M to about 50 mM, or from about 1 mM to about 50 mM, or from about 15 mM to about 45 mM, or from about 15 mM to about 30 mM. The concentration of olefinic substrate or diazo reagent can be, for example, about 100, 200, 300, 400, 500, 600, 700, 800, or 900 M. The concentration of olefinic substrate or diazo reagent can be about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, or 500 mM.

[0294] Reaction mixtures can contain additional reagents. As non-limiting examples, the reaction mixtures can contain buffers (e.g., 2-(N-morpholino)ethanesulfonic acid (MES), 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid (HEPES), 3-morpholinopropane-1-sulfonic acid (MOPS), 2-amino-2-hydroxymethyl-propane-1,3-diol (TRIS), potassium phosphate, sodium phosphate, phosphate-buffered saline, sodium citrate, sodium acetate, and sodium borate), cosolvents (e.g., dimethylsulfoxide, dimethylformamide, ethanol, methanol, isopropanol, glycerol, tetrahydrofuran, acetone, acetonitrile, and acetic acid), salts (e.g., NaCl, Kcl, CaCl.sub.2, and salts of Mn.sup.2+ and Mg.sup.2+), denaturants (e.g., urea and guandinium hydrochloride), detergents (e.g., sodium dodecylsulfate and Triton-X 100), chelators (e.g., ethylene glycol-bis(2-aminoethylether)-N, N,N,N-tetraacetic acid (EGTA), 2-({2-[Bis(carboxymethyl)amino]ethyl}(carboxymethyl)amino)acetic acid (EDTA), and 1,2-bis(o-aminophenoxy)ethane-N,N,N,N-tetraacetic acid (BAPTA)), sugars (e.g., glucose, sucrose, and the like), and reducing agents (e.g., sodium dithionite, NADPH, dithiothreitol (DTT), -mercaptoethanol (BME), and tris(2-carboxyethyl)phosphine (TCEP)). Buffers, cosolvents, salts, denaturants, detergents, chelators, sugars, and reducing agents can be used at any suitable concentration, which can be readily determined by one of skill in the art. In general, buffers, cosolvents, salts, denaturants, detergents, chelators, sugars, and reducing agents, if present, are included in reaction mixtures at concentrations ranging from about 1 M to about 1 M. For example, a buffer, a cosolvent, a salt, a denaturant, a detergent, a chelator, a sugar, or a reducing agent can be included in a reaction mixture at a concentration of about 1 M, or about 10 M, or about 100 M, or about 1 mM, or about 10 mM, or about 25 mM, or about 50 mM, or about 100 mM, or about 250 mM, or about 500 mM, or about 1 M. In some embodiments, a reducing agent is used in a sub-stoichiometric amount with respect to the olefin substrate and the diazo reagent. Cosolvents, in particular, can be included in the reaction mixtures in amounts ranging from about 1% v/v to about 75% v/v, or higher. A cosolvent can be included in the reaction mixture, for example, in an amount of about 5, 10, 20, 30, 40, or 50% (v/v).

[0295] Reactions are conducted under conditions sufficient to catalyze the formation of a cyclopropanation product. The reactions can be conducted at any suitable temperature. In general, the reactions are conducted at a temperature of from about 4 C. to about 40 C. The reactions can be conducted, for example, at about 25 C. or about 37 C. The reactions can be conducted at any suitable pH. In general, the reactions are conducted at a pH of from about 6 to about 10. The reactions can be conducted, for example, at a pH of from about 6.5 to about 9. The reactions can be conducted for any suitable length of time. In general, the reaction mixtures are incubated under suitable conditions for anywhere between about 1 minute and several hours. The reactions can be conducted, for example, for about 1 minute, or about 5 minutes, or about 10 minutes, or about 30 minutes, or about 1 hour, or about 2 hours, or about 4 hours, or about 8 hours, or about 12 hours, or about 24 hours, or about 48 hours, or about 72 hours. Reactions can be conducted under aerobic conditions or anaerobic conditions. Reactions can be conducted under an inert atmosphere, such as a nitrogen atmosphere or argon atmosphere. In some embodiments, a solvent is added to the reaction mixture. In some embodiments, the solvent forms a second phase, and the cyclopropanation occurs in the aqueous phase. In some embodiments, the heme enzymes is located in the aqueous layer whereas the substrates and/or products occur in an organic layer. Other reaction conditions may be employed in the methods of the invention, depending on the identity of a particular heme enzyme, olefinic substrate, or diazo reagent.

[0296] Reactions can be conducted in vivo with intact cells expressing a heme enzyme of the invention. The in vivo reactions can be conducted with any of the host cells used for expression of the heme enzymes, as described herein. A suspension of cells can be formed in a suitable medium supplemented with nutrients (such as mineral micronutrients, glucose and other fuel sources, and the like). Cyclopropanation yields from reactions in vivo can be controlled, in part, by controlling the cell density in the reaction mixtures. Cellular suspensions exhibiting optical densities ranging from about 0.1 to about 50 at 600 nm can be used for cyclopropanation reactions. Other densisties can be useful, depending on the cell type, specific heme enzymes, or other factors.

[0297] The methods of the invention can be assessed in terms of the diastereoselectivity and/or enantioselectivity of cyclopropanation reaction that is, the extent to which the reaction produces a particular isomer, whether a diastereomer or enantiomer. A perfectly selective reaction produces a single isomer, such that the isomer constitutes 100% of the product. As another non-limiting example, a reaction producing a particular enantiomer constituting 90% of the total product can be said to be 90% enantioselective. A reaction producing a particular diastereomer constituting 30% of the total product, meanwhile, can be said to be 30% diastereoselective.

[0298] In general, the methods of the invention include reactions that are from about 1% to about 99% diastereoselective. The reactions are from about 1% to about 99% enantioselective. The reaction can be, for example, from about 10% to about 90% diastereoselective, or from about 20% to about 80% diastereoselective, or from about 40% to about 60% diastereoselective, or from about 1% to about 25% diastereoselective, or from about 25% to about 50% diastereoselective, or from about 50% to about 75% diastereoselective. The reaction can be about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or about 95% diastereoselective. The reaction can be from about 10% to about 90% enantioselective, from about 20% to about 80% enantioselective, or from about 40% to about 60% enantioselective, or from about 1% to about 25/% enantioselective, or from about 25% to about 50% enantioselective, or from about 50% to about 75% enantioselective. The reaction can be about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or about 95% enantioselective. Accordingly some embodiments of the invention provide methods wherein the reaction is at least 30% to at least 90% diastereoselective. In some embodiments, the reaction is at least 30% to at least 90% enantioselective.

IV. EXAMPLES

[0299] The present invention will be described in greater detail by way of specific examples. The following examples are offered for illustrative purposes, and are not intended to limit the invention in any manner. Those of skill in the art will readily recognize a variety of noncritical parameters which can be changed or modified to yield essentially the same results.

Example 1

CC Functionalization by Enzyme-Catalyzed Carbenoid Insertion

[0300] This example illustrates bacterial cytochrome P450s that are engineered to catalyze highly stereoselective carbene transfers to aryl-substituted olefins, a reaction without a known biological counterpart.

[0301] Creating enzymes that catalyze novel reactions, one of the hallmarks of evolution, is a huge challenge and nearly unexplored frontier in protein engineering. Carbene transfers to CC bonds are powerful catalytic methods that lack biological counterparts. Stereo-control over these transformations currently relies on expensive transition metal catalysts that require toxic organic solvents and are difficult to systematically modify or optimize. This example illustrates variants of cytochrome P450.sub.BM3 that catalyze an important reaction not previously known for this monooxygenase: the cyclopropanation of styrene from diazoester reagents with exquisite enantio- and diastereocontrol. As such, this example demonstrates that existing enzymes can be adapted for catalysis of synthetically-important reactions not previously observed in Nature.

Introduction

[0302] The many strategies for functionalizing CC bonds that have evolved in the biological world have captivated the imaginations of chemists who attempt to develop biomimetic catalysts (J. T. Groves, Proc. Natl. Acad. Sci. U.S.A. 100, 3569 (2003); R. Breslow, J. Biol. Chem. 284, 1337 (2009)). The reverse of this, developing new biocatalysts inspired by synthetic chemistry, has received little attention, mainly because we poorly understand how to encode a desired function in a protein sequence. Nature's entire catalyst repertoire has been built with and utilizes physiologically accessible reagents. Not subject to the same limitations, synthetic chemists have developed powerful methods for direct CC functionalization based on transition metal-catalyzed carbenoid insertions, reactions that are used extensively in the synthesis of natural product intermediates and artificial drugs (H. M. L. Davies et al., Nature 451, 417 (2008)). Utilizing high-energy precursors typically in the form of acceptor-substituted diazo reagents, these synthetic systems, upon dinitrogen extrusion, form metallo-carbenoid intermediates that insert into CC bonds to form new carbon-carbon centers. Synthetic catalysts, however, require expensive transition metals and elaborate ligand designs for stereocontrol; they also often require toxic organic solvents. This example demonstrates combining the high levels of selectivity and green process conditions afforded by enzymes with the synthetic power of carbene transfer strategies enabled by transition metal catalysis.

Results

[0303] Members of the diverse cytochrome P450 enzyme family catalyze myriad oxidative transformations, including hydroxylation, epoxidation, oxidative ring coupling, heteratom release, and heteroatom oxygenation (E. M. Isin et al., Biochim. Biophys. Acta 1770, 314 (2007)). The majority of transformations encompassed by this broad catalytic scope are manifestations of the same high-valent iron-oxene intermediate (compound I, FIG. 1). Inspired by the impressive chemo-, regio- and stereo-selectivities with which cytochrome P450s can insert oxygen atoms into CC bonds, whether these enzymes could be engineered to mimic this chemistry was investigated for isoelectronic carbene transfer reactions via high-valent iron-enoid species (FIG. 1). This example shows that variants of the cytochrome P450 from Bacillus megaterium (CYP102A1, or P450.sub.BM3) are efficient catalysts for the asymmetric metallocarbene-mediated cyclopropanation of styrenes.

[0304] Since iron porphyrins are known to catalyze carbene-based cyclopropanations (J. R. Wolf et al., J. Am. Chem. Soc. 117, 9194 (1995)), whether some common heme proteins display measurable levels of cyclopropanase activity was first probed. The reaction between styrene and ethyl diazoacetate (EDA, FIG. 2), a well-recognized model system for validating new cyclopropanation catalysts, was investigated. Initial experiments showed that optimal formation of the desired cyclopropanation products occurred in water in the presence of a reducing agent (e.g, sodium dithionite) under anaerobic conditions (Tables 7-10). Horseradish peroxidase (HRP), cytochrome c (cyt c), myoglobin (Mb) and P450.sub.BM3 all displayed multiple turnovers towards the cyclopropane products, with HRP, cyt c and Mb showing negligible enantio-induction and forming the trans cyclopropane with over 90% selectivity, which is comparable to the diastereoselectivity induced by free hemin (Table 7). Interestingly, P450.sub.BM3, despite forming the cyclopropane products in low yield, catalyzed the reaction with different diasteroselectivity (cis:trans 37:63) and slight enantio-induction (Table 11), indicating that carbene transfer and selectivity were dictated by the active site-bound heme cofactor rather than by hemin released from the protein.

TABLE-US-00008 TABLE 7 Heme catalysts under anaerobic conditions with sodium dithionite (Na.sub.2S.sub.2O.sub.4). [00097]embedded image [00098]embedded image [00099]embedded image Axial Cat. loading % ee % ee Catalyst ligand (% mol eq) TTN cis:trans.sup.a cis.sup.b trans.sup.c Catalase O-Tyr 0.16 0 CPO.sup.d S-Cys 0.40 0 HRP N-His 1.00 9 7:93 8 7 cyt c N-His, 1.00 19 6:94 0 12 S-Met Mb N-His 1.00 43 6:94 1 2 P450.sub.BM3 S-Cys 0.20 5 37:63 27 2 Hemin 0.20 73 6:94 1 0 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S). .sup.dBioconversion conducted at 0.1 M citrate buffer pH = 4.0.

TABLE-US-00009 TABLE 8 Heme catalysts under anaerobic conditions without Na.sub.2S.sub.2O.sub.4. [00100]embedded image [00101]embedded image [00102]embedded image Axial Cat. loading % ee % ee Catalyst ligand (% mol eq) TTN cis:trans.sup.a cis.sup.b trans.sup.c Catalase O-Tyr 0.16 0 CPO.sup.d S-Cys 0.40 0 HRP N-His 1.00 0 cyt c N-His, S-Met 1.00 12 8:92 8 3 Mb N-His 1.00 0.8 11:89 2 8 P450.sub.BM3 S-Cys 0.20 0 0 Hemin 0.20 4 11:89 1 3 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S). .sup.dBioconversion conducted at 0.1 M citrate buffer pH = 4.0.

TABLE-US-00010 TABLE 9 Heme catalysts under aerobic conditions with Na.sub.2S.sub.2O.sub.4. [00103]embedded image [00104]embedded image [00105]embedded image Axial Cat. loading % ee % ee Catalyst ligand (% mol eq) TTN cis:trans.sup.a cis.sup.b trans.sup.c Catalase O-Tyr 0.16 0 CPO.sup.d S-Cys 0.40 0 HRP N-His 1.00 1 12:88 3 7 cyt c N-His, S-Met 1.00 3 9:91 6 16 Mb N-His 1.00 6 7:93 13 12 P450.sub.BM3 S-Cys 0.20 1 13:87 38 8 Hemin 0.20 6 8:92 5 1 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S). .sup.dBioconversion conducted at 0.1 M citrate buffer pH = 4.0.

TABLE-US-00011 TABLE 10 Heme catalysts under aerobic conditions without Na.sub.2S.sub.2O.sub.4. [00106]embedded image [00107]embedded image [00108]embedded image Axial Cat. loading % ee % ee Catalyst ligand (% mol eq) TTN cis:trans.sup.a cis.sup.b trans.sup.c Catalase O-Tyr 0.16 0 CPO.sup.d S-Cys 0.40 0 HRP N-His 1.00 0 cyt c N-His, S-Met 1.00 0 Mb N-His 1.00 0 P450.sub.BM3 S-Cys 0.20 0.4 46:54 46 36 Hemin 0.20 0 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S). .sup.dBioconversion conducted at 0.1 M citrate buffer pH = 4.0.

TABLE-US-00012 TABLE 11 Stereoselective P450.sub.BM3 cyclopropanases. Reactions were run in phosphate buffer (pH 8.0) at room temperature under argon with 30 mM styrene, 10 mM EDA, 0.2 mole % catalyst (with respect to EDA), and 10 mM sodium dithionite. Yields, diastereomeric ratios and enantiomeric excess were determined by GC analysis. Catalyst % yield.sup.a TTN cis:trans % ee.sub.cis.sup.b % ee.sub.trans.sup.c Hemin 15 73 6:94 1 0 P450.sub.BM3 1 5 37:63 27 2 P450.sub.BM3-F87A 1 6 38:62 26 6 P450.sub.BM3-T268A 65 323 1:99 15 96 H2-5-F10 59 294 16:84 41 63 H2A10 33 167 60:40 95 78 H2-4-D4 41 206 53:47 79 33 C3C 40 199 71:29 94 91 C3C-I263A 38 190 19:81 62 91 CSC-A328G 37 186 83:17 52 45 C3C-T438S 59 293 92:8 97 66 .sup.aBased on EDA. .sup.b(R, S)-(S, R). .sup.c(R, R)-(S, S). Variant 9-10A-TS-F87V-T268A is denoted as C3C. Other sequence identities are described in Table 12.

[0305] Whether the activity and selectivity of heme-catalyzed cyclopropanation could be enhanced by engineering the protein sequence was determined. P450.sub.BM3 is a well-studied, soluble, self-sufficient (heme and diflavin reductase domains are fused in a single polypeptide), long-chain fatty acid monooxygenase. More than a decade of protein engineering attests to the functional plasticity of this biocatalyst (C. J. C. Whitehouse et al., Chem. Soc. Rev. 41, 1218 (2012)). Thousands of variants that exhibit monooxygenase activity on a wide range of substrates have been accumulated from using directed evolution to engineer cytochrome P450.sub.BM3 for synthetic applications (J. C. Lewis et al., Chimia 63, 309 (2009)). Some of these variants were tested by chiral gas chromatography for altered cyclopropanation diastero- and enantioselectivity. A panel of 92 P450.sub.BM3 variants, chosen for diversity of activity and protein sequence, was screened in E. coli lysate for the reaction of styrene and EDA under aerobic conditions in the presence of sodium dithionite (Tables 12 and 13). The ten most promising hits were selected for purification and subsequent characterization under standardized anaerobic reaction conditions (Tables 11 and 14).

TABLE-US-00013 TABLE 12 Raw data from P450.sub.BM3 compilation plate screen. Diastereo- and enantioselectivity were determined by gas chromatography using a chiral -CDX column as the stationary phase. P450.sub.BM3 Mutations compared to wild- Absolute ee variants type P450.sub.BM3 (SEQ ID NO: 1) activity.sup.a de.sup.b (cis).sup.c CYP102A3 N/A 0.004053 74 8 CYP102A2 N/A 0.002963 76 36 CYP102A1 None 0.002240 81 7 (P450.sub.BM3) WT F87A F87A 0.001704 28 57 WT T88L T88L 0.004522 78 23 WT A328V A328V 0.000830 100 N/A J.sup.4 V78A, T175I, A184V, F205C, 0.001334 100 N/A S226R, H236Q, E252G, R255S, A290V, L353V 139-3.sup.5 V78A, H138Y, T175I, V178I, 0.001386 86 0 A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V 9-10A.sup.4 R47C, V78A, K94I, P142S, 0.004292 74 20 T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V 9-10A L75W.sup.1 9-10A L75W 0.005191 83 8 9-10A L75I.sup.1 9-10A L75I 0.002267 85 3 9-10A A78F.sup.1 9-10A L78F 0.002008 82 35 9-10A A78S.sup.1 9-10A A78S 0.005098 81 6 9-10A A82G.sup.1 9-10A A82G 0.002245 76 7 9-10A A82F.sup.1 9-10A A82F #VALUE! N/A N/A 9-10A A82C.sup.1 9-10A A82C 0.002487 74 16 9-10A A82I.sup.1 9-10A A82I 0.001031 100 N/A 9-10A A82S.sup.1 9-10A A82S 0.001483 82 14 9-10A A82L.sup.4 9-10A A82L 0.000591 100 N/A 9-10A F87A 9-10A F87A 0.001701 61 10 9-10A F87V.sup.1 9-10A F87V 0.000000 N/A N/A 9-10A F87I.sup.1 9-10A F87I 0.000983 100 N/A 9-10A F87L.sup.1 9-10A F87L 0.000710 100 N/A 9-10A T88C.sup.1 9-10A T88C 0.002516 77 3 9-10A T260S.sup.1 9-10A T260S 0.004259 82 6 9-10A T260N.sup.1 9-10A T260N 0.003882 77 15 9-10A T260L.sup.1 9-10A T260L 0.006173 77 2 9-10A A328V.sup.1 9-10A A328V 0.006471 68 8 9-10A A328M.sup.1 9-10A A328M 0.005180 82 6 9-10A A328F.sup.1 9-10A A328F 0.002009 63 32 49-1A R47C, V78T, A82G, F87V, 0.001874 75 32 K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328L, L353V 35-7F R47C, V78F, A82S, K94I, 0.004514 73 52 P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328L, L353V 53-5H.sup.1 9-10A A78F, A82S, A328F 0.002840 80 2 7-11D 9-10A A82F, A328V 0.036840 24 28 49-9B R47C, V78A, A82G, F87V, 0.000000 N/A N/A K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328L, L353V 41-5B R47C, V78F, A82G, K94I, 0.008391 77 17 P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328V, L353V 13-7C.sup.1 9-10A A78T, A328L 0.005493 73 43 12-10C R47C, V78A, A82G, F87V, 0.004566 73 21 K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328V, L353V 77-9H.sup.1 9-10A A78T, A82G, A328L 0.003053 73 34 11-8E R47C, V78A, F87V, K94I, 0.001453 77 15 P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328L, L353V 1-12G.sup.4 9-10A A82L, A328V 0.003884 70 19 29-3E R47C, V78A, A82F, K94I, 0.003425 80 15 P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328F, L353V 29-10E R47C, V78F, A82G, K94I, 0.001935 70 16 P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328F, L353V 68-8F.sup.1 9-10A A78F, A82G, A328L 0.004127 72 32 35E11.sup.6 R47C, V78F, A82S, K94I, 0.003600 71 14 P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328F, L353V, E464G, I710T 19A12.sup.6 35E11 L52I, L188P, I366V 0.006909 70 27 ETS8.sup.6 35E11 L52I, I366V 0.003966 79 19 (11-3).sup.6 35E11 L52I, A74S, L188P, 0.005633 76 39 I366V (7-7).sup.6 35E11 L52I, A74E, S82G, 0.010499 77 9 A184V, L188P, I366V H2A10 9-10A TS F87V, L75A, 0.066422 8 94 L181A, T268A SL2-6F8 R47C, L52I, V78F, A82S, 0.000778 100 N/A K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, A328L, K349N, L353V, I366V, E464G, I710T A12SL-17-4 R47C, L52I, A74E, V78F, 0.010935 80 6 A82S, K94I, P142S, T175I, A184V, L188P, F205C, S226R, H236Q, E252G, R255S, A290V, A328F, L353V, I366V, E464G, I710T H2-2-A1.sup.2 9-10A TS F87V, L75A, 0.003042 75 11 L18IA, L437A A12RM-2-8 R47C, L52I, A74E, V78F, 0.007705 77 13 A82S, K94I, P142S, T175I, A184S, L188P, F205C, S226R, H236Q, E252G, R255S, A290V, A328F, L353V, I366V, E464G, I710T H2-5-F10 9-10A TS F87V, L75A, 0.141237 46 56 I263A, T268A, L437A 13C9R1 L52I, I58V, L75R, F87A, 0.001980 100 N/A H100R, S106R, F107L, A135S, A184V, N239H, S274T, L324I, V340M, I366V, K434E, E442K, V446I 22A3 13C9R1 F162I E434K K442E 0.004053 70 4 I446V 2C6.sup.3 9-10A A78L, F87A, V184T, 0.004257 78 15 G315S, A330V 9C7.sup.3 9-10A C47R, A78L, F87G, 0.007258 79 5 I94K, A180V, V184T, G315S, A330V, Y345C B1.sup.3 9-10A C47R, A78L, F87A, 0.002246 61 14 I94K, V184T, I263M, G315S, A330V B1SYN.sup.3 9-10A C47S, N70Y, A78L, 0.002705 76 23 F87A, I174N, I94K, V184T, I263M, G315S, A330V H2-4-D4 9-10A TS F87V, L75A, 0.052439 57 84 M177A, L181A, T268A, L437A E12 A87V.sup.3 9-10A C47R, A78L, F87V, 0.001990 65 52 I94K, A111V, V141I, A180V, V184T, G315S, A330V GlcA4 9-10A C47R, F81W, A82S, 0.004925 78 12 T180A F87A, I94K H2-8-C7.sup.2 9-10 TS F87V, L75A, 0.000808 100 N/A L181A CH-F8 9-10A L51A, C47A, F87V, 0.001126 100 N/A I94K, L181A, C205F, S254R, I366V, L437A, E442K H2-4-H5.sup.2 9-10A TS F87V, L75A, 0.001229 100 N/A M177A, L181A SA9 9-10A C47R, F81W, A82I, 0.004170 81 11 F87A, I94K, A180T, A197V ManA10 9-10A C47R, F81S, A82V, 0.006340 82 14 F87A, I94K, A180T, A197V Man1 9-10A C47R, F81L, A82T, 0.003053 73 21 F87A, I94K MB2 9-10A C47R, F81W, A82I, 0.003282 77 10 F87A, I94K HA62 9-10A C47R, F81A, A82L, 0.003375 81 5 F87A, I94K 9-10A TS V78A, P142S, T175I, A184V, 0.001920 75 54 S226R, H236Q, E252G, A290V, L353V, I366V, E442K 9-10A TS 9-10A TS F87A 0.001546 60 5 F87A 25F7 9-10A C47R, A74F, A78S, 0.001829 81 43 F87A, I282K, C205F, S255R 24C4 9-10A C47R, A74I, A78L, 0.000783 100 N/A F87A, I94K, C205F, S255R 5A1 9-10A M30T, C47R, A74F, 0.002471 80 15 A78S, I94K, C205F, S255R, Q310L, I366V, E442K 8B3 9-10A M30T, C47R, A74F, 0.001315 100 N/A A78S, I94K, C205F, C255R, L310Q, Q323L, I366V, N381K, R398H, E441K Determined by GC analysis on a chiral -CDX column. .sup.aRepotted as the sum of the area of the cyclopropane peaks over the area of the internal standard. .sup.bDiastereomeric excess = ([cis] [trans]/([cis] + [trans]). .sup.c(R, S)-(S, R). .sup.1P. Meinhold et al., Adv. Synth. Catal. 348, 763 (2006). .sup.2J. C. Lewis et al., Chembiochem: a European journal of chemical biology 11, 2502 (2010). .sup.3J. C. Lewis et al., Proceedings of the National Academy of Sciences of the United States of America 106, 16550 (2009). .sup.4M. W. Peters et al., J. Am. Chem. Soc. 125, 13442 (2003). .sup.5A. Glieder et al., Nat. Biotechnol. 20, 1135 (2002). .sup.6R. Fasan et al., Angew. Chem., Int. Ed. 46, 8414 (2007).

TABLE-US-00014 TABLE 13 Raw GC screening data for the chimeric P450s in the compilation plate. Chimeric P450s (heme domain Absolute P450 block sequence) activity.sup.a de.sup.b ee (cis).sup.c CYP102A1 11111111 0.001704 28 56 (P450.sub.BM3) F87A.sup.1 CYP102A2 22222222 N/A N/A N/A F88A.sup.1 CYP102A3 33333333 N/A N/A N/A F88A.sup.1 5R1.sup.2 32312231 0.008625 58 19 9R1.sup.2 12112333 0.0042707 58 24 12R1.sup.2 12112333 0.0701514 32 49 C1D11R1.sup.2 21113312 0.007138 51 9 C2B12R1.sup.2 32313233 0.005914 38 5 C2C12R1.sup.2 21313111 0.006226 28 9 C2E6R1.sup.2 11113311 0.008731 25 6 C2G9R1.sup.2 22213132 0.007975 15 31 C3D10R1.sup.2 22132231 0.004898 16 2 C3E4R1.sup.2 21313311 0.007893 14 17 F3H12R1.sup.2 21333233 0.005586 56 17 F6D8R1.sup.2 22313233 0.008088 76 6 C3B5R1.sup.2 23132233 0.014722 81 4 X7R1.sup.2 22312333 0.017305 4 34 .sup.aReported as the sum of the area of the cyclopropane peaks over the area of the internal standard. .sup.bDiastereomeric excess = ([cis] [trans])/([cis] + [trans]). .sup.c(R, S) (S, R). .sup.1C. R. Otey et al., PLoS Biol. 4, 789 (2006). .sup.2M. Landwehr et al., Chem. Biol. 14, 269 (2007). Site-directed recombination of three bacterial cytochrome P450s was performed with sequence crossover sites chosen to minimize the number of disrupted contacts within the protein structure. Seven crossover sites where chosen resulting in eight sequence blocks. The numbering refers to the identity of the parent sequence at each block. For example, 12312312 refers to a sequence containing block 1 from P450 1, block 2 from P450 2, block 3 from P450 3, etc.

TABLE-US-00015 TABLE 14 Stereoselective P450.sub.BM3 based cyclopropanases. [00109]embedded image [00110]embedded image [00111]embedded image P450 % yield.sup.a TTN cis:trans.sup.b % ee cis.sup.c % ee trans.sup.d WT 1 5 37:63 10 9 WTF87A 1.2 6 37:63 26 6 H2A10 33.4 167 60:40 95 78 H2-4-D4 41.2 206 53:47 79 33 H2-5-F10 58.8 294 16:84 41 63 C2C12R1 1.6 8 36:64 45 1 C3E4R1 1.6 8 43:57 51 7 X7R1 2.4 12 33:67 23 4 12 R1 6.2 31 17:83 9 2 C2E6 R1 4.6 23 27:73 25 6 C2G9 R1 48 240 9:91 10 2 7-11D 32 160 35:65 22 18 .sup.abased on EDA. .sup.bDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.c(R,S) (S,R). .sup.d(R,R) (S,S).

[0306] Five of the ten selected P450s showed improvements in activity (>100 TTN), a comprehensive range of diastereoselectivities with cis:trans ratios varying from 9:91 to 60:40, and impressive enantioselectivities (up to 95% ee, Table 14). For example, variant H2-5-F10, which contains 16 amino acid substitutions from wild type, catalyzes 294 TTN, equivalent to 58% yield (with respect to EDA) under these conditions. This represents a 50-fold improvement in TTN over wild type P450.sub.BM3. Furthermore, mutations affect both the diastereo- and enantioselectivity of cyclopropanation: H2-5-F10 favors the trans cyclopropanation product (cis:trans 16:84) with 63% ee.sub.trans, while variant H2A10, which catalyzes up to 167 TTN, demonstrates reversed diastereoselectivity (cis:trans 60:40) with high enantioselectivity (95% ee.sub.cis).

[0307] The variant H2A10 was used to verify the role of the enzyme in catalysis and identify optimal conditions (Table 15, FIGS. 3 and 4). Heat inactivation produced diastereo- and enantioselectivities similar to those obtained using free hemin, consistent with protein denaturation and release of the cofactor. Complete inhibition was achieved by pre-incubating the bioconversion with carbon monoxide, which irreversibly binds the reduced P450 heme, confirming that catalysis occurs at the active site. Air inhibited the cyclopropanation reaction by about 50%, showing that dioxygen and EDA compete for reduced Fe.sup.II. Cyclopropanation was also achieved with NADPH as the reductant, confirming that the novel activity can also be driven by the endogenous electron transport machinery of the diflavin-containing reductase domain. The presence of a reducing agent in sub-stoichiometric amounts proved essential for cyclopropanation (Table 16), implying that the active species is Fe.sup.II rather than the resting state Fe.sup.III.

TABLE-US-00016 TABLE 15 Controls for P450 based cyclopropanation using variant H2A10. [00112]embedded image [00113]embedded image [00114]embedded image % % ee % ee Conditions TTN inhibition cis:trans.sup.a cis.sup.b trans.sup.c Complete System (CS) 101 70:30 95 78 CS-Na.sub.2S.sub.2O.sub.4 + NADPH 45 55 61:39 87 31 CS-Na.sub.2S.sub.2O.sub.4 + NADH 38 62 53:47 76 19 CS-Na.sub.2S.sub.2O.sub.4 0 100 CS-P450 0 100 CS + CO 0 100 Boiled P450 146 +45 16:84 2 2 H2A10.sub.heme 85 16 67:33 92 67 CS-P450 + Hemin 16 84 15:85 1 2 CS (aerobic) 43 57 67:33 94 76 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S).

TABLE-US-00017 TABLE 16 Effect of concentration of sodium dithionite on cyclopropane yield. [00115]embedded image [00116]embedded image [Na.sub.2S.sub.2O.sub.4]/mM [cyclopropanes]/mM TTN 0 0 0 1 2.59 129 5 2.72 136 10 3.34 167 20 3.13 156 50 2.79 140 100 2.71 136

[0308] Highly active variants H2A10, H2-5-F10 and H2-4-D4 have three to five active site alanine substitutions with respect to 9-10A-TS-F87V (12 mutations from wild type), which itself shows negligible cyclopropanase activity. These variants demonstrate significant differences in TTN, diastereoselectivity, and enantioselectivity (Table 11). To better understand how protein sequence controls P450-mediated cyclopropanation, 12 new variants were constructed to assess the contributions of individual alanine mutations to catalysis and stability (Table 17). T268A is key for achieving high levels of cyclopropanation activity, and this mutation alone converts inactive 9-10A-TS-F87V into an active cyclopropanase. Variant 9-10A-TS-F87V-T268A (denoted C3C) is a competent cyclopropanase (199 TTN), displays strong preference for the cis product (cis:trans 71:29), forms both diastereomers with over 90% ee, and is as stable as wild-type P450.sub.BM3. Other active site alanine mutations tune the product distribution. Notably, the addition of I263A to C3C reverses diastereoselectivity (cis:trans 19:81). The effects of similar mutations introduced in the poorly active wild type P450.sub.BM3 were also investigated (Table 18).

TABLE-US-00018 TABLE 17 Mutational analysis of alanine substitutions on 9-10A TS F87V. [00117]embedded image Mutations relative to 9-10A TS F87V % ee % ee T.sub.50 P450 (Holo) L75A M177A L181A I263A T268A L437A TTN cis:trans.sup.a cis.sup.b trans.sup.c ( C.) 9-10A TS F87V No No No No No No 7 35:65 41 8 59.5 9-10A TS F87V Yes No No No No No 5 42:58 59 11 52.3 L75A 9-10ATS F87V No No Yes No No No 5 41:59 27 7 53.3 L181A 9-10A TS F87V No No No Yes No No 8 29:71 31 39 55.4 I263A 9-10A TS F87V No No No No Yes No 199 71:29 94 91 55.2 T268A (C3C) C3C I263A No No No Yes Yes No 190 19:81 62 91 54.0 C3C L181A No No Yes No Yes No 159 56:44 92 94 50.8 H2A10 Yes No Yes No Yes No 167 60:40 95 78 48.9 C3C L181A No No Yes Yes Yes No 203 14:86 46 95 50.9 I263A C3C L181A No No Yes No Yes Yes 180 27:73 74 98 48.4 L437A C3C L181A No No Yes Yes Yes Yes 218 9:91 55 96 48.2 I263A L437A 4H5 Yes Yes Yes No No No 7 32:68 9 0 49.4 C3C I263A No No No Yes Yes Yes 267 16:84 59 89 50.4 L437A H2-5-F10 Yes No No Yes Yes Yes 294 16:84 41 63 47.5 H2-4-D4 Yes Yes Yes No Yes Yes 206 53:47 79 33 46.4 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S).
Impressively, P450.sub.BM3-T268A, with a single mutation, is an active cyclopropanase (323 TTN, Table 11) with exquisite trans-selectivity (cis:trans 1:99) and high enantioselectivity for the major diastereomer (96% ee.sub.trans, FIG. 2). Whereas C3C is a cis-selective cyclopropanase, identical active site mutations in wild type P450.sub.BM3 result in a trans-selective enzyme (Table 18), demonstrating that mutations outside of the active site can also influence the stereochemical outcome.

TABLE-US-00019 TABLE 18 Introducing variant 9-10A-TS-F87V-T268A related active site mutations in wild-type P450.sub.BM3. [00118]embedded image Mutations relative to wild-type P450.sub.BM3 P450 (Holo) V78 F87 T268 I263 TTN cis:trans.sup.a % ee cis.sup.b % ee trans.sup.c T.sub.50 ( C.) WT 5 37:63 10 9 56.0 WT-F87A A 6 38:62 26 6 53.0 WT-F87V V 9 30:70 33 26 52.9 WT-T268A A 323 1:99 15 96 53.6 WT-F87V/T268A V A 274 32:68 77 99 52.0 WT-V78A/F87V/T268A A V A 190 32:68 70 20 50.8 WT-F87V/I263A/T268A V A A 246 7:93 8 94 50.0 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S).

[0309] Since the design of cis-selective small-molecule catalysts for diazocarbonyl-mediated cyclopropanations has proven more challenging than their trans counterparts (A. Caballero et al., European Journal of Inorganic Chemistry, 1137 (2009)), whether further active site engineering of P450.sub.BM3 could provide robust cis-selective water-compatible catalysts to complement existing organometallic systems was investigated. Five active site residues (L181, I263, A328, L437, T438) were chosen for individual site-saturation mutagenesis (see, Materials and Methods). Substitutions A328G, T438A, T438S and T438P all afforded enhanced cis-selectivity (Table 19). Notably A328G also reversed the enantioselectivity for the cis-diastereomer (Table 11). C3C-T438S displayed the highest diastereo- and enantioselectivities (cis:trans 92:8 and 97% ee.sub.cis) and maintained activity comparable to C3C (Table 11).

TABLE-US-00020 TABLE 19 Cyclopropanation activity of selected C3C.sub.heme active site variants. [00119]embedded image [00120]embedded image [00121]embedded image P450.sub.heme Yield (%).sup.a TTN cis:trans.sup.b % ee cis.sup.c % ee trans.sup.d 9-10A TS 57 286 71:29 92 88 F87V T268A (C3C) C3C-L181G 47 234 59:41 89 90 C3C-A328G 37 186 83:17 52 45 C3C-L437F 53 265 53:47 82 85 C3C-L437Q 30 148 53:47 73 87 C3C-L437G 58 290 54:46 88 91 C3C-L437A 39 194 38:62 84 11 C3-T438A 54 273 91:9 92 75 C3C-T438G 15 78 73:27 87 59 C3C-T438S 59 293 92:8 97 66 C3C-T438Q 41 206 38:62 67 70 C3C-T438P 32 161 90:10 91 50 .sup.aBased on ED. .sup.bDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.c(R,S) (S,R). .sup.d(R,R) (S,S). Variant 9-10A-TS-F87V-T268A is denoted as C3C.

[0310] C3C exhibits Michaelis-Menten kinetics (FIG. 5 and Table 20) with similar K.sub.M values for the olefin (1.5 mM) and the diazocarbene (5 mM). The relatively high K.sub.M values reflect the lack of evolutionary pressure for these enzymes to bind these substrates. C3C exhibits a notable k.sub.cat for cyclopropanation of 100 min.sup.1, comparable to the k.sub.cat of many native P450s for hydroxylation, but about fifty times slower than P450.sub.BM3-catalyzed fatty acid hydroxylation (Table 21). When used at 0.1 mol % equivalent, C3C-catalyzed cyclopropanations reached completion after 30 minutes. Adding more EDA equivalents leads to enhanced turnovers for cyclopropanes, with preserved C3C stereoselectivity (Table 22), confirming catalyst integrity and implying that the reaction stops because of EDA depletion rather than due to mechanistic inactivation.

TABLE-US-00021 TABLE 20 Michaelis-Menten parameters for P450 cyclopropanases variant 9-10A-TS-F87V-T268A (herein called C3C). k.sub.cat/(K.sub.M-EDA k.sub.cat K.sub.M-EDA K.sub.M-styrene k.sub.cat/K.sub.M-EDA k.sub.cat/K.sub.M-styrene K.sub.M-styrene) catalyst (min.sup.1) (mM) (mM) (s.sup.1 M.sup.1) (s.sup.1 M.sup.1) (s.sup.1 M.sup.1 M.sup.1) C3C.sub.heme 100 24 5.2 3.5 1.4 0.5 320 1,100 2.1 10.sup.5

TABLE-US-00022 TABLE 21 Kinetic parametersfor wild-type cytochrome P450s acting on their native substrates and for an engineered variant of P450.sub.BM3 (propane monooxygenase, PMO) acting on the non-native substrate propane. k.sub.cat/K.sub.M-EDA P450 Substrate k.sub.cat (min.sup.1) K.sub.M-EDA (mM) (s.sup.1 M.sup.1) CYP153A6.sup.1 Octane 75 0.32 3,900 P450.sub.BM3.sup.2 Lauric 5140 0.29 3.0 10.sup.5 acid PMO.sup.3 Propane 450 0.17 4.4 10.sup.4 .sup.1M. M. Chen et al., Advanced Synthesis & Catalysis 354, 964 (2012). .sup.2M. A. Noble et al., Biochemical Journal 339 (Pt 2), 371 (1999). .sup.3R. Fasan et al.,. J. Mol. Biol. 383, 1069 (2008).

TABLE-US-00023 TABLE 22 Effect of EDA addition at t = 30 min on variant 9-10A-TS-F87V- T268A-catalyzed cyclopropanations. [00122]embedded image [00123]embedded image % ee % ee Conditions TTN cis:trans.sup.a cis.sup.b trans.sup.c 10 mM EDA added at t = 0 273 2.5 72:28 92 90 10 mM EDA added at t = 425 17 73:27 93 89 0 + 10 mM EDA at t = 30 min TTN values are reported as the mean of triplicates standard deviation. .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S).

[0311] To assess substrate scope of P450.sub.BM3-catalyzed cyclopropanation, the activities of seven variants against various olefins and diazo compounds were investigated (Tables 23-27). P450 cyclopropanation is robust to both electron-donating (p-vinylanisole, p-vinyltoluene) and electron-withdrawing (p-trifiuoromethylstyrene) substitutions on styrene, and 7-11D demonstrated consistent cis-selectivity for these substrates. The P450s were also active on 1,1-disubstituted olefins (e.g., -methyl styrene), with chimeric P450 C2G9R1 forming cyclopropanes in 77% yield (with respect to EDA). The P450s were only moderately active with t-butyl diazoacetate as substrate (<30 TTN), forming the trans product with >87% selectivity and offering no advantage over free hemin (Table 27). However, for reactions involving EDA and aryl-substituted olefins, the P450s consistently outperformed the free cofactor in both activity and stereoselectivity.

TABLE-US-00024 TABLE 23 Substrate scope of P450 cyclopropanases: p-methylstyrene + EDA. [00124]embedded image [00125]embedded image % ee % ee P450 % yield TTN cis:trans cis trans.sup.a 7-11D 21 104 54:46 0.3 N/A H2-5-F10 44 222 11:89 14.9 N/A C2G9 R1 18 92 10:90 8.9 N/A H2A10 10 50 43:57 84.3 N/A 9-10A TS F87V 46 228 78:22 81.4 N/A T268A (C3C) Hemin 7 37 6:94 1.6 N/A GC (cyclosil-B column 30 m x 0.32 mm, 0.25 m film): oven temperature = 100 C. for 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution times: cis-cyclopropanes (21.03 and 21.18 min), trans-cyclopropanes (22.71 min). .sup.atrans-enantiomers did not resolve.

TABLE-US-00025 TABLE 24 Substrate scope of P450 cyclopropanases: p-vinylanisole + EDA. [00126]embedded image [00127]embedded image % ee % ee P450 % yield TTN cis:trans cis trans.sup.a 7-11D 59 297 70:30 27 N/A H2-5-F10 73 364 11:89 38 N/A C2G9 R1 39 196 10:90 1 N/A H2A10 16 80 40:60 75 N/A 9-10A TS F87V 43 214 48:52 44 N/A T268A (C3C) Hemin 19 96 7:93 0 N/A GC oven temperature = 110 C. for 8 min, 2 C./min to 180 C. then 180 C. for 30 min, 175 kPa. Cyclosil-B column (30 m x 0.25 mm, 0.25 m film). Elution times: cis-cyclopropanes (38.74 and 39.52 min), trans-cyclopropanes (43.07 min). .sup.aBaseline resolution could not be achieved for the trans-enantiomers.

TABLE-US-00026 TABLE 25 Substrate scope of P450 cyclopropanases: p-(trifluoromethyl)styrene. [00128]embedded image [00129]embedded image % ee % ee P450 % yield.sup.a TTN.sup.a cis:trans cis trans 7-11D 24 120 76:24 31 59 H2-5-F10 40 198 26:74 72 65 C2G9 R1 18 89 10:90 4 0 H2A10 9 47 26:74 24 22 9-10A TS F87V 42 211 39:61 54 93 T268A (C3C) Hemin 2 9 11:89 1 1 .sup.aAssumed the same detector response factor as for ethyl 2-(4-methylphenyl)cyclopropane-1-carboxylate. GC (cyclosil-B column 30 m x 0.25 mm, 0.25 m film): oven temperature = 110 C. for 8 min, 2 C./min to 180 C. then 180 C. for 30 min, 175 kPa. Elution times: cis-cyclopropanes (27.26 and 28.11 min), trans-cyclopropanes (30.78 and 30.99 min).

TABLE-US-00027 TABLE 26 Substrate scope of P450 cyclopropanases: -methyl styrene. [00130]embedded image [00131]embedded image [00132]embedded image P450 % yield TTN Z:E % ee (Z) % ee (E).sup.a 7-11D 31 157 41:49 42 N/A H2-5-F10 66 329 21:79 14 N/A C2G9 R1 77 387 16:84 4 N/A H2A10 34 168 19:81 31 N/A 9-10A TS F87V 26 127 16:84 6 N/A T268A (C3C) WT F87V T268A 62 312 7:93 3 N/A Hemin 15 77 24:76 0 N/A GC oven temperature = 100 C. for 5 min, 1 C./min up to 135 C., 135 C. for 10 min, 10 C./min up to 200 C., 200 C. for 5 min. Cyclosil-B column (30 m x 0.32 mm, 0.25 m film). Elution times: Z-cyclopropanes (34.96 and 35.33 min), E-cyclopropanes (39.34 and 39.61 min). .sup.atrans-enantiomers did not separate to baseline resolution.

TABLE-US-00028 TABLE 27 Substrate scope of P450 cyclopropanases: t-butyl diazoacetate. [00133]embedded image [00134]embedded image [00135]embedded image P450 % yield.sup.a TTN.sup.a cis:trans WT F87V T268A 1.4 7 4:96 7-11D 11 54 13:87 H2-5-F10 18 90 3:97 H2A10 24 120 3:97 9-10A TS F87V 0.3 2 3:97 T268A (C3C) Hemin 20 100 4:96 .sup.aAssumed the same detector response factor as for ethyl 2-(4-methylphenyl)cyclopropane-1-carboxylate. GC (cyclosil-B column 30 m 0.32 mm, 0.25 m film): oven temperature = 100 C. for 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution times: cis-cyclopropanes (21.66 min), trans-cyclopropanes (23.31 min). Cis- and trans-enantiomers did not resolve.

[0312] Designing enzymes that catalyze reactions not observed in nature constitutes a contemporary challenge in protein engineering (J. B. Siegel et al., Science 329, 309 (2010)). Working from a natural enzyme with promiscuous reactivity, this example demonstrates the construction of a cyclopropanase that exhibits kinetics comparable to natural enzymes, albeit with pre-activated reagents. Discovering catalysts for non-natural bond-disconnections by screening natural enzymes against synthetic reagents chosen based on chemical intuition offers a simple strategy for identifying enzymes with basal levels of novel activity. As shown herein, a single mutation can be enough to promote the new activity and achieve synthetically useful stereoselectivities. The established reaction promiscuity of natural enzymes (U. T. Bornscheuer et al., Angew. Chem. Int. Ed. 43, 6032 (2004)) and the ease with which cyclopropanase activity could be installed into P450.sub.BM3 indicates that this approach will be useful for other synthetically important transformations for which biological counterparts do not yet exist.

Materials and Methods

[0313] Unless otherwise noted, all chemicals and reagents for chemical reactions were obtained from commercial suppliers (Sigma-Aldrich, Acros) and used without further purification. The following heme proteins were all purchased from Sigma-Aldrich: myoglobin (from equine heart), peroxidase II (from horseradish), cytochrome c (from bovine heart), catalase (from Corynebacterium glutamicum) and chloroperoxidase (from Caldariomyces fumago). Silica gel chromatography purifications were carried out using AMD Silica Gel 60, 230-400 mesh. .sup.1H and .sup.13C NMR spectra were recorded on either a Varian Mercury 300 spectrometer (300 MHz and 75 MHz, respectively), or a Varian Inova 500 MHz (500 MHz and 125 MHz, respectively), and are internally referenced to residual solvent peak. Data for .sup.1H NMR are reported in the conventional form: chemical shift ( ppm), multiplicity (s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet, br=broad), coupling constant (Hz), integration. Data for .sup.13C are reported in terms of chemical shift ( ppm) and multiplicity. High-resolution mass spectra were obtained with a JEOL JMS-600H High Resolution Mass Spectrometer at the California Institute of Technology Mass Spectral Facility. Reactions were monitored using thin layer chromatography (Merck 60 silica gel plates) using an UV-lamp for visualization. Optical rotation was measured using a JASCO P-2000 Polarimeter.

[0314] Gas chromatography (GC) analyses were carried out using a Shimadzu GC-17A gas chromatograph, a FID detector, and J&W scientific cyclosil-B columns (30 m0.32 mm, 0.25 m film and 30 m0.25 mm, 0.25 m film). High-performance liquid chromatography (HPLC) was carried out using an Agilent 1200 series, an UV detector, and an Agilent XDB-C18 column (4.6150 mm, 5 m). Cyclopropane product standards for the reaction of ethyl diazoacetate (EDA) with styrene (ethyl 2-phenylcyclopropane-1-carboxylate) and -methylstyrene (ethyl 2-methyl-2-pehnylcyclopropane-1-carboxylate) were prepared as reported (A. Penoni et al., European Journal of Inorganic Chemistry, 1452 (2003)). These standards were used in co-injection experiments to determine the authenticity of enzyme-catalyzed cyclopropanes. Authentic P450 catalyzed cyclopropane samples were also prepared as described below and were characterized by NMR (.sup.1H and .sup.13C) and mass spectrometry. Azides 5 and 8, and benzosultam standards 6 and 9 were prepared as reported (J. V. Ruppel et al., Org. Lett. 9, 4889 (2007)). Benzosultam 11 was purchased from Sigma. These standards were used in co-injection experiments to determine the authenticity of P450-catalyzed benzosultams. Authentic P450 catalyzed benzosultam samples were also prepared as described below and were characterized by NMR (.sup.1H and .sup.13C) and mass spectrometry.

[0315] Plasmids pCWori[BM3] and pET22 were used as cloning vectors. Site-directed mutagenesis was accomplished by standard overlap mutagenesis using primers baring desired mutations (IDT, San Diego, Calif.). Electro-competent Escherichia coli cells were prepared following the protocol of Sambrook et al., Molecular cloning: a laboratory manual. (Cold Spring Harbor Laboratory Press, New York, 1989), vol. 2. Restriction enzymes BamHI, EcoRI, XhoI, Phusion polymerase, and T4 ligase were purchased from New England Biolabs (NEB, Ipswich, Mass.). Alkaline phosphatase was obtained from Roche (Nutley, N.J.). The 1,000 trace metal mix used in expression cultures contained: 50 mM FeCl.sub.3, 20 mM CaCl.sub.2, 10 mM MnSO.sub.4, 10 mM ZnSO.sub.4, 2 mM CoSO.sub.4, 2 mM CuCl.sub.2, 2 mM NiCl.sub.2, 2 mM Na.sub.2MoO.sub.4, and 2 mM H.sub.3BO.sub.3.

[0316] Enzyme library screening. Libraries are stored at 78 C. as glycerol stocks (Luria-Bertani medium (LB.sub.amp), 150 L, 25% v/v glycerol with 0.1 mg/mL ampicillin) in 96-well plates. These stocks were used to inoculate 96-shallow-well plates containing 300 L LB.sub.amp medium using a 96-pin stamp. Single colonies from site saturation libraries were picked with toothpicks and used to inoculate 300 L of LB.sub.amp. The cells were incubated at 37 C., 250 rpm, and 80% relative humidity overnight. After 16 h, 50 L aliquots of these over night cultures were transferred into 2 mL, deep-well plates containing terrific broth (TB.sub.amp) (800 L containing 0.1 mg/mL ampicillin, 1 L/mL trace metal mix and 20 mg L.sup.1 aminolevulinic acid) using a Multimek 96-channel pipetting robot (Beckman Coulter, Fullerton, Calif.). The cultures were incubated at 37 C. for 3 h and 30 min, and 30 min after reducing the incubation temperature to 25 C. (250 rpm, 80% relative humidity), 50 L isopropyl -D-1-thiogalactopyranoside (IPTG, 4.5 mM in TB.sub.amp) was added, and the cultures were allowed to continue for another 24 h at 25 C. (250 rpm, 80% relative humidity). Cells were then pelleted (3,000g, 15 min, 4 C.) and stored at 20 C. until further use, but at least for 2 h. For cell lysis, plates were allowed to thaw for 30 min at room temperature and then cell pellets were resuspended in 275 L phosphate buffer (0.1 M, pH=8.0, 0.65 mg/mL lysozyme, 10 mM magnesium chloride and 40 U/mL DNAse 1). The lysing cells were incubated at 37 C. for 1 h. Cell debris was separated by centrifugation at 5,000g and 4 C. for 15 min. The resulting crude lysates were then transferred to 96-well microtiter plates for CO assays and to 2 mL deep well plates for bioconversions.

[0317] CO binding assay. P450.sub.BM3 variants in cell lysate (40 L) were diluted with 60 L phosphate buffer (0.1 M, pH=8.0). To this solution was added 160 L sodium dithionite (0.1 M in phosphate buffer, 0.1 M, pH=8.0). The absorbance at 450 and 490 nm was recorded using a Tecan M1000 UV/Vis plate reader, and the microtiter plates were placed in a vacuum chamber. The chamber was sealed, evacuated to approximately 15 in Hg, purged with CO gas, and incubated for 30 min. The plates were then removed and the absorbance at 450 and 490 nm was again recorded using a plate reader. The difference spectra could then be used to determine the P450 concentration in each well as previously described (C. R. Otey, in Methods in Molecular Biology: Directed Enzyme Evolution, F. H. Arnold, G. Georgiou, Eds. (Humana Press, Totowa, N.J., 2003), vol. 230).

[0318] P450 expression and purification. For the enzymatic transformations, P450.sub.BM3 variants were used in purified form. Enzyme batches were prepared as follows. One liter TB.sub.amp was inoculated with an overnight culture (100 mL, LB.sub.amp) of recombinant E. coli DH5 cells harboring a pCWori plasmid encoding the P450 variant under the control of the tac promoter. After 3.5 h of incubation at 37 C. and 250 rpm shaking (OD.sub.600 ca. 1.8), the incubation temperature was reduced to 25 C. (30 min), and the cultures were induced by adding IPTG to a final concentration of 0.5 mM. The cultures were allowed to continue for another 24 hours at this temperature. After harvesting the cells by centrifugation (4 C., 15 min, 3,000g), the cell pellet was stored at 20 C. until further use but at least for 2 h. The cell pellet was resuspended in 25 mM Tris.Math.HCl buffer (pH 7.5 at 25 C.) and cells were lysed by sonication (21 min, output control 5, 50% duty cycle; Sonicator, Heat SystemsUltrasonic, Inc.). Cell debris was removed by centrifugation for 20 min at 4 C. and 27,000g and the supernatant was subjected to anion exchange chromatography on a Q Sepharose column (HiTrap Q HP, GE Healthcare, Piscataway, N.J.) using an AKTAxpress purifier FPLC system (GE healthcare). The P450 was eluted from the Q column by running a gradient from 0 to 0.5 M NaCl over 10 column volumes (P450 elutes at 0.35 M NaCl). The P450 fractions were collected and concentrated using a 30 kDa molecular weight cut-off centrifugal filter and buffer-exchanged with 0.1 M phosphate buffer (pH=8.0). The purified protein was flash-frozen on dry ice and stored at 20 C. P450 concentration was determined in triplicate using the CO binding assay described above (10 L P450 and 190 L 0.1 M phosphate buffer, pH 8.0, per well).

[0319] Thermostability measurements. Duplicate measurements were taken for all values reported on Tables 17 and 18. Purified P450 solutions (4 M, 200 L) were heated in a thermocycler (Eppendorf) over a range of temperatures (38 C.-65 C.) for 10 min followed by rapid cooling to 4 C. for 1 min. The precipitate was removed by centrifugation. The concentration of folded P450 remaining in the supernatant was measured by CO-difference spectroscopy (as described above). The temperature at which half of the protein was denatured (T.sub.50) was determined by fitting the data to the equation: f(T)=100/(1+exp(a*(TT.sub.50))).

[0320] Typical procedure for small-scale cyclopropanation bioconversions under anaerobic conditions. Small-scale reactions (400 L) were conducted in 2 mL crimp vials (Agilent Technologies, San Diego, Calif.). P450 solution (80 L, 100 M) was added to the vial with a small stir bar before crimp sealing with a silicone septum. Phosphate buffer (260 L, 0.1 M, pH=8.0) and 40 L of a solution of the reductant (100 mM sodium dithionite, or 20 mM NADPH) were combined in a larger crimp sealed vial and degassed by bubbling argon through the solution for at least 5 min (FIG. 3). In the meantime, the headspace of the 2 mL reaction vial with the P450 solution was made anaerobic by flushing argon over the protein solution no bubbling). When multiple reactions were conducted in parallel, up to 8 reaction vials were degassed in series via cannula. The buffer/reductant solution (300 L) was syringed into the reaction vial, while under argon. The gas lines were disconnected from the reaction vial before placing the vials on a plate stirrer. A 40 styrene solution in MeOH (10 L, typically 1.2 M) was added to the reaction vial via a glass syringe, and left to stir for about 30 s. A 40EDA solution in MeOH was then added (10 L, typically 400 mM) and the reaction was left stirring for the appropriate time. The final concentrations of the reagents were typically: 30 mM styrene, 10 mM EDA, 10 mM sodium dithionite, 20 M P450.

[0321] The reaction was quenched by adding 30 L HCl (3M) via syringe to the sealed reaction vial. The vials were opened and 20 L internal standard (20 mM 2-phenylethanol in MeOH) was added followed by 1 mL ethyl acetate. This mixture was transferred to a 1.8 mL eppendorf tube which was vortexed and centrifuged (16,000g 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by chiral phase GC.

[0322] A slightly modified work-up was implemented for kinetic experiments. The reactions were quenched after the set time by syringing 1 mL EtOAc to the closed vials and immediately vortexing the mixture. The vials were then opened and 20 L internal standard was added. The mixture was transferred to a 1.8 mL eppendorf tube, vortexed and centrifuged (16,000g, 1 min) The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by GC.

[0323] Typical procedure for preparative-scale cyclopropanation bioconversions under anaerobic conditions. The P450 solution was added to a Schlenk flask with a stir bar. With the flask kept on ice, the head-space was evacuated and back-filled with argon (4) with care not to foam the protein solution. Phosphate buffer and reductant were pre-mixed and degassed together in a separate round-bottom-flask by bubbling argon through the solution for 20 min. The buffer/reductant solution was transferred to the Schlenk flask via syringe. Styrene was added under argon and left to mix for 1 min. EDA. was added dropwise under argon. The solution was left to stir under argon until reaction completion. The reaction was quenched under argon by adding hydrochloric acid (3 M) to adjust the pH to 4, before opening the Schlenk flask. The reaction mixture was stirred with sodium chloride and dichloromethane (CH.sub.2Cl.sub.2). The combined emulsion layers were then filtered through Celite to break the emulsion and the Celite pad was rinsed with 320 mL CH.sub.2Cl.sub.2. The resulting biphasic mixture was transferred to a separating funnel and the organic phase was removed. The remaining aqueous phase was re-extracted with 340 mL CH.sub.2Cl.sub.2. The combined organic extracts were dried with sodium sulfate, filtered, and concentrated. The resulting residue was purified by SiO.sub.2 chromatography.

[0324] Summary of Mutations (with Respect to Wild-Type P450.sub.BM3) of P450 Cyclopropanases and Aminases. [0325] 7-11D (P. Meinhold et al., Adv. Synth. Catal. 348, 763 (2006)): R47C, V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, A82F, A328V [0326] 9-10A TS (J. C. Lewis et al., Chembiochem: A European Journal of Chemical Biology 11, 2502 (2010)): V78A, P142S, T175I, A184V, S226R, H236Q, E252G, A290V, L353V, I366V, E442K [0327] H2A10: 9-10A TS F87V, L75A, L181A, T268A [0328] H2-5-F10: 9-10A TS F87V, L75A, I263A, T268A, L437A [0329] H2-4-D4: 9-10A TS F87V, L75A, M177A, L181A, T268A, L437A [0330] C3C: 9-10A TS F87V T268A [0331] B1SYN (J. C. Lewis et al., Proceedings of the National Academy of Sciences USA 106, 16550 (2009)): R47C, V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, C47S, N70Y, A78L, F87A, I174N, I94K, V184T, I263M, G315S, A330V

Supplementary Data

[0332] Preliminary Experiments with Heme Proteins

[0333] The following six heme proteins were initially screened for cyclopropanase activity: catalase, chloroperoxidase (CPO), horseradish peroxidase (HRP), cytochrome C (cyt c), myoglobin (Mb) and P450.sub.BM3. Small-scale (400 L) reactions were conducted as described in section II and were analyzed by GC (cyclosil-B 30 m0.25 mm0.25 m): oven temperature=130 C. Table 7 shows heme catalysts under anaerobic conditions with sodium dithionite (Na.sub.2S.sub.2O.sub.4). Table 8 shows heme catalysts under anaerobic conditions without Na.sub.2S.sub.2O.sub.4. Table 9 shows heme catalysts under aerobic conditions with Na.sub.2S.sub.2O.sub.4, Table 10 shows heme catalysts under aerobic conditions without Na.sub.2S.sub.2O.sub.4.

Screening P450BM3 Variants for Cyclopropanation Activity

[0334] Lysate screening under aerobic conditions. The 92 P450.sub.BM3 variants in the compilation plate (Table 12) represent a diverse selection of P450.sub.BM3 scaffolds that have previously been engineered for monooxygenase activity on a variety of substrates, including but not limited to short alkane hydroxylation, demethylation of protected monosaccharides and oxidation of lead drug compounds. These P450.sub.BM3 variants carry various mutations (Table 12) accumulated along sequential rounds of engineering efforts for activity towards the target substrates. The compilation plate was expressed and lysed as described in above (enzyme library screening). 150 L lysate was transferred (Multimek 96-channel pipetting robot, Beckman Coulter, Fullerton, Calif.) to a 2 mL deep well plate, with 50 L of 120 mM Na.sub.2S.sub.2O.sub.4 in 0.1 M KPi (pH=8.0), 100 L, of a 30 mM styrene, 60 mM EDA mixed solution in 15% MeOH in 0.1 M KPi (pH=8.0) was added to the plate to initiate the reaction. The plate was sealed and was left shaking (300 rpm) for four hours. The plastic seal was removed and 30 L HCl (3 M) was added to quench the reaction followed by 20 L of an internal standard solution (20 mM -methylstyrene in methanol). The reactions were extracted by adding 500 L EtOAc and carefully vortexing the plate. The plate was centrifuged (1,700g) to separate the biphasic mixture. The top organic layer was transferred (2150 L) to a separate deep well plate. The extracts for each of the 92 reactions were dried through 92 separate anhydrous sodium sulfate plugs. The dried extracts were analyzed by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=60 C. 3 min, 7.5 C./min to 160 C., 20 C./min to 250 C., 250 C. 2 min, cis-cyclopropanes (20.3 min and 20.45 min), trans-cyclopropanes (21.8 min).

[0335] Determining the cyclopropanation activity of the top 10 hits in Tables 12-13 under anaerobic conditions. Small-scale reactions (400 L total volume) were conducted as described above and were analyzed by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 1 C./min to 135 C., 135 C. 10 min, 10 C./min to 200 C., 200 C. 5 min, cis-cyclopropanes (39.40 min and 40.20 min), trans-cyclopropanes (44.69 min and 45.00 min). Table 14 shows stereoselective P450.sub.BM3 based cyclopropanases.

Experimental Characterization of P450BM3 Cyclopropanases

[0336] Controls to confirm the enzymatic cyclopropanation activity of variant H2A10. Small scale reactions (400 L total volume) were set up and worked-up as described above. For the carbon monoxide (CO) inhibition experiment, the reaction vial and the buffer/reductant vial were purged with CO after having been purged with argon. For the boiled P450 experiment, a 100 M solution of variant H2A10 was heated at 60 C. for 10 min. For the hemin experiment, hemin (80 L) was added from a 1 mM solution in 50% DMSO-H2O, such that its final concentration in the reaction was 200 M. Complete System=10 mM styrene, 20 mM EDA, 20 mM Na.sub.2S.sub.2O.sub.4, 20 M P450 (H2A10) under anaerobic conditions. The dried ethyl acetate extracts were analyzed by chiral phase GC, using 2-phenylethanol as an internal standard (injector temperature=300 C., oven temperature=100 C. for 5 min, 1 C./min ramp up to 135 C., 135 C. for 10 min, 10 C./min ramp up to 200 C., 200 C. for 5 min). Elution time: cis-cyclopropanes (39.40 min and 40.20 min), trans-cyclopropanes (44.69 min and 45.00 min). Table 15 shows controls for P450 based cyclopropanation using variant H2A10.

[0337] Optimizing cyclopropanation reaction conditions for variant H2A10. Small-scale reactions (400 L final volume) were set up and worked up as described above. The dried ethyl acetate extracts were analyzed by chiral phase GC, using 2-phenylethanol as an internal standard (injector temperature=300 C., oven temperature=100 C. for 5 min, 5 C./min ramp up to 200 C., 20 C./min ramp up to 250 C., 250 C. for 5 min). Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min). The reaction conditions that gave optimal yields of cyclopropanes (with respect to EDA) were: 30 mM styrene, 10 mM EDA and 20 M P450 and were used in subsequent experiments.

[0338] Styrene concentration. FIG. 3 illustrates the effect of styrene concentration on cyclopropane yield.

[0339] P450 concentration. FIG. 4 illustrates the effect of P450 (H2A10) concentration on cyclopropane yield.

[0340] Dithionite concentration. Table 16 shows the effect of the concentration of Na.sub.2S.sub.2O.sub.4 on cyclopropane yield.

[0341] Mutational analysis of active site alanine substitutions in 9-10A TS F87V. Table 17 shows a mutational analysis of alanine substitutions on 9-10A TS F87V.

[0342] Sequential introduction of BM3-CIS active site mutations in wild-type P450.sub.BM3. Table 18 shows introducing BM3-CIS related active site mutations in wild-type P450.sub.BM3.

Active Site Saturation Mutagenesis of C3C.SUB.heme

[0343] Library construction. To simplify library construction and screening, only the C3C heme domain, which comprises residues 1-462 was used. This truncated enzymes lacks the P450 native reductase and exhibits similar activity and stereochemical control to the holo enzyme using dithionite as a reductant, but not NADPH. P450 site-directed mutagenesis and site-saturation libraries were assembled from PCR fragments generated from oligonucleotides containing the desired codon mutation or a degenerate NNK (or for reverse primers, the reverse complement MNN; where N=A,T,G,C, K=G,T and M=A,C) codon, which codes for all 20 amino acids and the TAG stop codon. PCR fragments were assembled using either standard overlap extension PCR or through restriction cloning using the Type IIS restriction enzyme, BsaI, depending on convenience.

[0344] Lysate screening under aerobic conditions. The compilation plate was expressed and lysed as described above (enzyme library screening), 150 L lysate was transferred (Multimek 96-channel pipetting robot, Beckman Coulter, Fullerton, Calif.) to a 2 mL deep well plate, with 50 L of 120 mM Na.sub.2S.sub.2O.sub.4 in 0.1 M KPi (pH=8.0). 100 L of a 90 mM styrene, 30 mM EDA mixed solution in 15% MeOH in 0.1 M KPi (pH=8.0) was added to the plate to initiate the reaction. The plate was sealed and was left shaking (300 rpm) for four hours. The plastic seal was removed and 30 L HCl (3 M) was added to quench the reaction followed by 20 L of an internal standard solution (20 mM 2-phenylethanol in methanol). Acetonitrile (400 L) was added before carefully vortexing the plate. The plate was centrifuged (1,700g), the supernatant was filtered (1 m glass, 96 well filter plate, Pall) and transferred (150 L) to a 96-well microliter plate (Agilent). Reactions were analyzed by reverse-phase HPLC (210 nm): 50% acetonitrile-water, 1.0 mL min.sup.1, cis-cyclopropanes (7.6 min), trans-cyclopropanes (9.7 min). Hits were selected based on enhancement of cis-selectivity over parent C3C.

[0345] Determining the cyclopropanation activity of hits from the site-saturation libraries under anaerobic conditions. Small-scale reactions (400 L total volume) were conducted as described above and were analyzed by GC (cyclosil-B 30 m0.25 mm0.25 m): oven temperature=130 C., 175 kPa, cis-cyclopropanes (39.40 min and 40.20 min), trans-cyclopropanes (44.69 min and 45.00 min). Table 19 shows the cyclopropanation activity of selected C3C.sub.heme active site variants

Kinetic Characterization of C3C

[0346] Determination of initial rates. Both styrene and EDA concentrations were varied in the presence of the P450s expressed as the heme-domain (0.5 or 1.0 M C3C.sub.heme). Reactions were set up in phosphate buffer (pH=8.0) with sodium dithionite as the reductant at 298 K, and were worked-up as described above. Three time points were taken and used to determine the rate of product formation by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min). Kinetic parameters were determined by fitting the data to the standard Michaelis-Menten model.

[0347] FIG. 5 illustrates the initial velocities plot for C3C.sub.heme. (A) EDA concentration was varied at a saturating concentration of styrene (30 mM). (B) Styrene concentration was varied at a fixed concentration of EDA (20 mM). Table 20 shows the Michaelis-Menten parameters for P450 cyclopropanation catalysts. Table 21 shows kinetic parameters for wild-type cytochrome P450s acting on their native substrates and for an engineered variant of P450.sub.BM3 (propane monooxygenase, PMO) acting on the non-native substrate propane. Table 22 shows the effect of EDA addition at t=30 min on C3C-catalyzed cyclopropanations.

Substrate Scope of P450 Cyclopropanases

[0348] Small-scale reactions. Selected P450 catalysts were surveyed at a small-scale (400 L total volume) for each combination of reagents (olefins and diazo esters). The small-scale anaerobic bioconversions were conducted as described above and were analyzed by GC. Table 23 shows the substrate scope of P450 cyclopropanation catalysts: p-methylstyrene+EDA. Table 24 shows the substrate scope of P450 cyclopropanation catalysts: p-vinylanisole+EDA. Table 25 shows the substrate scope of P450 cyclopropanation catalysts: p-(trifluoromethyl)styrene. Table 26 shows the substrate scope of P450 cyclopropanation catalysts: -methyl styrene. Table 27 shows the substrate scope of P450 cyclopropanation catalysts: t-butyl diazoacetate.

[0349] Preparative-scale bioconversions. These reactions were conducted anaerobically as described above.

[0350] Cyclopropanation of styrene with EDA.

##STR00136##

Prepared using 1.5 mmol styrene (3 equiv), 0.5 mmol FDA (1 equiv) and 1 mol C3C.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 25 mg of the cis-cyclopropane (1) and 8 mg of a mixture of cyclopropanes with trans (2) in 5:1 excess over cis (C. J. Sanders et al., Tetrahedron: Asymmetry 12, 1055 (2001); M. Lenes Rosenberg et al., Organic Letters 11, 547 (2009); Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007)). Diagnostic data for the cis-cyclopropane 1: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.28 (m, 4H), 7.21 (m, 1H), 3.89 (q, J=7.1 Hz, 2H), 2.60 (m, 1H), 2.10 (m, 1H), 1.73 (m, 1H), 1.35 (m, 1H), 0.99 (t, J=7.1 Hz, 3H); .sup.13C (CDCl.sub.3, 125 MHz): 170.99, 136.56, 129.31, 127.88, 126.63, 60.18, 25.47, 21.80, 14.02, 11.12; [].sup.25.sub.D=7.056 (c 0.83, CHCl.sub.3). Diagnostic data for the trans-cyclopropane 2: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.20 (m, 3H), 7.03 (m, 2H), 4.10 (q, J=7.1 Hz, 2H), 2.45 (m, 1H), 1.83 (m, 1H), 1.53 (m, 1H), 1.23 (m, 1H), 1.21 (t, J=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 173.43, 140.13, 128.46, 126.55, 126.16, 60.72, 26.18, 24.20, 17.09, 14.27; [].sup.25.sub.D=+199.2 (c 0.50, CHCl.sub.3). MS (EI.sup.+) m/z: 190 (M.sup.+), 162 (PhCH(CH.sub.2)CHCO2.sup.+), 145 (PhCH(CH.sub.2)CHCO.sup.+). The absolute configuration of compounds 1 and 2 was determined by comparison of the sign of their optical rotations with that reported (N. Watanabe et al. Heterocycles 42, 537 (1996)). The enantiomeric excess was determined to be 92% for the cis-cyclopropane and 88% for the trans-cyclopropane by GC.

[0351] Cyclopropanation of p-methylstyrene with EDA.

##STR00137##

[0352] Prepared using 1.5 mmol styrene (3 equiv), 0.5 mmol EDA (1 equiv) and 1 mol C3C.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 10 mg of the cis-cyclopropane (3) and 16 mg of a mixture of cyclopropanes with trans(4):cis/2:1 (Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007)). Diagnostic data for the cis-cyclopropane 3: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.17 (d, J=8.0 Hz, 2H), 7.08 (d, J=8.0 Hz, 2H), 3.91 (q, J=7.1 Hz, 2H), 2.56 (m, 1H), 2.32 (s, 3H) 2.06 (m, 1H), 1.69 (m, 1H), 1.32 (m, 1H), 1.02 (t, J=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 171.12, 136.12, 133.42, 129.14, 128.60, 60.17, 25.23, 21.68, 21.10, 14.08, 11.21. Diagnostic data for the trans-cyclopropane 4: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.09 (d, J=8.0 Hz, 2H), 7.01 (d, J=8.0 Hz, 2H), 4.19 (q, J 7.1 Hz, 2H), 2.50 (m, 1H), 2.33 (s, 3H), 1.88 (m, 1H), 1.59 (m, 1H), 1.33 (m, 1H), 1.29 (t,=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 173.58, 137.04, 136.08, 129.12, 126.10, 60.66, 25.94, 24.06, 21.11, 16.96, 14.28. MS (EI.sup.+) m/z: 204 (M.sup.+), 175 ([M-Et].sup.+) 131 ([M-COOEt].sup.+). The enantiomeric excess was determined to be 82% for the cis-cyclopropane by GC. Baseline resolution of the trans-enantiomers could not be achieved.

[0353] Cyclopropanation of p-methoxystyrene with EDA.

##STR00138##

[0354] Prepared using 1.5 mmol styrene (3 equiv), 0.5 mmol EDA (1 equiv) and 1 mol C3C.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 16 mg of the trans-cyclopropane (6) and 3 mg of a mixture of cyclopropanes with cis:trans/5:1 (Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007)). Diagnostic data for the trans-cyclopropane 6: 6.96 (m, 3H), 6.75 (m, 2H), 4.09 (q, J=7.1 Hz, 2H), 3.72 (s, 3H), 2.41 (m, 1H), 1.75 (m, 1H), 1.48 (m, 1H), 1.21 (t, J=7.1 Hz, 3H), 1.18 (m, 1H). MS (EI.sup.+) m/z: 220 (M.sup.+), 191 ([M-Et].sup.+), 175 ([M-EtO].sup.+), 147 ([M-COOEt].sup.+). The enantiomeric excess was determined to be 38% for the cis-cyclopropane by GC. The trans-enantiomers did not resolve to baseline resolution.

[0355] Cyclopropanation of styrene with t-butyl diazo acetate.

##STR00139##

[0356] Prepared using 0.75 mmol styrene (3 equiv), 0.24 mmol t-BuDA (1 equiv) and 0.5 mol C3C.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 9 mg of the trans-cyclopropane (8) (C. J. Sanders et al., Tetrahedron: Asymmetry 12, 1055 (2001); Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007)). Diagnostic data for the trans-cyclopropane 4: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.20 (m, 2H), 7.12 (m, 1H), 7.02 (m, 2H), 2.36 (m, 1H), 1.76 (m, 1H), 1.45 (m, 1H), 1.40 (s, 9H), 1.16 (m, 1H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 172.58, 140.52, 128.42, 126.32, 126.07, 80.57, 28.17, 25.75, 25.31, 17.08. MS (EI.sup.+) m/z: 218 (M.sup.+), 145 ([M-OtBu].sup.+).

Example 2

In Vivo and In Vitro Olefin Cyclopropanation Catalyzed by Heme Enzymes

[0357] This example illustrates the use of heme containing enzymes to catalyze the conversion of olefins to various products containing one or more cyclopropane functional groups. In certain aspects, this example demonstrates novel variants of cytochrome P450.sub.BM3 (CYP102A1). These variants have an improved ability to use diazo esters as carbene precursors and cyclopropanate various olefins. Preferred variants include cytochrome P450.sub.BM3 mutants having C400S and T268A amino acid substitutions and engineered variants of other P450s having the equivalent substitutions. Variants with axial serine coordination efficiently catalyze the cyclopropanation reaction in whole cells sustaining over 10,000 total turnovers.

Introduction

[0358] The many strategies for functionalizing CC and CH bonds that have evolved in Nature have captivated the imaginations of chemists and form the foundation of biomimetic chemistry (J. T. Groves, Proceedings of the National Academy of Sciences U.S.A. 100, 3569 (2003); R. Breslow, Journal of Biological Chemistry 284, 1337 (2009)). The reverse of this, using inspiration from synthetic chemistry to discover and develop new biocatalysts, is a nascent frontier in molecular engineering whose recent highlights include CH activation by artificial rhodium enzymes (T. K. Hyster et al., Science 338, 500 (2012)) and the de novo design of Diels-Alderases (T. K. Hyster et al., Science 338, 500 (2012); J. B. Siegel et al., Science 329, 309 (2010)). Synthetic chemists have developed powerful methods for direct CC and CH functionalization based on transition metal-catalyzed carbenoid and nitrenoid transfers, reactions that are widely used to synthesize natural product intermediates and pharmaceuticals (H. M. L. Davies et al., Nature 451, 417 (2008)). The asymmetric cyclopropanation of olefins with high-energy carbene precursors (e.g., acceptor-substituted diazo reagents) is a hallmark reaction that generates up to 3 stereogenic centers in a single step to make the important cyclopropane motif, featured in many natural products and therapeutic agents (H. Lebel et al., Chemical Reviews 103, 977 (2003)). Limited to using physiologically accessible reagents, Nature catalyzes intermolecular cyclopropane formation through wholly different strategies, typically involving olefin addition to the methyl cation of S-adenosyl methionine or through cyclization of dimethylallyl pyrophosphate-derived allylic carbenium ions (L. A. Wessjohann et al., Chemical Reviews 103, 1625 (2003)). As a result, the diverse cyclopropanation products that can be formed by metallocarbene chemistry cannot be readily accessed by engineering natural cyclopropanation enzymes. This example describes a natural metalloenzyme, the iron-heme-containing cytochrome P450, engineered to catalyze formal carbenoid transfers, thereby combining the high levels of regio- and stereoselectivity of enzymes with the synthetic versatility of carbene-based strategies. An enzyme is non-toxic, could be used in a primarily aqueous medium at ambient temperatures, and could be significantly less expensive to prepare than current transition metal catalysts.

Results

[0359] Members of the cytochrome P450 enzyme family catalyze myriad oxidative transformations, including hydroxylation, epoxidation, oxidative ring coupling, heteroatom release, and heteroatom oxygenation (E. M. Isin et al., Biochim. Biophys. Acta, 1770, 314 (2007)). Most transformations encompassed by this broad catalytic scope manifest the reactivity of the same high-valent iron-oxene intermediate (Compound I, FIG. 1). Inspired by the impressive chemo-, regio- and stereoselectivities with which cytochrome P450s can insert oxygen atoms into CH and CC bonds, the present inventors investigated whether these enzymes could be engineered to mimic this chemistry for isoelectronic carbene transfer reactions via a high-valent iron-carbenoid species (FIG. 1). This example demonstrates that variants of the cytochrome P450 from Bacillus megaterium (CYP102A1, or P450.sub.BM3) are efficient catalysts for the asymmetric cyclopropanation of styrenes and other olefins.

[0360] Because iron porphyrins have been reported to catalyze carbene-based cyclopropanations (J. R. Wolf et al., J. Am. Chem. Soc. 117, 9194 (1995); B. Morandi et al., Science 335, 1471 (2012)), whether some common heme proteins display measurable levels of cyclopropanation activity in aqueous media (phosphate buffer, 5% methanol co-solvent) was first probed. The reaction between styrene and ethyl diazoacetate (EDA) was chosen (FIG. 2), a well-recognized model system for validating new cyclopropanation catalysts. The experiments showed that optimal formation of the desired cyclopropanation products occurred in the presence of a reducing agent (e.g., sodium dithionite, Na.sub.2S.sub.2O.sub.4) under anaerobic conditions (Tables 7-10). Horseradish peroxidase (HRP), cytochrome c (cyt c), myoglobin (Mb) and P450.sub.BM3 all displayed multiple turnovers towards the cyclopropane products, with HRP, cyt c and Mb showing negligible enantioinduction and formed the trans cyclopropane with over 90% diastereoselectivity, which is comparable to the diastereoselectivity induced by free hemin (Table 7). P450.sub.BM3, despite forming the cyclopropane products in low yield, catalyzed the reaction with different diasteroselectivity (cis:trans 37:63) and slight enantioinduction (Table 28), showing that carbene transfer and selectivity are dictated by the heme cofactor bound in the enzyme active site.

TABLE-US-00029 TABLE 28 Stereoselective P450.sub.BM3 cyclopropanation catalysts. Reactions were run in aqueous phosphate buffer (pH 8.0) and 5% MeOH cosolvent at room temperature under argon with 30 mM styrene, 10 mM EDA, 0.2 mole % catalyst (with respect to EDA), and 10 mM Na.sub.2S.sub.2O.sub.4. Yields, diastereomeric ratios, and enantiomeric excess were determined by GC analysis. Yields based on EDA. Catalyst % yield TTN cis:trans % ee.sub.cis* % ee.sub.trans Hemin 15 73 6:94 1 0 P450.sub.BM3 1 5 37:63 27 2 P450.sub.BM3-T268A 65 323 1:99 15 96 9-10A-TS-F87V 1 7 35:65 41 8 H2-5-F10 59 294 16:84 41 63 H2A10 33 167 60:40 95 78 H2-4-D4 41 206 53:47 79 33 BM3-CIS 40 199 71:29 94 91 BM3-CIS-I263A 38 190 19:81 62 91 BM3-CIS-A328G 37 186 83:17 52 45 BM3-CIS-T438S 59 293 92:8 97 66 BM3-CIS-C400S 29 150 93:7 99 51 TTN = total turnover number. *(R, S)-(S, R). (R, R)-(S, S). See, below for protein sequences indicating mutations from wild type P450.sub.BM3. Variant 9-10A-TS-F87V-T268A (herein called BM3-CIS).

[0361] The activity levels exhibited by the native proteins tested are not suitable for practical synthetic applications. Whether the activity and selectivity of heme-catalyzed cyclopropanation could be enhanced by engineering the protein sequence was therefore explored. P450.sub.BM3 is a well-studied, soluble, self-sufficient (heme and diflavin reductase domains are fused in a single polypeptide, 120 KDa), long-chain fatty acid monooxygenase. More than a decade of protein engineering attests to the functional plasticity of this biocatalyst (C. J. C. Whitehouse et al., Chemical Society Reviews 41, 1218 (2012)). Thousands of variants that exhibit monooxygenase activity on a wide range of substrates have been accumulated from the use of engineered cytochrome P450.sub.BM3 for synthetic applications (T. C. Lewis et al., Chimia 63, 309 (2009)). Some of these variants were tested for altered cyclopropanation diastero- and enantioselectivity by analysis of product distributions using gas chromatography (GC) with a chiral stationary phase. A panel of 92 P450.sub.BM3 variants, chosen for diversity of activity and protein sequence, was screened in E. coli lysate for the reaction of styrene and EDA under aerobic conditions in the presence of Na.sub.2S.sub.2O.sub.4 (Tables 12 and 13). The ten most promising hits were selected for purification and characterization under standardized anaerobic reaction conditions (Tables 14 and 28).

[0362] Five of the ten selected P450s showed improvements in activity compared to wild type (total turnover numbers (TTN)>100), a comprehensive range of diastereoselectivities with cis:trans ratios varying from 9:91 to 60:40, and up to 95% enantioselectivities (Table 14). For example, variant H2-5-F10, which contains 16 amino acid substitutions, catalyzes 294 total turnovers, equivalent to 58% yield under these conditions (0.2% enzyme loading with respect to EDA). This represents a 50-fold improvement over wild type P450.sub.BM3. Furthermore, mutations affect both the diastereo- and enantioselectivity of cyclopropanation: H2-5-F10 favors the trans cyclopropanation product (cis:trans 16:84) with 63% ee.sub.trans, whereas H2A10, with a TTN of 167, shows reversed diastereoselectivity (cis:trans 60:40) with high enantioselectivity (95% ee.sub.cis).

[0363] H2A10 was used to verify the role of the enzyme in catalysis and identify better reaction conditions (Table 15, FIGS. 3 and 4). Heat inactivation produced diastereo- and enantioselectivities similar to those obtained with free hemin, consistent with protein denaturation and release of the cofactor. Complete inhibition was achieved by pre-incubating the reaction mixture with carbon monoxide, which irreversibly binds the reduced P450 heme, confirming that catalysis occurs at the active site. Air inhibited the cyclopropanation reaction by about 50%, showing that dioxygen and EDA compete for reduced Fe.sup.II. Cyclopropanation was also achieved with NADPH as the reductant, confirming that the activity can also be driven by the endogenous electron transport machinery of the diflavin-containing reductase domain. The presence of a reducing agent in sub-stoichiometric amounts proved essential for cyclopropanation (Table 16), implying that the active species is Fe.sup.II rather than the resting state Fe.sup.III.

[0364] Highly active P450.sub.BM3 variants H2A10, H2-5-F10 and H2-4-D4 have three to five active site alanine substitutions with respect to 9-10A-TS-F87V (12 mutations from P450.sub.BM3), which itself shows negligible cyclopropanation activity. These variants exhibit a range of TTN, diastereoselectivity, and enantioselectivity (Table 28). To better understand how protein sequence controls P450-mediated cyclopropanation, 12 variants were constructed to assess the contributions of individual alanines to catalysis and stability (Table 17). T268A is key for achieving high cyclopropanation activity, and this mutation alone converts inactive 9-10A-TS-F87V into an active cyclopropanation catalyst. Variant 9-10A-TS-F87V-T268A (herein called BM3-CIS) is a competent cyclopropanation catalyst (199 TTN), displays strong preference for the cis product (cis:trans 71:29), forms both diastereomers with over 90% ee, and is as stable as wild-type P450.sub.BM3. Other active site alanine mutations tune the product distribution. Notably, the addition of I263A to BM3-CIS reverses diastereoselectivity (cis:trans 19:81). The effects of similar mutations introduced in the poorly active wild type P450.sub.BM3 were also investigated (Table 18). Impressively, P450.sub.BM3-T268A, with a single mutation, is an active cyclopropanation catalyst (323 TTN, Table 28) with exquisite trans-selectivity (cis:trans 1:99) and high enantioselectivity for the major diastereomer (96% ee.sub.trans, Table 28). Whereas BM3-CIS is a cis-selective cyclopropanation catalyst, identical active site mutations in wild type P450.sub.BM3 result in a trans-selective enzyme (Table 18), demonstrating that mutations outside of the active site also influence the stereochemical outcome.

[0365] Because the design of cis-selective small-molecule catalysts for diazocarbonyl-mediated cyclopropanations has proven more challenging than their trans counterparts (A. Caballero et al., European Journal of Inorganic Chemistry, 1137 (2009)), whether active site engineering of P450.sub.BM3 could provide robust cis-selective water-compatible catalysts to complement existing organometallic systems was investigated (I. Nicolas et al., Coordination Chemistry Reviews 252, 727 (2008)). Five active site residues (L181, I263, A328, L437, T438) were chosen for individual site-saturation mutagenesis. The A328G, T438A, T438S and T438P variants exhibited enhanced cis-selectivity (Table 19). Notably A328G also reversed the enantioselectivity for the cis-diastereomer (Table 28). BM3-CIS-T438S displayed the highest diastereo- and enantioselectivities (cis:trans 92:8 and 97% ee.sub.cis) and maintained TTN comparable to BM3-CIS (Table 28).

[0366] Variant 9-10A-TS-F87V-T268A (BM3-CIS) exhibits Michaelis-Menten kinetics (FIG. 5 and Table 20) with relatively high K.sub.M values for the olefin (1.5 mM) and the diazoester (5 mM), reflecting the lack of evolutionary pressure for this enzyme to bind these substrates. BM3-CIS exhibits a notable k.sub.cat for cyclopropanation of 100 min.sup.1, comparable to the k.sub.cat of many native P450s for hydroxylation, but about fifty times less than P450.sub.BM3-catalyzed fatty acid hydroxylation (Table 21). Free hemin does not exhibit saturation kinetics and displays slower initial rates than BM3-CIS (only 30 min.sup.1 at 10 mM styrene and 15 mM EDA), indicating that the protein scaffold enhances k.sub.cat compared to the free cofactor in solution. When used at 0.2 mol % equivalent, BM3-CIS-catalyzed cyclopropanations reached completion after 30 minutes. Adding more EDA enhanced turnovers for cyclopropanes and preserved variant 9-10A-TS-F87V-T268A (BM3-CIS) stereoselectivity (Table 22), confirming catalyst integrity and implying that the reaction stops because of EDA depletion rather than protein inactivation.

[0367] This example shows that different variants of this enzyme will accept a wide range of substrates for cyclopropanation. To begin to assess the substrate scope of P450.sub.BM3-catalyzed cyclopropanation, the activities of six variants were investigated against a panel of olefins and diazo compounds (Tables 29-34).

TABLE-US-00030 TABLE 29 Scope of P450 catalyzed cyclopropanation of styrenyl substrates. Ar = p-X-C.sub.6H .sub.4. [00140]embedded image [00141]embedded image [00142]embedded image Reagents P450 catalyst TTN Z:E % ee.sub.z % ee.sub.E R.sub.1 = H, X = Me, R.sub.2 = Et BM3-CIS 228 78:22 81 N/A R.sub.1 = H, X = OMe, R.sub.2 = Et H2-5-F10 364 11:89 38 N/A R.sub.1 = H, X = CF.sub.3, R.sub.2 = Et 7-11D 120 76:24 31 59 R.sub.1 = Me, X = H, R.sub.2 = Et 7-11D 157 41:49 42 N/A R.sub.1 = H, X = H, R.sub.2 = t-Bu H2A10 120 3:97 N/A N/A Reaction conditions: 20 M catalyst, 30 mM olefin, 10 mM diazoester, 10 mM Na.sub.2S.sub.2O.sub.4, under argon in aqueous potassium phosphate buffer (pH 8.0) and 5% MeOH cosolvent for 2 hours at 298K. Enzyme loading is 0.2 mol % with respect to diazoester. N/A = not available when enantiomers did not separate to baseline resolution. Variant 9-10A-TS-F87V-T268A (herein called BM3-CIS).

TABLE-US-00031 TABLE 30 Substrate scope of P450 cyclopropanation catalysts: p-methylstyrene + EDA. [00143]embedded image [00144]embedded image P450 % yield TTN cis:trans % ee cis % ee trans* 7-11D 21 104 54:46 0.3 N/A H2-5-F10 44 222 11:89 14.9 N/A C2G9 R1 18 92 10:90 8.9 N/A H2A10 10 50 43:57 84.3 N/A 9-10A-TS-F87V- 46 228 78:22 81.4 N/A T268A (BM3-CIS) BM3-CIS-C400S 32 157 93:7 87.1 N/A Hemin 7 37 6:94 1.6 N/A GC (cyclosil-B column 30 m 0.32 mm, 0.25 m film): oven temperature = 100 C. for 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution times: cis-cyclopropanes (21.03 and 21.18 min), trans-cyclopropanes (22.71 min). *trans-enantiomers did not resolve.

TABLE-US-00032 TABLE 31 Substrate scope of P450 cyclopropanation catalysts: p-vinylanisole + EDA. [00145]embedded image [00146]embedded image % ee % ee P450 % yield TTN cis:trans cis trans* 7-11D 59 297 70:30 27 N/A H2-5-F10 73 364 11:89 38 N/A C2G9 R1 39 196 10:90 1 N/A H2A10 16 80 40:60 75 N/A 9-10A-TS-F87V- 43 214 48:52 44 N/A T268A (BM3-CIS) BM3-CIS-C400S 47 235 81:19 61 N/A hemin 19 96 7:93 0 N/A GC oven temperature = 110 C. for 8 min, 2 C./min to 180 C. then 180 C. for 30 min, 175 kPa. Cyclosil-B column (30 m 0.25 mm, 0.25 m film). Elution times: cis-cyclopropanes (38.74 and 39.52 min), trans-cyclopropanes (43.07 min). *Baseline resolution could not be achieved for the trans-enantiomers.

TABLE-US-00033 TABLE 32 Substrate scope of P450 cyclopropanation catalysts: p-(trifluoromethyl)styrene. [00147]embedded image [00148]embedded image [00149]embedded image % ee % ee P450 % yield* TTN* cis:trans cis trans 7-11D 24 120 76:24 31 59 H2-5-F10 40 198 26:74 72 65 C2G9 R1 18 89 10:90 4 0 H2A10 9 47 26:74 24 22 9-10A-TS-F87V- 42 211 39:61 54 93 T268A (BM3-CIS) BM3-CIS-C400S 24 121 76:24 55 75 hemin 2 9 11:89 1 1 *Assumed the same detector response factor as for ethyl 2-(4-methylphenyl)cyclopropane-1-carboxylate. GC (cyclosil-B column 30 m 0.25 mm, 0.25 m film): oven temperature = 110 C. for 8 min, 2 C./min to 180 C. then 180 C. for 30 min, 175 kPa. Elution times: cis-cyclopropanes (27.26 and 28.11 min), trans-cyclopropanes (30.78 and 30.99 min).

TABLE-US-00034 TABLE 33 Substrate scope of P450 cyclopropanation catalysts: -methyl styrene. [00150]embedded image [00151]embedded image [00152]embedded image P450 % yield TTN Z:E % ee (Z) % ee (E)* 7-11D 31 157 41:49 42 N/A H2-5-F10 66 329 21:79 14 N/A C2G9 R1 77 387 16:84 4 N/A H2A10 34 168 19:81 31 N/A 9-10A-TS-F87V- 26 127 16:84 6 N/A T268A (BM3-CIS) WT F87V T268A 62 312 7:93 3 N/A BM3-CIS-C400S 17 86 30:70 34 N/A hemin 15 77 24:76 0 N/A GC oven temperature = 100 C. for 5 min, 1 C./min up to 135 C., 135 C. for 10 min, 10 C./min up to 200 C., 200 C. for 5 min. Cyclosil-B column (30 m 0.32 mm, 0.25 m film). Elution times: Z-cyclopropanes (34.96 and 35.33 min), E-cyclopropanes (39.34 and 39.61 min). *trans-enantiomers did not separate to baseline resolution.

TABLE-US-00035 TABLE 34 Substrate scope of P450 cyclopropanation catalysts: t-butyl diazoacetate. [00153]embedded image [00154]embedded image [00155]embedded image P450 % yield* TTN* cis:trans WT F87V T268A 1.4 7 4:96 7-11D 11 54 13:87 H2-5-F10 18 90 3:97 H2A10 24 120 3:97 9-10A-TS-F87V- 0.3 2 3:97 T268A (BM3-CIS) BM3-CIS-C400S 15 76 8:92 hemin 20 100 4:96 *Assumed the same detector response factor as for ethyl 2-(4-methylphenyl)cyclopropane-1-carboxylate. GC (cyclosil-B column 30 m 0.32 mm, 0.25 m film): oven temperature = 100 C. for 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution times: cis-cyclopropanes (21.66 min), trans-cyclopropanes (23.31 min). Cis- and trans-enantiomers did not resolve.

[0368] P450 cyclopropanation is robust to both electron-donating (p-vinylanisole, p-vinyltoluene) and electron-withdrawing (p-trifluoromethylstyrene) substitutions on styrene, and variant 7-11D showed consistent cis-selectivity for these substrates. The P450s were also active on 1,1-disubstituted olefins (e.g., -methyl styrene), with chimeric P450 C2G9R1 forming cyclopropanes in 77% yield (with respect to EDA). The P450s were only moderately active with t-butyl diazoacetate as substrate (<30% yield), forming the trans product with >87% selectivity and offering no advantage over free hemin (Table 34). For reactions involving EDA and aryl-substituted olefins, however, the P450s consistently outperformed the free cofactor in both activity and stereoselectivity. An appropriate catalyst for a given substrate can be found by testing the substrate against engineered or native P450s, as demonstrated above. Directed evolution methods well known to those of skill in the art can be used to enhance catalyst activity.

[0369] P450-derived cyclopropanases containing both heme and reductase domains remain competent monooxygenases, preferentially producing styrene oxide in the presence of NADPH under air. The possibility of generating a specialist cyclopropanase that has no promiscuous monooxygenase activity was investigated. It is known that proximal cysteinate ligation (by C400 in P450.sub.BM3) is important for dioxygen activation and stabilization of compound I during monooxygenation (J. H. Dawson, Science 240, 433 (1988)). As evidenced by the ability of free hemin to catalyze cyclopropanation, this ligand is likely not required for carbene transfer reactions, although it is required for the enzyme to catalyze monooyxgenation reactions. Site-saturation mutagenesis of C400 in wild-type P450.sub.BM3 revealed that only the isosteric C400S mutation led to folded home-bound protein. Since this mutation has been reported to abolish monooxygenation activity in mammalian P450s (K. P. Vatsis et al., Journal of Inorganic Biochemistry 91, 542 (2002)), BM3-CIS-C400S was created, which remains an active cyclopropanase that is able to initiate the catalytic cycle by utilizing electrons from either dithionite (150 TTN) or NADPH (304 TTN). Unexpectedly, BM3-CIS-C400S displays considerably improved diastereo-(cis:trans/dithionite 93:7; NADPH 72:28) and enantioselectivity (dithionite 99% ee.sub.cis; NADPH 94% ee.sub.cis) compared to its cysteine homologue (Tables 35-36 and FIG. 6) and is a much more active NADPH-driven cyclopropanase (FIG. 7).

TABLE-US-00036 TABLE 35 Effect of C400S mutation on BM3-CIS-mediated cyclopropanation driven by Na.sub.2S.sub.2O.sub.4. [00156]embedded image [00157]embedded image [00158]embedded image O.sub.2 % % Yield inhibition cis: ee ee P450 Conditions (%).sup.a TTN (%) trans.sup.b cis.sup.c trans.sup.d BM3- Anaerobic 29 143 77:23 94 91 CIS.sub.heme BM3- Aerobic 11 55 62 65:35 87 86 CIS.sub.heme BM3-CIS- Anaerobic 30 151 93:7 99 51 C-400S.sub.heme BM3-CIS- Aerobic 0.6 3 98 45:55 79 31 C-400S.sub.heme .sup.abased on EDA. .sup.bDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.c(R,S) (S,R). .sup.d(R,R) (S,S). Variant 9-10A-TS-F87V-T268A (herein called BM3-CIS).

TABLE-US-00037 TABLE 36 In vitro activities for purified P411.sub.BM3-CIS vs P450.sub.BM3-CIS driven by NADPH. [00159]embedded image [00160]embedded image TTN TTN styrene O.sub.2 cyclopropanes oxide TTN.sub.cyc/ inhibition % ee % ee Cat. Conditions (TTN.sub.cyc) (TTN.sub.epo) TTN.sub.epo (%) cis:trans.sup.a cis.sup.b trans.sup.c P450.sub.BM3-CIS Anaerobic 60 18 12 10 5 60:40 89 53 P450.sub.BM3-CIS Aerobic 82 13 406 21 0.20 +36 56:44 88 58 P411.sub.BM3-CIS Anaerobic 304 15 0 72:28 92 19 P411.sub.BM3-CIS Aerobic 43 5 14 2 3.1 86 49:51 74 14 .sup.aDiastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.b(R,S) (S,R). .sup.c(R,R) (S,S). Small-scale reactions (400 L total volume) were conducted as described below with the following modifications: glucose dehydrogenase (GDH, 4 L, 225 U mL.sup.1) was added to the reaction vial together with the P450 solution. Glucose (40 L, 250 mM) and NADPH (40 L, 5 mM) were degassed together with the buffer solution. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. The small amounts of epoxide formed by P450.sub.BM3-CIS under anaerobic conditions are due to dioxygen contamination in the small-scale reactions in the experiments. Variant 9-10A-TS-F87V-T268A (herein called BM3-CIS).

[0370] Under aerobic conditions in the presence of NADPH, BM3-CIS-C400S forms negligible amounts of styrene oxide and is still able to form cyclopropanes (43 TTN), in marked contrast to BM3-CIS, which forms styrene oxide as the major product (FIG. 7). Cyclopropanation activity in BM3-CIS-C400S remains, however, severely inhibited by dioxygen (FIG. 7). It is noteworthy that Vatsis et al. have shown that the mammalian P450 CYP2B4-C436S which also has its proximal cysteine mutated to a serine is able to use electrons from NADH to reduce dioxygen to hydrogen peroxide. In particular, Vatsis et al. have shown that serine-heme P450s can function as a two-electron oxidase, accepting electrons from NADPH and reducing dioxygen to hydrogen peroxide. This peroxide generation activity can therefore be in competition with cyclopropanation under aerobic conditions.

[0371] BM3-CIS-C400S exhibits Michaelis-Menten kinetics (FIG. 8 and Table 37) with similar K.sub.M values for the olefin (1.5 mM) and the diazocarbene (5 mM) as variant 9-10A-TS-F87V-T268A (BM3-CIS). Replacement of axial thiolate ligation with serine decreases the k.sub.cat to about 20 min.sup.1.

TABLE-US-00038 TABLE 37 Michaelis-Menten parameters for P450 cyclopropanases. K.sub.cat/(K.sub.M-EDA k.sub.cat K.sub.M-EDA K.sub.M-styrene k.sub.cat/K.sub.M-EDA k.sub.cat/K.sub.M-styrene K.sub.M-styrene) Catalyst (min.sup.1) (mM) (mM) (s.sup.1 M.sup.1) (s.sup.1 M.sup.1) (s.sup.1 M.sup.1 M.sup.1) BM3- 100.7 24.1 5.2 3.5 1.4 0.5 321 1,111 2.1 10.sup.5 CIS.sub.heme BM3-CTS- 20.4 5.7 4.7 59.6 72.3 1.3 10.sup.4 C400S

[0372] BM3-CIS-C400S demonstrated consistent cis-selectivity for the substrates shown in Tables 30-34. In vitro cyclopropanation reactions catalyzed by BM3-CIS-C400S can be driven by sub-stoichiometric amounts of either NADH or NADPH.

[0373] To investigate whether the differences in stereoselectivity and catalytic rates caused by the C400S mutation were caused by changes in active site structure, the crystal structures of BM3-CIS and BM3-CIS-C400S were determined at 2.5 and 3.3 , respectively (FIG. 9 and Table 38).

TABLE-US-00039 TABLE 38 Data collection and refinement statistics for P450.sub.BM3 crystals. 9-10A-TS-F87V- T268A (BM3-CIS) BM3-CIS-C400S pdb accession # 4H23 4H24 Data collection* Space group I 1 2 1 P 2 21 21 wavelength 1.033 1.033 Cell dimensions a, b, c () 187.79, 62.74, 210.28 63.16, 124.46, 127.69 () 90.00, 115.75, 90.00 90.00, 90.00, 90.00 Resolution () 48.6-2.5 (2.5-2.6) ** 44.9-3.3 (3.3-3.5) ** R.sub.merge 5.3(39.5) 17.6(51.4) I/I 13.4(3.0) 11.8(5.7) Completeness 98.7(99.2) 99.9(99.9) (%) Redundancy 2.6(2.6) 5.3(5.4) Refinement Resolution () 48.6-2.5 44.9-3.3 No. reflections 72085 14884 R.sub.work/R.sub.free 0.19/0.25 0.18/0.26 No. atoms Protein 14401 6890 Ligand/ion 128 86 Water 196 24 B-factors Protein 33.9 25.4 Ligand/ion 25.4 19.9 Water 26.7 18.9 R.m.s. deviations Bond lengths () 0.017 0.016 Bond angles () 1.70 1.65 Ramachandran 0.3% 0.7% outliers*** *All data sets were collected from single crystals. **Highest-resolution shell is shown in parentheses. ***Ramachandran outliers lie in regions of protein that are known to be flexible and show similar disorder among P450.sub.BM3 structures in the literature.

[0374] The structures are superimposable (RMSD=0.52 ), with no significant changes in active site side chain or heme orientation. It is likely that changes in catalytic properties arise from electronic effects of altering the primary heme-ligand sphere. Both cis-selective BM3-CIS and BM3-CIS-C400S closely resemble the ligand-bound closed form of P450.sub.BM3 (FIG. 9), while trans-selective P450.sub.BM3-T268A resembles the open apo-form (J. P. Clark et al., Journal of Inorganic Biochemistry 100, 1075 (2006)). These large-scale conformational changes may contribute to the different diastereoselectivities observed among proteins that share nearly identical active site sequences.

[0375] Encouraged by the high turnovers achieved by BM3-CIS-C400S.sub.holo in vitro when using NADPH as a reductant (FIG. 7), the catalytic cyclopropanation reaction was investigated using whole cells expressing cytochrome P450 variants. The stability of EDA was first assessed in the presence of E. coli cells (OD.sub.600=30) lacking the P450.sub.BM3 gene and found no decomposition over the course of two hours. E. coli cells expressing BM3-CIS-C400S.sub.holo are hereafter referred to as the ABC catalyst. Initial experiments to identify optimal conditions revealed that whole-cell reactions were also significantly inhibited by dioxygen (FIG. 10). The C400S mutation improves in vivo activity by a factor of 3-4 as can be seen in FIG. 10 by comparing the ABC catalyst with whole cells expressing the thiolase-ligated BM3-CIS.sub.holo. The ABC catalyst also affords higher diastereo- and enantioselectivity compared to BM3-CIS.sub.holo (FIG. 10).

[0376] Addition of 2 mM glucose gave a consistent increase in cyclopropane yields (FIG. 11), presumably due to increased intracellular concentration of NADH, which is required to reduce the P450 catalyst to the active Fe(II) ferrous state. The ability of the whole cells to catalyze cyclopropanation to moderate yields even in the absence of exogenous glucose implies that some of the P450 is reduced with endogenous amounts of intracellular NAD(P)H. After normalizing for cell density, there are no significant differences in activity for cells grown in M9Y (M9, 1.5% yeast extract) or TB media. M9Y is the preferred growth medium due to its lower cost (FIG. 12). Expressing the holo enzyme gives a slightly higher yield of cyclopropanes compared to the heme domain alone (FIG. 12). Increasing ABC catalyst loading (cell density) increases cyclopropane yield up to approximately 80% at OD.sub.600=50 (FIG. 13). When EDA is used at 10 mM, a 2:1 excess of styrene affords optimal yields (FIG. 14). Controls for whole cells containing the P450 gene but with no P450 induction and for whole cells devoid of the P450 gene are shown in FIG. 15.

[0377] The cell seems to stabilize the P450 catalyst, extending its activity for hours, such that the reaction only finishes when EDA is depleted, as shown in FIG. 16. Remarkably, under the conditions in FIG. 16, the in vivo TTN is over 8,000. At high substrate loading (100 mM EDA, 200 mM styrene) the in vivo TTN reaches over 30,000. This is approximately two orders of magnitude higher than the in vitro TTN values reported above for purified enzyme catalyst.

[0378] This example also shows that the ABC catalyst can be lyophilized and supplied as a solid that can be resuspended in the desired reaction conditions. It has been observed that the lyophilization process does not compromise the catalyst activity. Thus, this whole cell catalyst can be lyophilized and conveniently stored for long periods of time. It can be packaged, weighed out or otherwise distributed in solid form when needed for a reaction. Because it is genetically encoded in a whole cell, it can also be stored or distributed as a plasmid (to be transformed into live cells) or as the live cells (e.g., in a bacterial stab culture) and then grown to the desired density and volume, using methods well known to those of skill in the art.

[0379] In vivo catalysis offers some key advantages over the use of purified enzymes in vitro, such as the lower costs associated with catalyst preparation, the prolonged activity and the ability to incorporate the P450 cyclopropanation reaction into metabolic pathways.

[0380] This concept has been demonstrated for a single P450 enzyme, from Bacillus megaterium, and for chimeras of the B. megaterium enzyme with other, related P450s from B. subtilis. Those of skill in the art, however, will recognize that other P450s from other organisms can be engineered to carry out cyclopropanation and ABC whole-cell catalysts can be made using those enzymes. In particular, the equivalent of the C400S mutation will improve the performance of other P450 enzymes for cyclopropanation and other carbene transfer reactions. One of skill in the art knows how to identify the equivalent residue to C400 in other P450s, based on sequence alignments, an example of which is given below. Methods known in the art, such as site-directed mutagenesis or gene synthesis, can be used to alter this residue to serine in any P450. If the resulting enzyme folds properly, it will serve as a catalyst for cyclopropanation. This mutation in a purified protein or whole cell catalyst will improve the activity over the parent enzyme that does not include this mutation.

[0381] For example, BLAST alignment (http://blast.ncbi.nlm.nih.gov/Blast.cgi) of the amino acid sequence of P450.sub.BM3 (CYP102A1) to other P450s, such as the one from Pseudomonas putida (CYP101A1, P450.sub.CAM) or the mammalian enzyme from Oryctolagus cuniculus (CYP2B4), enables identification of the proximal cysteine residue or of the equivalent T268 (marked in bold), as shown below (SEQ ID NOS:61-69):

TABLE-US-00040 CYP102A1 380 ENPSAIPQH--------AFKPFGNGQRACIGQQFALHEATLVL 414 E+APH+ FG+GC+GQAE+ L CYP101A1 329 ERENACPMHVDFSRQKVSHTTPGHGSHLCLGQHLARREIIVTL 371 CYP102A1 265 GHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRL 324 G+TLSF++ FLK+PA+ ER+P+ ELR CYP101A1 249 GLDTVVNFLSFSMEFLAKSPEHRQELIERPER-----IPA------------ACEELLR- 290 CYP102A1 374 FRPERF--ENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFD 422 FPFN+ FPFG+RC+G+ AEL+L++F CYP2B4 408 FNPGHFLDANGALKRNEGFMPFSLGKRVCLGEGIARTELFLFFTTILQNFS 458 CYP102A1 257 QIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVL-VDPVPSYKQVKQLKYVG 315 +++ AGETTSL+ ++KPHV++ +E+V+ P+ ++ Y CYP2B4 291 TVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTD 350

[0382] Therefore, the mutations C357S and T252A in CYP101A1 or C436S and T302A in CYP2B4 are expected to enhance the cyclopropanation activity in these enzymes. The mutation can be introduced into the target gene by using standard cloning techniques or by gene synthesis. The mutated gene can be expressed in the appropriate microbial host under the control of an inducible promoter or by means of chromosomal integration under the control of a constitutive promoter. Cyclopropanation activity can be screened in vivo or in vitro by following product formation by GC or HPLC (see, Materials and Methods).

[0383] Because the ABC catalyst is genetically encoded and functions very well in whole cells, this catalyst can be incorporated into multi-enzyme pathways for biological synthesis in vivo, where multiple transformations of a substrate are carried out inside the cell. The EDA or other diazo reagent can be provided exogenously to the medium or generated in situ.

[0384] The ability to extend the C400S mutation to other P450 scaffolds allows access to a variety of diazo compounds as carbenoid precursors. These include, but are not limited to, diazo esters (acceptor type), diazo -keto ester or -cyano esters (acceptor-aceptor type), and alkyl,aryl, or alkenyl substituted diazo esters (donor-acceptor) (FIG. 17a). These diazo compounds can be reacted inter- and intramolecularly with a variety of styrenes, aliphatic olefins, and allenes to provide biologically active compounds or organic building blocks for further reaction (FIG. 17b). For instance, P450 catalyzed reaction of a diazo ester with aryl or allylic silanes and boronic acids would form cyclopropanes that can then be used in Suzuki or Hiyama cross coupling reactions. Furthermore, cyclopropanation of geranylacetone at the C9 olefin by a trans-selective P450 catalyst and EDA will provide a key precursor to anthroplalone and noranthroplone, marine natural products that exhibit microgram cytotoxicity against B-16 melanoma cells (FIG. 17c) (W. A. Donaldson, Tetrahedron 57, 8589 (2001)). Lastly, treatment of 2,5-dimethylhexa-2,4-diene with a similar catalyst and EDA would provide the ethyl ester of chrysanthemic acid, an important intermediate in the production of pyrethroid insecticides (FIG. 17d).

Materials and Methods

[0385] Unless otherwise noted, all chemicals and reagents for chemical reactions were obtained from commercial suppliers (Sigma-Aldrich, Acros) and used without further purification. The following heme proteins were all purchased from Sigma-Aldrich: myoglobin (from equine heart), peroxidase II (from horseradish), cytochrome c (from bovine heart), catalase (from Corynebacterium glutamicum) and chloroperoxidase (from Caldariomyces fumago). Silica gel chromatography purifications were carried out using AMD Silica Gel 60, 230-400 mesh. .sup.1H and .sup.13C NMR spectra were recorded on either a Varian Mercury 300 spectrometer (300 MHz and 75 MHz, respectively), or a Varian Inova 500 MHz (500 MHz and 125 MHz, respectively), and are internally referenced to residual solvent peak. Data for .sup.1H NMR are reported in the conventional form: chemical shift ( ppm), multiplicity (s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet, br=broad), coupling constant (Hz), integration. Data for .sup.13C are reported in terms of chemical shift ( ppm) and multiplicity. High-resolution mass spectra were obtained with a JEOL JMS-600H High Resolution Mass Spectrometer at the California Institute of Technology Mass Spectral Facility. Reactions were monitored using thin layer chromatography (Merck 60 silica gel plates) using an UV-lamp for visualization. Optical rotation was measured using a JASCO P-2000 Polarimeter.

[0386] Gas chromatography (GC) analyses were carried out using a Shimadzu GC-17A gas chromatograph, a FID detector, and J&W scientific cyclosil-B columns (30 m0.32 mm, 0.25 m film and 30 m0.25 mm, 0.25 m film). High-performance liquid chromatography (HPLC) was carried out using an Agilent 1200 series, an UV detector, and an Agilent XDB-C18 column (4.6150 mm, 5 m). Cyclopropane product standards for the reaction of ethyl diazoacetate (EDA) with styrene (ethyl 2-phenyl cyclopropane-1-carboxylate) and -methyl styrene (ethyl 2-methyl-2-phenylcyclopropane-1-carboxylate) were prepared as reported (A. Penoni et al., European Journal of Inorganic Chemistry, 1452 (2003)). These standards and enzyme-prepared cyclopropanes demonstrated identical retention times in gas chromatograms when co-injected, confirming product identity. Absolute stereoconfiguration of cyclopropane enantiomers was determined by measuring optical rotation of purified cyclopropane products from preparative bioconversion reactions using enantioselective P450-BM3 variants and referenced to values taken from reference (N. Watanabe et al., Heterocycles 42, 537 (1996)). Authentic P450-catalyzed cyclopropane samples were also prepared as described herein and were characterized by NMR and (.sup.1H and .sup.13C) and mass spectrometry.

[0387] Plasmids pCWori[BM3] and pET22 were used as cloning vectors. Site-directed mutagenesis was accomplished by standard overlap mutagenesis using primers bearing desired mutations (IDT, San Diego, Calif.). Electrocompetent Escherichia coli cells were prepared following the protocol of Sambrook et al., Molecular cloning: a laboratory manual. (Cold Spring Harbor Laboratory Press, New York, 1989), vol. 2. Restriction enzymes BamHI, EcoRI, XhoI, Phusion polymerase, and T4 ligase were purchased from New England Biolabs (NEB, Ipswich, Mass.). Alkaline phosphatase was obtained from Roche (Nutley, N.J.). The 1,000 trace metal mix used in expression cultures contained: 50 mM FeCl.sub.3, 20 mM CaCl.sub.2, 10 mM MnSO.sub.4, 10 mM ZnSO.sub.4, 2 mM CoSO.sub.4, 2 mM CuCl.sub.2, 2 mM NiCl.sub.2, 2 mM Na.sub.2MoO.sub.4, and 2 mM H.sub.3BO.sub.3.

[0388] Enzyme library screening. Libraries are stored at 78 C. as glycerol stocks (Luria-Bertani medium (LB.sub.amp), 150 L, 25% v/v glycerol with 0.1 mg mL.sup.1 ampicillin) in 96-well plates. These stocks were used to inoculate 96-shallow-well plates containing 300 L LB.sub.amp medium using a 96-pin stamp. Single colonies from site-saturation libraries were picked with toothpicks and used to inoculate 300 L of LB.sub.amp. The cells were incubated at 37 C., 250 rpm shaking, and 80% relative humidity overnight. After 16 h, 50 L aliquots of these overnight cultures were transferred into 2 mL, deep-well plates containing terrific broth (TB.sub.amp) (800 L containing 0.1 mg mL.sup.1 ampicillin, 1 L mL.sup.1 trace metal mix and 20 mg L.sup.1 aminolevulinic acid) using a Multimek 96-channel pipetting robot (Beckman Coulter, Fullerton, Calif.). The cultures were incubated at 37 C. for 3 h and 30 min, and 30 min after reducing the incubation temperature to 25 C. (250 rpm, 80% relative humidity), 50 L isopropyl -D-1-thiogalactopyranoside (IPTG, 4.5 mM in TB.sub.amp) was added, and the cultures were allowed to continue for another 24 h at 25 C. (250 rpm, 80% relative humidity). Cells were then pelleted (3,000g, 15 min, 4 C.) and stored at 20 C. until further use, but at least for 2 h. For cell lysis, plates were allowed to thaw for 30 min at room temperature and then cell pellets were resuspended in 275 L phosphate buffer (0.1 M, pH=8.0, 0.65 mg mL.sup.1 lysozyme, 10 mM magnesium chloride and 40 U mL.sup.1 DNAse I). The lysing cells were incubated at 37 C. for 1 h. Cell debris was separated by centrifugation at 5,000g and 4 C. for 15 min. The resulting crude lysates were then transferred to 96-well microtiter plates for CO assays and to 2 mL deep-well plates for bioconversions.

[0389] CO binding assay. Na.sub.2S.sub.2O.sub.4 (160 L, 0.1 M in phosphate buffer, 0.1 M, pH=8.0) was added to P450.sub.BM3 variants in cell lysate (40 L). The absorbance at 450 and 490 nm was recorded using a Tecan M1000 UV/Vis plate reader, and the microtiter plates were placed in a vacuum chamber. The chamber was sealed, evacuated to approximately 15 in Hg, purged with CO gas, and incubated for 30 min. The plates were then removed and the absorbance at 450 and 490 nm was again recorded using a plate reader. The difference spectra could then be used to determine the P450 concentration in each well as previously described (C. R. Otey, in Methods in Molecular Biology: Directed Enzyme Evolution, F. H. Arnold, Georgiou, Eds. (Humana Press, Totowa, N.J., 2003), vol. 230).

[0390] P450 expression and purification. For the enzymatic transformations, P450.sub.BM3 variants were used in purified form. Enzyme batches were prepared as follows. One liter TB.sub.amp was inoculated with an overnight culture (100 mL, LB.sub.amp) of recombinant E. coli DH5 cells harboring a pCWori plasmid encoding the P450 variant under the control of the tac promoter. After 3.5 h of incubation at 37 C. and 250 rpm shaking (OD.sub.600 ca. 1.8), the incubation temperature was reduced to 25 C. (30 min), and the cultures were induced by adding IPTG to a final concentration of 0.5 mM. The cultures were allowed to continue for another 24 hours at this temperature. After harvesting the cells by centrifugation (4 C., 15 min, 3,000g), the cell pellet was stored at 20 C. until further use but at least for 2 h. The cell pellet was resuspended in 25 mM Tris.Math.HCl buffer (pH 7.5 at 25 C.) and cells were lysed by sonication (21 min, output control 5, 50% duty cycle; Sonicator, Heat SystemsUltrasonic, Inc.). Cell debris was removed by centrifugation for 20 min at 4 C. and 27,000g and the supernatant was subjected to anion exchange chromatography on a Q Sepharose column (HiTrap Q HP, GE Healthcare, Piscataway, N.J.) using an AKTAxpress purifier FPLC system (GE healthcare). The P450 was eluted from the Q column by running a gradient from 0 to 0.5 M NaCl over 10 column volumes (P450 elutes at 0.35 M NaCl). The P450 fractions were collected and concentrated using a 30 kDa molecular weight cut-off centrifugal filter and buffer-exchanged with 0.1 M phosphate buffer (pH=8.0). The purified protein was flash-frozen on dry ice and stored at 20 C. P450 concentration was determined in triplicate using the CO binding assay described above (10 L P450 and 190 L 0.1 M phosphate buffer, pH 8.0, per well).

[0391] Thermostability measurements. Duplicate measurements were taken for all values reported on Tables 17 and 18. Purified P450 solutions (4 M, 200 L) were heated in a thermocycler (Eppendorf) over a range of temperatures (38 C.-65 C.) for 10 min followed by rapid cooling to 4 C. for 1 min. The precipitate was removed by centrifugation. The concentration of folded P450 remaining in the supernatant was measured by CO-difference spectroscopy (as described above). The temperature at which half of the protein was denatured (T.sub.50) was determined by fitting the data to the equation: f(T)=100/(1+exp(a*(TT.sub.50))).

[0392] Typical procedure for small-scale cyclopropanation and carbene insertion bioconversions under anaerobic conditions. Small-scale reactions (400 L) were conducted in 2 mL crimp vials (Agilent Technologies, San Diego, Calif.). P450 solution (80 L, 100 M) was added to the vial with a small stir bar before crimp sealing with a silicone septum. Phosphate buffer (260 L, 0.1 M, pH=8.0) and 40 L of a solution of the reductant (100 mM Na.sub.2S.sub.2O.sub.4, or 20 mM NADPH) were combined in a larger crimp-sealed vial and degassed by bubbling argon through the solution for at least 5 min (FIG. 3). In the meantime, the headspace of the 2 mL reaction vial with the P450 solution was made anaerobic by flushing argon over the protein solution (with no bubbling). When multiple reactions were conducted in parallel, up to 8 reaction vials were degassed in series via cannulae. The buffer/reductant solution (300 L) was syringed into the reaction vial, while under argon. The gas lines were disconnected from the reaction vial before placing the vials on a plate stirrer. A 40 styrene solution in MeOH (10 L, typically 1.2 M) was added to the reaction vial via a glass syringe, and left to stir for about 30 s. A 40EDA solution in MeOH was then added (10 L, typically 400 mM) and the reaction was left stirring for the appropriate time. The final concentrations of the reagents were typically: 30 mM styrene, 10 mM EDA, 10 mM Na.sub.2S.sub.2O.sub.4, 20 M P450.

[0393] The reaction was quenched by adding 30 L HCl (3M) via syringe to the sealed reaction vial. The vials were opened and 20 internal standard (20 mM 2-phenylethanol in MeOH) was added followed by 1 mL ethyl acetate. This mixture was transferred to a 1.8 mL eppendorf tube which was vortexed and centrifuged (16,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by chiral phase GC.

[0394] A slightly modified work-up was implemented for kinetic experiments. The reactions were quenched after the set time by syringing 1 mL EtOAc to the closed vials and immediately vortexing the mixture. The vials were then opened and 20 L internal standard was added. The mixture was transferred to a 1.8 mL eppendorf tube, vortexed and centrifuged (16,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by GC.

[0395] Typical procedure for preparative-scale cyclopropanation bioconversions under anaerobic conditions. The P450 solution was added to a Schlenk flask with a stir bar. With the flask kept on ice, the head-space was evacuated and back-filled with argon (4) with care not to foam the protein solution. Phosphate buffer and reductant were pre-mixed and degassed together in a separate round-bottom-flask by bubbling argon through the solution for 20 min. The buffer/reductant solution was transferred to the Schlenk flask via syringe. Styrene was added under argon and left to mix for 1 min. EDA was added dropwise under argon. The solution was left to stir under argon until reaction completion. The reaction was quenched under argon by adding hydrochloric acid (3 M) to adjust the pH to 4, before opening the Schlenk flask. The reaction mixture was stirred with sodium chloride and dichloromethane (CH.sub.2Cl.sub.2). The combined emulsion layers were then filtered through Celite to break the emulsion and the Celite pad was rinsed with 320 mL CH.sub.2Cl.sub.2. The resulting biphasic mixture was transferred to a separating funnel and the organic phase was removed. The remaining aqueous phase was re-extracted with 340 mL CH.sub.2Cl.sub.2. The combined organic extracts were dried with sodium sulfate, filtered, and concentrated. The resulting residue was purified by SiO.sub.2 chromatography.

Supplementary Data

[0396] Preliminary Experiments with Heme Proteins

[0397] The following six heme proteins were initially screened for cyclopropanation activity: catalase, chloroperoxidase (CPO), horseradish peroxidase (HRP), cytochrome C (cyt c), myoglobin (Mb) and P450.sub.BM3. Small-scale (400 L) reactions were conducted as described above and were analyzed by CBC (cyclosil-B 30 m0.25 mm0.25 m): oven temperature=130 C. Table 7 shows heme catalysts under anaerobic conditions with sodium dithionite (Na.sub.2S.sub.2O.sub.4). Table 8 shows heme catalysts under anaerobic conditions without Na.sub.2S.sub.2O.sub.4. Table 9 shows heme catalysts under aerobic conditions with Na.sub.2S.sub.2O.sub.4, Table 10 shows heme catalysts under aerobic conditions without Na.sub.2S.sub.2O.sub.4.

Screening P450.SUB.BM3 .Variants for Cyclopropanation Activity

[0398] Lysate screening under aerobic conditions. The 92 variants in the compilation plate (Table 12) represent a diverse selection of P450.sub.BM3 variants that have previously been engineered for monooxygenase activity on a variety of substrates, including but not limited to short alkane hydroxylation, demethylation of protected monosaccharides, and oxidation of lead drug compounds. These P450.sub.BM3 variants carry various mutations accumulated along sequential rounds of engineering efforts for activity towards the target substrates (Table 12) or were generated by recombination with homologous enzymes (Table 13). The compilation plate was expressed and lysed as described above. 150 L lysate was transferred (Multimek 96-channel pipetting robot, Beckman Coulter, Fullerton, Calif.) to a 2 mL deep-well plate, with 50 L of 120 mM Na.sub.2S.sub.2O.sub.4 in 0.1 M KPi (pH=8.0). 100 L of a 30 mM styrene, 60 mM EDA mixed solution in 15% MeOH in 0.1 M KPi (pH=8.0) was added to the plate to initiate the reaction. The plate was sealed and was left shaking (300 rpm) for four hours. The plastic seal was removed and 30 L HCl (3 M) was added to quench the reaction followed by 20 L of an internal standard solution (20 mM -methylstyrene in methanol). The reactions were extracted by adding 500 L EtOAc and carefully vortexing the plate. The plate was centrifuged (1,700g) to separate the biphasic mixture. The top organic layer was transferred (2150 L) to a separate deep-well plate. The extracts for each of the 92 reactions were dried through 92 separate anhydrous sodium sulfate plugs. The dried extracts were analyzed by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=60 C. 3 min, 7.5 C./min to 160 C., 20 C./min to 250 C., 250 C. 2 min, cis-cyclopropanes (20.3 min and 20.45 min), trans-cyclopropanes (21.8 min). The top 10 protein variants of importance with respect to this report are highlighted in Tables 12 and 13.

[0399] Determining the cyclopropanation activity of the top 10 hits (highlighted on Tables 12 and 13) under anaerobic conditions. Small-scale reactions (400 L total volume) were conducted as described above and were analyzed by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 1 C./min to 135 C., 135 C. 10 min, 10 C./min to 200 C., 200 C. 5 min, cis-cyclopropanes (39.40 min and 40.20 min), trans-cyclopropanes (44.69 min and 45.00 min). Table 14 shows stereoselective P450.sub.BM3-based cyclopropanation catalysts.

Experimental Characterization of P450.SUB.BM3 .Cyclopropanation Catalysts

[0400] Controls to confirm the enzymatic cyclopropanation activity of variant H2A10. Small-scale reactions (400 L total volume) were set up and worked up as described above. For the carbon monoxide (CO) inhibition experiment, the reaction vial and the buffer/reductant vial were purged with CO after having been purged with argon. For the boiled P450 experiment, a 100 M solution of variant H2A10 was heated at 60 C. for 10 min. For the hemin experiment, hemin (80 L) was added from a 1 mM solution in 50% DMSO-H2O, such that its final concentration in the reaction was 200 M. Complete System=10 mM styrene, 20 mM EDA, 20 mM Na.sub.2S.sub.2O.sub.4, 20 M P450 (H2A10) under anaerobic conditions. The dried ethyl acetate extracts were analyzed by chiral phase GC, using 2-phenylethanol as an internal standard (injector temperature=300 C., oven temperature=100 C. for 5 min, 1 C./min ramp up to 135 C., 135 C. for 10 min, 10 C./min ramp up to 200 C., 200 C. for 5 min). Elution time: cis-cyclopropanes (39.40 min and 40.20 min), trans-cyclopropanes (44.69 min and 45.00 min). Table 15 shows controls for P450 based cyclopropanation using variant H2A1.

[0401] Optimizing cyclopropanation reaction conditions for variant H2A10. Small-scale reactions (400 L final volume) were set up and worked up as described above. The dried ethyl acetate extracts were analyzed by chiral phase GC, using 2-phenylethanol as an internal standard (injector temperature=300 C., oven temperature=100 C. for 5 min, 5 C./min ramp up to 200 C., 20 C./min ramp up to 250 C., 250 C. for 5 min). Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min). The reaction conditions that gave optimal yields of cyclopropanes (with respect to EDA) were: 30 mM styrene, 10 mM EDA and 20 M P450 and were used in subsequent experiments.

[0402] Styrene concentration. FIG. 3 illustrates the effect of styrene concentration on cyclopropane yield.

[0403] P450 concentration. FIG. 4 illustrates the effect of P450 (H2A10) concentration on cyclopropane yield.

[0404] Dithionite concentration. Table 16 shows the effect of the concentration of Na.sub.2S.sub.2O.sub.4 on cyclopropane yield.

[0405] Mutational analysis of active site alanine substitutions in 9-10A TS F87V, Table 17 shows a mutational analysis of alanine substitutions on 9-10A TS F87V.

[0406] Sequential introduction of BM3-CIS active site mutations in wild-type P450.sub.BM3. Table 18 shows introducing BM3-CIS related active site mutations in wild-type P450.sub.BM3.

Active Site Saturation Mutagenesis of BM3-CIS.SUB.heme

[0407] Library construction. To simplify library construction and screening, only the BM3-CIS heme domain, which comprises residues 1-462 was used. This truncated enzymes lacks the P450 native reductase and exhibits similar activity and stereochemical control to the full length enzyme using Na.sub.2S.sub.2O.sub.4 as a reductant, but not NADPH. P450 site-directed mutagenesis and site-saturation libraries were assembled from PCR fragments generated from oligonucleotides containing the desired codon mutation or a degenerate NNK (or for reverse primers, the reverse complement MNN; where N=A,T,G,C, K=G,T and M=A,C) codon, which codes for all 20 amino acids and the TAG stop codon. PCR fragments were assembled using either standard overlap extension PCR or through restriction cloning using the Type IIS restriction enzyme, BsaI, depending on convenience.

[0408] Lysate screening under aerobic conditions. The compilation plate was expressed and lysed as described above. 150 L lysate was transferred (Multimek 96-channel pipetting robot, Beckman Coulter, Fullerton, Calif.) to a 2 mL deep-well plate, with 50 L of 120 mM Na.sub.2S.sub.2O.sub.4 in 0.1 M KPi (pH=8.0). 100 L of a 90 mM styrene, 30 mM EDA mixed solution in 15% MeOH in 0.1 M KPi (pH=8.0) was added to the plate to initiate the reaction. The plate was sealed and was left shaking (300 rpm) for four hours. The plastic seal was removed and 30 L HCl (3 M) was added to quench the reaction followed by 20 L of an internal standard solution (20 mM 2-phenylethanol in methanol). Acetonitrile (400 L) was added before carefully vortexing the plate. The plate was centrifuged (1,700g), the supernatant was filtered (1 m glass, 96 well filter plate, Pall) and transferred (150 L) to a 96-well microtiter plate (Agilent). Reactions were analyzed by reverse-phase HPLC (210 nm): 50% acetonitrile-water, 1.0 mL, min.sup.1, cis-cyclopropanes (7.6 min), trans-cyclopropanes (9.7 min). Hits were selected based on enhancement of cis-selectivity over parent BM3-CIS.

[0409] Determining the cyclopropanation activity of hits from the site-saturation libraries under anaerobic conditions. Small-scale reactions (400 L total volume) were conducted as described above and were analyzed by GC (cyclosil-B 30 m0.25 mm0.25 m): oven temperature=130 C., 175 kPa, cis-cyclopropanes (39.40 min and 40.20 min), trans-cyclopropanes (44.69 min and 45.00 min). Table 19 shows the cyclopropanation activity of selected BM3-CIS.sub.heme active site variants.

Kinetic Characterization of BM3-CIS

[0410] Determination of initial rates. Both styrene and EDA concentrations were varied in the presence of the P450s expressed as the heme-domain (0.5 or 1.0 M BM3-CIS.sub.heme). Reactions were set up in phosphate buffer (pH=8.0) with Na.sub.2S.sub.2O.sub.4 as the reductant at 298 K, and were worked-up as described above. Three time points were taken and used to determine the rate of product formation by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min). Kinetic parameters were determined by fitting the data to the standard Michaelis-Menten model.

[0411] FIG. 5 illustrates the initial velocities plot for BM3-CIS.sub.heme. (A) EDA concentration was varied at a saturating concentration of styrene (30 mM). (B) Styrene concentration was varied at a fixed concentration of EDA (20 mM). Initial rates were computed as the slope of a zero-intercept linear fit of three different time points from independent reactions. Error bars correspond to 1- (68.3%) confidence intervals for the slope. Table 20 shows the Michaelis-Menten parameters for P450 cyclopropanation catalysts. Table 21 shows kinetic parameters for wild-type cytochrome P450s acting on their native substrates and for an engineered variant of P450.sub.BM3 (propane monooxygenase, PMO) acting on the non-native substrate propane. Table shows the effect of EDA addition at t=30 min on BM3-CIS-catalyzed cyclopropanations.

Substrate Scope of P450 Cyclopropanation Catalysts

[0412] Small-scale reactions. Selected P450 catalysts were surveyed at a small-scale (400 L total volume) for each combination of reagents (olefins and diazo esters). The small-scale anaerobic bioconversions were conducted as described above and were analyzed by GC. Table 30 shows the substrate scope of P450 cyclopropanation catalysts: p-methylstyrene+EDA. Table 31 shows the substrate scope of P450 cyclopropanation catalysts: p-vinylanisole+EDA. Table 32 shows the substrate scope of P450 cyclopropanation catalysts: p-(trifluoromethyl)styrene. Table 33 shows the substrate scope of P450 cyclopropanation catalysts: -methyl styrene. Table 34 shows the substrate scope of P450 cyclopropanation catalysts: t-butyl diazoacetate.

[0413] Preparative-scale bioconversions. These reactions were conducted anaerobically as described above.

[0414] Cyclopropanation of Styrene with EDA.

##STR00161##

[0415] Prepared using 1.5 mmol styrene (3 equiv), 0.5 mmol EDA (1 equiv) and 1 mol BM3-CIS.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 25 mg of the cis-cyclopropane (1) and 8 mg of a mixture of cyclopropanes with trans (2) in 5:1 excess over cis (Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007); C. J. Sanders et al., Tetrahedron: Asymmetry 12, 1055 (2001); M. Lenes Rosenberg et al., Organic Letters 11, 547 (2009)). Diagnostic data for the cis-cyclopropane 1: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.28 (m, 4H), 7.21 (m, 1H), 3.89 (q, J=7.1 Hz, 2H), 2.60 (m, 1H), 2.10 (m, 1H), 1.73 (m, 1H), 1.35 (m, 1H), 0.99 (t, J=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 170.99, 136.56, 129.31, 127.88, 126.63, 60.18, 25.47, 21.80, 14.02, 11.12; [].sup.25.sub.D=7.056 (c 0.83, CHCl.sub.3). Diagnostic data for the trans-cyclopropane 2: .sup.1HNMR (CDCl.sub.3, 500 MHz): 7.20 (m, 3H), 7.03 (m, 2H), 4.10 (q, J=7.1 Hz, 2H), 2.45 (m, 1H), 1.83 (m, 1H), 1.53 (m, 1H), 1.23 (m, 1H), 1.21 (t, J=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 173.43, 140.13, 128.46,126.55, 126.16, 60.72, 26.18, 24.20, 17.09, 14.27; [].sup.25.sub.D=+199.2 (c 0.50, CHCl.sub.3). MS (EI.sup.+) m/z: 190 (M.sup.+), 162 (PhCH(CH.sub.2)CHCO2.sup.+), 145 (PhCH(CH.sub.2)CHCO.sup.+). The absolute configuration of compounds 1 and 2 was determined by comparison of the sign of their optical rotations with that reported (N. Watanabe et al., Heterocycles 42, 537 (1996)). The enantiomeric excess was determined to be 92% for the cis-cyclopropane and 88% for the trans-cyclopropane by GC.

[0416] Cyclopropanation of p-methylstyrene with EDA.

##STR00162##

[0417] Prepared using 1.5 mmol styrene (3 equiv), 0.5 mmol EDA (1 equiv) and 1 mol BM3-CIS.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 10 mg of the cis-cyclopropane (3) and 16 mg of a mixture of cyclopropanes with trans(4):cis/2:1 (Y. Chen et al. Journal of Organic Chemistry 72, 5931 (2007)). Diagnostic data for the cis-cyclopropane 3: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.17 (d, J=8.0 Hz, 2H), 7.08 (d, J=8.0 Hz, 2H), 3.91 (q, J=7.1 Hz, 2H), 2.56 (m, 1H), 2.32 (s, 3H) 2.06 (m, 1H), 1.69 (m, 1H), 1.32 (m, 1H), 1.02 (t, J=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 171.12, 136.12, 133.42, 129.14, 128.60, 60.17, 25.23, 21.68, 21.10, 14.08, 11.21. Diagnostic data for the trans-cyclopropane 4: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.09 (d, J=8.0 Hz, 2H), 7.01 (d, J=8.0 Hz, 2H), 4.19 (q, J=7.1 Hz, 2H), 2.50 (m, 1H), 2.33 (s, 3H), 1.88 (m, 1H), 1.59 (m, 1H), 1.33 (m, 1H), 1.29 (t, J=7.1 Hz, 3H); .sup.13C NMR (CDCl.sub.3, 125 MHz): 173.58, 137.04, 136.08, 129.12, 126.10, 60.66, 25.94, 24.06, 21.11, 16.96, 14.28. MS (EI.sup.+) m/z: 204 (M.sup.+), 175 ([M-Et].sup.+) 131 ([M-COOEt].sup.+). The enantiomeric excess was determined to be 82% for the cis-cyclopropane by GC. Baseline resolution of the trans-enantiomers could not be achieved.

[0418] Cyclopropanation of p-methoxystyrene with EDA.

##STR00163##

[0419] Prepared using 1.5 mmol styrene (3 equiv), 0.5 mmol EDA (1 equiv) and 1 mol BM3-CIS.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 16 mg of the trans-cyclopropane (6) and 3 mg of a mixture of cyclopropanes with cis:trans/5:1 (Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007)). Diagnostic data for the trans-cyclopropane 6: 6.96 (m, 3H), 6.75 (m, 2H), 4.09 (q, J=7.1 Hz, 2H), 3.72 (s, 3H), 2.41 (m, 1H), 1.75 (m, 1H), 1.48 (m, 1H), 1.21 (t, J=7.1 Hz, 3H), 1.18 (m, 1H). MS (ET.sup.+) m/z: 220 (M.sup.+), 191 ([M-Et].sup.+), 175 ([M-EtO].sup.+), 147 ([M-COOEt].sup.+). The enantiomeric excess was determined to be 38% for the cis-cyclopropane by GC. The trans-enantiomers did not resolve to baseline resolution.

[0420] Cyclopropanation of styrene with t-butyl diazo acetate.

##STR00164##

[0421] Prepared using 0.75 mmol styrene (3 equiv), 0.24 mmol t-BuDA (1 equiv) and 0.5 mol BM3-CIS.sub.heme (0.002 equiv). The product was purified by SiO.sub.2 chromatography (9:1 hexanes-diethyl ether) to give 9 mg of the trans-cyclopropane (8) (Y. Chen et al., Journal of Organic Chemistry 72, 5931 (2007); C. J. Sanders et al., Tetrahedron: Asymmetry 12, 1055 (2001)). Diagnostic data for the trans-cyclopropane 4: .sup.1H NMR (CDCl.sub.3, 500 MHz): 7.20 (m, 2H), 7.12 (m, 1H), 7.02 (m, 2H), 2.36 (m, 1H), 1.76 (m, 1H), 1.45 (m, 1H), 1.40 (s, 9H), 1.16 (m, 1H); .sup.13C NMR (CDCl.sub.3, 125 MHz): b 172.58, 140.52, 128.42, 126.32, 126.07, 80.57, 28.17, 25.75, 25.31, 17.08. MS (EI.sup.+) m/z: 218 (M.sup.+), 145 ([M-OtBu].sup.+).

Orthogonalization of Cyclopropanation and Monooxygenation Activities

[0422] FIG. 18 illustrates the UV-Vis absorption spectra of purified BM3-CIS.sub.heme (3 M, upper line) and BM3-CIS-C400S.sub.heme (2 M, lower line). Insert shows solutions of both proteins at approximately 1 mM.

[0423] Concentration of BM3-CIS-C400S was determined by the micro BCA assay (Thermo Scientific) using BM3-CIS as a standard. The serine-ligated cytochrome P450 displays a lower extinction coefficient (5 lower) and a Soret band that is blue-shifted by 14 nm. Magnetic circular dichroism and electronic absorption spectra of the substrate-free ferric, ferrous and CO-bound ferrous serine-ligated P450 has been reported elsewhere (R. Perera et al., Archives of Biochemistry and Biophysics 507, 119 (2011)).

[0424] Activity under anaerobic vs aerobic conditions with sodium dithionite as the reductant. Table 35 shows the effect of C400S mutation on BM3-CIS-mediated cyclopropanation driven by Na.sub.2S.sub.2O.sub.4. FIG. 6 shows the cyclopropanation activities of BM3-CIS and BM3-CIS-C400S driven by sodium dithionite under anaerobic and aerobic conditions. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value.

[0425] Activity under anaerobic vs aerobic conditions with NADPH as the reductant. Small-scale reactions (400 L total volume) were conducted as described above with the following modifications: glucose dehydrogenase (GDH, 4 L, 225 U mL.sup.1) was added to the reaction vial together with the P450 solution. Glucose (40 L, 250 mM) and NADPH (40 L, 5 mM) were degassed together with the buffer solution. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Table 36 shows the effect of C400S mutation on BM3-CIS-mediated cyclopropanation driven by NADPH.

[0426] Determination of initial rates. Both styrene and EDA concentrations were varied in the presence of the P450s expressed as the heme-domain (3.5 M BM3-CIS-C400S.sub.heme). Reactions were set-up in phosphate buffer (pH=8.0) with sodium dithionite as the reductant at 298 K, and were worked-up as described above. Three time points were taken and used to determine the rate of product formation by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min). Kinetic parameters were determined by fitting the data to the standard Michaelis-Menten model. FIG. 8 shows the initial velocities plot for BM3-CIS-C400S.sub.heme. (A) EDA concentration was varied at a saturating concentration of styrene (30 mM). (B) Styrene concentration was varied at a fixed concentration of EDA (20 mM). Table 37 shows the Michaelis-Menten parameters for P450 cyclopropanases.

X-ray Crystallography Statistics

[0427] FIG. 9 shows active site and protein alignments of BM3-CIS with BM3-CIS-C400S and wild type P450.sub.BM3.

[0428] To investigate the nature of enhanced stereoselectivity in BM3-CIS-C400S, crystal structures of both proteins were determined to assess any structural changes that may have occurred due to the axial Cys.fwdarw.Ser mutation. The top panels shows alignments of BM3-CIS (green) and BM3-CIS-C400S (peach) with left, middle and right panels showing active site residues, the active site I-helix, and global protein fold, respectively. No significant structural changes were observed (RMSD 0.52 ). Middle panels: Large variations are observed upon comparing BM3-CIS with the open (ligand-free) form of wild type BM3 (purple, taken from PDB #2IJ2, RMSD 1.2 ). Pronounced rearrangements are observed in active site side chain residues (left) as well as rotations within the I-helix. Global movements are also observed in the N-terminal rich beta domain as well as F- and G-helices (right, marked by double headed arrows). These movements are consistent with well-known transitions that occur upon substrate binding and are important for native monooxygenation catalysis. Bottom panels: Alignment of BM3-CIS with a ligand-bound BM3 structure (cyan, taken from PDB #1JPZ, RMSD 0.52 ) demonstrates that BM3-CIS and BM3-CIS-C400S mimic the closed protein conformation even in the absence of substrate.

[0429] Table 38 shows data collection and refinement statistics for P450.sub.BM3 crystals.

Summary of Mutations in P450.SUB.BM3 .Variants

[0430] Mutations in variant P450 cyclopropanation catalysts are reported with respect to wild-type P450.sub.BM3. [0431] 7-11D (P. Meinhold et al., Adv. Synth. Catal. 348, 763 (2006)): R47C, V78A, K94I, P142S, T175I, A184V, F205C, S226R, H236Q, E252G, R255S, A290V, L353V, A82F, A328V [0432] 9-10A TS (J. C. Lewis et al., Chembiochem: A European Journal of Chemical Biology 11, 2502 (2010)): V78A, P142S, T175I, A184V, S226R, H236Q, E252G, A290V, L353V, I366V, E442K [0433] H2A10: 9-10A TS+F87V, L75A, L181A, T268A [0434] H2-5-F10: 9-10A TS+F87V, L75A, I263A, T268A, L437A [0435] H2-4-D4: 9-10A TS+F87V, L75A, M177A, L181A, T268A, L437A [0436] BM3-CIS: 9-10A TS+F87V, T268A

Whole Cell Catalysts for In Vivo Cyclopropanation

[0437] Media and cell cultures. E. coli cells were grown from glycerol stock overnight (37 C., 250 rpm) in 5 ml M9Y medium (1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 5.0 g NH.sub.4Cl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, 1.5% yeast extract, 1 mL micronutrients, 0.1 mg mL.sup.1 ampicillin). The pre-culture was used to inoculate 45 mL of M9Y medium and this culture was incubated at 37 C. 250 rpm for 2 h and 30 min. At OD.sub.600=1.2, the cultures were cooled to 25 C. and induced with IPTG (0.2.5 mM) and 6-aminolevulinic acid (0.25 mM). Cultures were harvested after 20 h and resuspended (OD.sub.600=30) in nitrogen-free M9 medium (1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, 1 mL micronutrients). The micronutrient solution contains 0.15 mM (NH.sub.4).sub.6Mo.sub.7O.sub.24, 20.0 mM H.sub.3BO.sub.3, 1.5 mM CoCl.sub.2, 0.5 mM CuSO.sub.4, 4.0 mM MnCl.sub.2, and 0.5 mM ZnSO.sub.4. Aliquots of the cell suspension were used for determination of the cell dry weight (cdw, 2 mL) and P450 expression level (4 mL).

[0438] Small-scale whole cell bioconversions. E. coli cells (OD.sub.600=30, 425 L) were made anaerobic by bubbling argon through the cell suspension in a crimped 2 mL vial. A degassed solution of glucose (50 L, 20 mM) was added to the cells before adding EDA (12.5 L of a 400 mM solution in MeOH) and olefin (12.5 L of a 1.2 M solution in MeOH). The reactions were stirred at room temperature for the appropriate and were worked up by adding 20 L of the internal standard (20 mM 2-phenylethanol) and extracting with 1 mL ethyl acetate. The organic layer was dried over Na.sub.2SO.sub.4 before analyzing the product mixture by chiral phase gas chromatography.

[0439] FIG. 11 illustrates the effect of glucose addition on in vivo cyclopropanation of styrene. Reaction conditions: 20 mM styrene, 10 mM EDA, under argon in nitrogen-free medium and 5% MeOH cosolvent for 2 hours at 298 K (OD.sub.60024). Total turnover=concentration of cyclopropanes (mM)/cell density (g cdw/L) in units of mmol/g cdw.

[0440] FIG. 12 illustrates the effect of media and comparison of holo vs heme forms of BM3-CIS-C400S on in vivo cyclopropanation of styrene. Reaction conditions: 20 mM styrene, 10 mM EDA, 2 mM glucose under argon in nitrogen-free medium and 5% MeOH cosolvent for 2 hours at 298 K (OD.sub.60024).

[0441] FIG. 13 illustrates that increasing ABC catalyst loading (cell density) increases cyclopropanes yield up to approximately 80% at OD.sub.600=50.

[0442] FIG. 14 illustrates the effect of styrene concentration on cyclopropane yield.

[0443] FIG. 15 illustrates controls for ABC catalyzed cyclopropanation.

[0444] FIG. 16 illustrates that ABC catalyst is active for 3 hours. At OD.sub.600=25, the P450 concentration in 0.85 M, such that TTN>8,000.

Example 3

In Vivo and In Vitro Olefin Cyclopropanation Catalyzed by Heme Enzymes

[0445] This example illustrates the use of heme containing enzymes to catalyze the conversion of olefins to various products containing one or more cyclopropane functional groups. In certain aspects, this example demonstrates novel variants of cytochrome P450.sub.BM3 (CYP102A1 or BM3) having an improved ability to catalyze the formal transfer of carbene equivalents from diazo esters to various olefins, making cyclopropane products with high stereoselectivity. Preferred variants include, but are not limited to, cytochrome P450.sub.BM3 mutants having C400S and T268A amino acid substitutions and engineered variants of other P450s having the equivalent substitutions. Axial serine heme ligation (C400S in BM3) in cytochrome P450s creates the homologous cytochrome P411 family. Cytochrome P411s catalyze the cyclopropanation reaction in whole cells, sustaining over 10,000 total turnovers with high stereoselectivity, making the cyclopropane product with titers of over 20 g L.sup.1.

Introduction

[0446] Genetically programmed whole-cell biocatalysts are readily produced in simple growth media, do not require further purification or isolation and can be engineered with metabolic pathways for the elaboration of complex molecules (P. K. Ajikumar et al., Science 330, 70 (2010); P. J. Westfall et al., Proc. Natl. Acad. Sci. U.S.A. 109, E111 (2012); M. Kataoka et al., Appl Microbiol. Biotechnol. 62, 437 (2003)). The range of accessible transformations, however, is currently limited to the chemical repertoire of natural enzymes. Designing enzymes for non-natural reactions in vivo has been challenging due to the requirements for assembly of the functional catalyst, the compatibility of synthetic reagents in the cellular milieu, and cell permeability to allow substrate influx and product release. The catalysis of non-natural transformations inside cells will enable alternative metabolic routes to natural and artificial products, bio-based production of chemicals currently made using synthetic reactions, and will expand the chemical toolbox available for in vivo studies of cellular function (M. Boyce, C. R. Bertozzi, Nature Methods 8, 638 (2011)).

[0447] The preceding examples demonstrate that a few amino acid mutations in a bacterial cytochrome P450 monooxygenase can unlock significant cyclopropanation activity in vitro. Variants of P450.sub.BM3 from Bacillus megaterium (BM3) catalyze hundreds of turnovers of formal carbene transfers from diazoesters (e.g., ethyl diazoacetate, EDA) to olefins (e.g., styrene) in the presence of a reductant, forming cyclopropane products with high levels of diastereo- and enantioselectivity (P. S. Coelho et al., Science 339, 307 (2013). Olefin cyclopropanation is widely used in the synthesis of fine chemicals (H. Lebel et al., Chem. Rev. 103, 977 (2003)), and state-of-the-art asymmetric organometallic catalysts are able to catalyze thousands to tens of thousands of turnovers (D. A. Evans et al., J. Am. Chem. Soc. 113, 726 (1991); H. M. L. Davies, C. Venkataramani, Org. Lett. 5, 1403 (2003); G. Maas, Chem. Soc. Rev. 33, 183 (2004)). BM3 variants may be suitable for in vivo catalysis because they are readily expressed in functional form and can catalyze non-natural carbene transfers without requiring artificial cofactors or posttranslational modifications. To initiate the catalytic cycle inside a cell, it is necessary to reduce the enzyme to the catalytically active ferrous-P450 with an endogenous reducing agent such as NAD(P)H. Based on consideration of heme ligation control of the P450 Fe.sup.III/F.sub.II reduction potential, a genetically-encoded ABC catalyst that catalyzes efficient and selective olefin cyclopropanation in intact cells was designed.

Results

[0448] Cytochrome P450-catalyzed cyclopropanations require substoichiometric (with respect to diazoester and olefin) reductant and proceed optimally under anaerobic conditions (P. S. Coelho et al., Science 339, 307 (2013)). This indicates that diazoester activation and carbene transfer involve a reduced P450-bound Fe.sup.II-heme cofactor as opposed to the resting state Fe.sup.III-heme (FIG. 19A). Active P450-derived cyclopropanation catalysts show marked preference for strong reducing agents such as sodium dithionite (E=660 mV, all potentials vs SHE) over native NAD(P)H (E=320 mV) (P. S. Coelho et al., Science 339, 307 (2013)). This indicates a limited substrate-induced low-spin (E Fe.sup.III/II=430 mV) to high-spin (E Fe.sup.III/II=290 mV) transition of the P450 heme-iron (T. W. B. Ost et al., Biochemistry 40, 13421 (2001)), which, while essential for monooxygenation, may not be achievable in this engineered system due to the poor affinity for the non-natural substrates (K.sub.M5 mM) (P. S. Coelho et al., Science 339, 307 (2013)). It was hypothesized that raising the reduction potential of the resting state enzyme to facilitate NAD(P)H reduction would be important for enhancing Fe.sup.II catalysis in vivo. Because the reduction potential of heme proteins can be tuned by axial ligand mutations (D. S. Wuttke, H. B. Gray, Curr. Opin. Struct. Biol. 3, 555 (1993); C. J. Reedy et al., Nucleic Acids Res. 36, D307 (2008)), the Fe.sup.III/II potential was raised by substituting the axial cysteine thiolate in BM3 with the weakly donating serine alcohol (FIG. 19A). Furthermore, axial cysteinate ligation is essential for dioxygen activation and stabilization of the active ferryl-porphyrin cation radical oxidant (compound I, FIG. 1) during monooxygenation (J. H. Dawson, Science 240, 433 (1988)), and axial cysteine to serine substitutions abolish monooxygenation activity in mammalian P450s (K. P. Vatsis et al., J. Inorg. Biochem. 91, 542 (2002)). Because free hemin is also a (poor) cyclopropanation catalyst (P. S. Coelho et al., Science 339, 307 (2013)), an axial cysteine to serine mutation (C400S in BM3) maintains carbene transfer activity while eliminating monooxygenation activity.

[0449] The C400S mutation was introduced into a cis-selective cyclopropanation catalyst of the present invention, BM3-CIS (13 mutations from BM3; P. S. Coelho et al., Science 339, 307 (2013)), to contrast with the trans-selectivity observed with iron-porphyrins (J. R. Wolf et al. J. Am. Chem. Soc. 117, 9194 (1995)). BM3-CIS catalyzes hundreds of turnovers in the presence of dithionite in vitro and forms the ethyl 2-phenylcyclopropane-1-carboxylate product with 71% cis-selectivity and 94% enantiomeric excess (ee.sub.cis) (P. S. Coelho et al., Science 339, 307 (2013)). Heme-serine ligation in BM3-CIS-C400S (hereafter called ABC-CIS) was confirmed by determining the crystal structures of the BM3-CIS and ABC-CIS heme domains at 2.5 and 3.3 , respectively (FIG. 9 and Table 38, PDB: 4H23 and 4H24); the structures are superimposable (RMSD=0.52 , FIG. 9). Despite the limited resolution of the ABC-CIS structure, simulated annealing omit maps generated in the absence of modeled heme and C400S show density consistent with heme coordination by a proximal amino acid side chain (FIGS. 19B and 20). UV-vis spectra for the green-brown ABC-CIS (FIGS. 21-23) provide further evidence for heme-serine ligation and are consistent with those reported for a Ser-ligated mammalian P450 (K. P. Vatsis et al., J. Inorg. Biochem. 91, 542 (2002); R. Perera et al., Arch. Biochem. Biophys. 507, 119 (2011)) (Table 39), marked by a ferrous carbon monoxide-bound complex at 411 nm.

TABLE-US-00041 TABLE 39 Comparison of max for ABC-CISheme and CYP2B4-C436S (Vatsis et al.) ABC-CIS.sub.heme (nm) CYP2B4-C436S (nm) Ferric resting state 404 405 Ferrous 425 422 Ferrous-CO 411 413

[0450] Potentiometric redox titrations using the truncated heme domains of wild-type BM3, its C400S variant (referred to herein as ABC), BM3-CIS and ABC-CIS (FIGS. 19C and 24-27) showed that the C400S mutation raises the reduction potential of the resting state enzyme by +127 mV (E Fe.sup.III/II.sub.Ser=293 mV and 265 mV for ABC and ABC-CIS, respectively). This shift is similar in magnitude to that which occurs in BM3 upon substrate binding (T. W. B. Ost et al., Biochemistry 40, 13421 (2001)), and therefore allows ABC-CIS to be reduced by NAD(P)H even in the absence of substrate.

[0451] ABC-CIS (P411.sub.BM3-heme-CIS) is an active dithionite-driven cyclopropanation catalyst in vitro, with Michaelis-Menten parameters (k.sub.cat=82 min.sup.1, K.sub.M-styrene=4.6 mM, K.sub.M-EDA=5.7 mM, FIG. 8), comparable to those of BM3-CIS (P450.sub.BM3-heme-CIS) Table 40).

TABLE-US-00042 TABLE 40 Michaelis-Menten parameters for P450 cyclopropanation catalysts. Error bars correspond to 99% confidence intervals for the fitted parameters. k.sub.cat/(K.sub.M-EDA k.sub.cat K.sub.M-EDA K.sub.M-styrene k.sub.cat/K.sub.M-EDA k.sub.cat/K.sub.M-styrene K.sub.M-styrene) Catalyst (min.sup.1) (mM) (mM) (s.sup.1 M.sup.1) (s.sup.1 M.sup.1) (s.sup.1 M.sup.1 M.sup.1) P450.sub.BM3-heme- 100 24 5.2 3.5 1.4 0.5 320 1,100 2.1 10.sup.5 CIS (5) P411.sub.BM3-heme- 82 15 5.7 2.9 4.6 2.4 240 300 5.5 10.sup.4 CIS

[0452] ABC-CIS displays considerably improved diastereoselectivity (cis:trans 93:7) and enantioselectivity (99% ee.sub.cis) compared to its cysteine homologue (FIG. 28), an unexpected result given the similar active site geometries of the two catalysts (FIG. 9). For a variety of styrenyl substrates, ABC-CIS (P411.sub.BM3-CIS) showed superior cis-selectivity relative to BM3-CIS (Table 41).

TABLE-US-00043 TABLE 41 Enhanced Z selectivity for ABC-CIS (P411.sub.BM3-CIS) over BM3-CIS (P450.sub.BM3-CIS). [00165]embedded image [00166]embedded image [00167]embedded image % ee % ee Reagents heme domain % yield* TTN Z:E.sup. Z.sup. E.sup. R.sub.1 = H, X = Me, P450.sub.BM3-CIS 46 228 78:22 81.4 N/A R.sub.2 = Et P411.sub.BM3-CIS 32 157 93:7 87.1 N/A R.sub.1 = H, X = OMe, P450.sub.BM3-CIS 43 214 48:52 44 N/A R.sub.2 = Et P411.sub.BM3-CIS 47 235 81:19 61 N/A R.sub.1 = H, X = CF.sub.3, P450.sub.BM3-CIS 42 211 39:61 54 93 R.sub.2 = Et P411.sub.BM3-CIS 24 121 76:24 55 75 R.sub.1 = Me, X = H, P450.sub.BM3-CIS 26 127 16:84 6 N/A R.sub.2 = Et P411.sub.BM3-CIS 17 86 30:70 34 N/A R.sub.1 = H, X = H, P450.sub.BM3-CIS 0.3 2 3:97 N/A N/A R.sub.2 = t-Bu P411.sub.BM3-CIS 15 76 8:92 N/A N/A *Based on EDA. .sup.Diastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.Enantiomeric excess is only reported when the enantiomers resolved to baseline resolution.

[0453] ABC-CIS shows increased activity compared to BM3-CIS when NADPH is used as the reductant under anaerobic conditions (FIG. 7 and Table 36). BM3-CIS only forms small amounts of cyclopropanes when NADPH is used and forms styrene oxide via monooxygenation as the major product under aerobic conditions. In contrast, ABC-CIS produces negligible amounts of styrene oxide and is still able to form cyclopropanes under aerobic conditions, albeit with lower yields (43 TTN) due to oxygen inhibition (FIG. 7). Dioxygen inhibition could be due to a two-electron oxidase activity as reported for CYP2B4-C436S (K. P. Vatsis et al. J. Inorg. Biochem. 91, 542 (2002)). NADH drives ABC-CIS-mediated cyclopropanation as efficiently as NADPH (Table 42), indicating that ABC-CIS is well suited for in vivo catalysis under anaerobic conditions where NADPH biosynthesis in E. coli does not take place.

##STR00168##

TABLE-US-00044 TABLE 42 In vitro BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-CIS) cyclopropanation driven by Na.sub.2S.sub.2O.sub.4, NADPH and NADH. Yield [NADPH]/mM [NADH]/mM [Na.sub.2S.sub.2O.sub.4]/mM (%)* TTN cis:trans.sup. % ee cis.sup. % ee trans.sup. 0 0 0 1 3 54:46 0 0 10 35 218 94:6 99 43 1 0 0 47 294 93:7 98 40 5 0 0 58 364 90:10 97 28 10 0 0 49 305 91:9 98 26 0 1 0 70 437 93:7 98 38 0 5 0 68 428 93:7 98 34 0 10 0 47 295 93:7 98 34 *Based on EDA. .sup.Diastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.(2R,1S) (2S,1R). .sup.(2R,1R) (2S,1S).

[0454] The efficiency of cyclopropanatian using resting Escherichia [BL21(DE3)] cells grown in M9Y media [M9, 1.5% yeast extract] expressing variant 9-10A-TS-F87V-T268A (also called BM3-CIS or P450.sub.BM3-CIS) and BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-CIS) was next investigated. Addition of glucose under anaerobic conditions significantly increased product yield (FIG. 29), presumably due to enhanced intracellular production of NADH. ABC-CIS catalyzes thousands of turnovers in vivo is about four times more active than BM3-CIS in whole-cells, and provides the cyclopropane products with enhanced cis-enantioselectivity (Table 43, entries 1 and 2).

TABLE-US-00045 TABLE 43 Cyclopropanation activities for intact E. coli cells expressing engineered enzymes. [00169]embedded image Cell [EDA] Density [P450] Yield ee.sub.cis ee.sub.trans Entry Catalyst (mM) (g.sub.cdw/L) (M) (%) TTN cis:trans (%)* (%).sup. 1 BM3-CIS 8.5 7.7 3.7 42 950 22:78 60 22 (P450.sub.BM3-CIS) 2 ABC-CIS 8.5 7.7 1.3 55 3,700 76:24 96 25 (P411.sub.BM3-CIS) 3 ABC-CIS.sub.heme 8.5 7.7 3.6 67 1,600 71:29 95 17 (P411.sub.BM3-heme-CIS) 4 BM3 (P450.sub.BM3) 8.5 13.4 4.8 0.9 15 25:75 24 21 5 ABC (P411.sub.BM3) 8.5 8.1 1.5 50 2,900 13:87 12 8 6 ABC-CIS 8.5 8.4 1.8 0.6 30 20:80 35 20 (P411.sub.BM3-CIS) + CO 7 ABC-CIS 170 8.4 1.8 72 67,800 90:10 99 43 (P411.sub.BM3-CIS).sup. 8 ABC-CIS 200 20 3.2 78.sup. 48,800 88:12 99 35 (P411.sub.BM3-CIS).sup. P411.sub.BM3 = P450.sub.BM3-C400S Reaction conditions were as follows: 2 eq styrene, 1 eq EDA, 0.2 eq glucose, E. coli whole-cells in aqueous nitrogen-free M9 minimal medium and 5% MeOH cosolvent under anaerobic conditions for twelve hours at 298K. Yields, diastereomeric ratios, and enantiomeric excess were determined by GC analysis. Yields based on EDA. TTN = total turnover number. *(2R,1S) (2S,1R). .sup.(2R,1R) (2S,1S). .sup.Neat reagents were used without addition of MeOH; reactions were left for 24 h. .sup.Isolated yield (1.63 g cyclopropanes). The data represent the averages of triplicate experiments. Standard errors are within 20% of the reported average.

[0455] The C400S mutation compromises protein expression such that ABC-CIS accounts for 2% of dry cell mass compared to 6% for BM3-CIS. The reduced expression is not due to decreased protein stability, as C400S contributes to increased thermostability in the purified ABC-CIS heme domain (ABC-CIS.sub.heme, FIG. 30). The holo enzyme, which contains both heme and diflavin reductase domains, is over two times more active on a molar basis than the heme domain alone (Table 43, entry 3), confirming that reduction to the ferrous state in vivo is important, but also showing that the reducing intracellular environment achieves heme reduction even in the absence of the reductase domain. The C400S mutation (ABC) improves the in vivo cyclopropanation activity of BM3 by over two orders of magnitude (Table 43, entries 4 and 5). Purified ABC is also an efficient NADH-driven cyclopropanation catalyst in vitro, whereas BM3 is barely active (Table 44).

TABLE-US-00046 TABLE 44 In vitro cyclopropanation activities of BM3 and ABC driven by NADH. [00170]embedded image [00171]embedded image [00172]embedded image Yield % ee % ee Catalyst (%)* TTN cis:trans.sup. cis.sup. trans.sup. BM3 (P450.sub.BM3) 0.2 2 0.5 17:83 29 21 ABC (P411.sub.BM3) 36 364 50 12:88 5 1 *Based on EDA. .sup.Diastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.(2R,1S) (2S,1R). .sup.(2R,1R) (2S,1S). Small-scale (500 L) reactions were conducted as described herein with purified P450.sub.BM3 and P411.sub.BM3 catalysts. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value.

[0456] Both ABC-CIS and BM3-CIS whole cells are significantly inhibited by dioxygen (FIG. 31). Whole-cells containing the ABC-CIS gene but with no induction and whole cells devoid of the ABC-CIS gene are able to form small amounts of cyclopropanes, but do so with stereoselectivity similar to that of free hemin (FIG. 32) since free hemin and other heme proteins present in cells are also able to catalyze styrene cyclopropanation at low levels (P. S. Coelho et al., Science 339, 307 (2013)). Whole-cell ABC-CIS catalysts are as stereoselective as purified ABC-CIS in vitro at equivalent catalyst loading (vide infra), demonstrating that the overexpressed P41 1 enzyme favorably outcompetes background catalysis. In vivo cyclopropanation is strongly inhibited by carbon monoxide (Table 43, entry 6), which irreversibly binds ferrous heme, confirming that catalysis occurs in the enzyme active site. Yields could be increased to 80% by increasing the cell density up to OD.sub.600=50 (FIG. 33). Reaction yield was only slightly improved by using excess styrene (FIG. 14), Lysate of cells expressing ABC-CIS and with NADH added retain only about 30% of the activity of the intact whole-cells and are not active in the absence of exogenous reductant (Table 45).

TABLE-US-00047 TABLE 45 Lysate activity compared to in vivo activity. [P411] Yield % ee Catalyst Conditions (M) (%)* TTN cis:trans.sup. cis.sup. ABC-CIS In vivo 1.0 44 5120 80:20 96 (P411.sub.BM3-CIS) ABC-CIS Lysate, no 1.0 0.6 55 67:33 92 (P411.sub.BM3-CIS) reductant ABC-CIS Lysate + 1.0 18 1780 80:20 97 (P411.sub.BM3-CIS) NADH ABC-CIS Lysate + 1.0 0.8 79 64:36 86 (P411.sub.BM3-CIS) dithionite *Based on EDA. .sup.Diastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.(2R,1S) (2S,1R).

[0457] Addition of dithionite inhibited ABC-CIS whole-cell reactions and was less efficient than NADH in driving the reaction in cell lysate (FIG. 15 and Table 45).

[0458] In order to provide a direct comparison of enzyme activity in vivo versus in vitro, both reactions were monitored at the same enzyme concentration over 8 hours (FIG. 34). On a molar basis, the in vivo catalyst showed almost 6 times higher TTN than the purified enzyme after 8 hours and retained the same stereoselectivity (75:25 cis:trans, -95% ee.sub.cis). Both catalysts remained active over 6 hrs, indicating that the observed differences in yield and TTN are due to improved activity rather than enhanced catalyst stability in vivo. Gradual addition of EDA did not improve the reaction yield.

[0459] At high substrate loading (170 mM EDA, 400 mM styrene, added as neat reagents), more than 60,000 catalytic turnovers were observed in the in vivo reaction with ABC-CIS (Table 43, entry 7). ABC-CIS whole-cell reactions are readily scalable to make gram quantities of cyclopropanes with high stereoselectivity, product titer (27 g L.sup.1) and yield (78%, Table 46). No organic cosolvents are necessary, and the cyclopropane products can be readily obtained by extraction with organic solvent at the end of the reaction. Furthermore, the cells can be lyophilized with a cryoprotectant such as sucrose and stored as a powder for weeks at 4 C. without degradation of catalytic activity or diastereo- and enantioselectivity (Table 47).

TABLE-US-00048 TABLE 46 Cyclopropanation activities for intact E. coli cells expressing ABC-CIS (P411.sub.BM3-CIS). [00173]embedded image vol. sp. c.sub.(substrate) c.sub.(carbene) c.sub.(cells) c.sub.(product) c.sub.(product) Yield.sup.1 time productivity Productivity [mM] [mM] [g/L] [mM] [g/L] [%] [h] [g/L/h] [g/g/h] 400 170 20 142 27 84% 12.sup.2 2.3.sup.2 0.19.sup.2 Reaction conditions are those described in Table 43 except where noted. .sup.1Yield is calculated based on carbene conversion. .sup.2Reaction was run overnight; actual reaction time may be shorter and hence productivity numbers are the worst possible scenario.

TABLE-US-00049 TABLE 47 Cyclopropanation activity of lyophilized ABC-CIS (P411.sub.BM3-CIS) whole-cell catalysts. [00174]embedded image Total [Cell Turnover density] [P411] Yield (mmol % ee % ee Catalyst (g.sub.cdw L.sup.1) (M) (%)* g.sub.cdw.sup.1) TTN cis:trans.sup. cis.sup. trans.sup. ABC-CIS 6.0 0.8 43 0.710 5300 67:33 93 25 (P411.sub.BM3-CIS) 0.08 600 *Based on EDA. .sup.Diastereomeric ratios and enantiomeric excess were determined by GC analysis. .sup.(2R,1S) (2S,1R). .sup.(2R,1R) (2S,1S). Cells were lyophilized in 10% sucrose (m/V) and were stored at 4 C. for two weeks. An appropriate mass of the resulting powder was transferred to a 2 mL glass vial, which was crimp sealed and purged with argon. Degassed solutions of nitrogen-free M9 medium and glucose (20 mM) were added via syringe. Cells were resuspended to OD.sub.600 = 25 and 2 mM final concentration of glucose. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value.

[0460] The lyophilized cells can be readily packaged and distributed. These features render the whole cell process attractive for facile benchtop synthesis.

[0461] ABC catalysts based on a Ser-ligated cytochrome-P411 are spectroscopically, electrochemically and catalytically distinct from cytochrome P450s. Whole-cell ABC catalysts are easy to use and deliver high conversion, optical purity and yield for substrate input in the tens of grams per liter. The ability to catalyze this non-natural CC bond forming reaction in vivo expands the scope of transformations accessible to microbial organic synthesis and provides artificial metabolic pathways to complement nature's existing strategies for making cyclopropanes (L. A. Wessjohann et al., Chem. Rev. 103, 1625 (2003).

[0462] This concept has been demonstrated for a single P450 enzyme, from Bacillus megaterium, and for chimeras of the B. megaterium enzyme with other, related P450s from B. subtilis. Those of skill in the art, however, will recognize that other P450s from other organisms can be engineered to carry out cyclopropanation and ABC whole-cell catalysts can be made using those enzymes. In particular, the equivalent of the C400S mutation will improve the performance of other P450 enzymes for cyclopropanation and other carbene transfer reactions. One of skill in the art knows how to identify the equivalent residue to C400 in other P450s, based on sequence alignments, an example of which is given below. Methods known in the art, such as site-directed mutagenesis or gene synthesis, can be used to alter this residue to serine in any P450. if the resulting enzyme folds properly, it will serve as a catalyst for cyclopropanation. This mutation in a purified protein or whole cell catalyst will improve the activity over the parent enzyme that does not include this mutation.

[0463] For example, BLAST alignment (http://blast.ncbi.nlm.nih.gov/Blast.cgi) of the amino acid sequence of P450.sub.BM3 (CYP102A1) to other P450s, such as the one from Pseudomonas putida (CYP101A1, P450.sub.CAM) or the mammalian enzyme from Oryctolagus cuniculus (CYP2B4), enables identification of the proximal cysteine residue or of the equivalent T268 (marked in bold), as shown below (SEQ ID NOS:61-69):

TABLE-US-00050 CYP102A1 380 ENPSAIPQH--------AFKPFGNGQRACIGQQFALHEATLVL 414 E+APH+ FG+GC+GQAE+ L CYP101A1 329 ERENACPMHVDFSRQKVSHTTPGHGSHLCLGQHLARREIIVTL 371 CYP102A1 265 GHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRL 324 G+TLSF++ FLK+PA+ ER+P+ ELR CYP101A1 249 GLDTVVNFLSFSMEFLAKSPEHRQELIERPER-----IPA------------ACEELLR- 290 CYP102A1 374 FRPERF--ENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFD 422 FPFN+ FPFG+RC+G+ AEL+L++F CYP2B4 408 FNPGHFLDANGALKRNEGFMPFSLGKRVCLGEGIARTELFLFFTTILQNFS 458 CYP102A1 257 QIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVL-VDPVPSYKQVKQLKYVG 315 +++ AGETTSL+ ++KPHV++ +E+V+ P+ ++ Y CYP2B4 291 TVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTD 350

[0464] Therefore, the mutations C357S and T252A in CYP101A1 or C436S and T302A in CYP2B4 are expected to enhance the cyclopropanation activity in these enzymes. The mutation can be introduced into the target gene by using standard cloning techniques or by gene synthesis. The mutated gene can be expressed in the appropriate microbial host under the control of an inducible promoter or by means of chromosomal integration under the control of a constitutive promoter. Cyclopropanation activity can be screened in vivo or in vitro by following product formation by GC or HPLC (see, Materials and Methods).

[0465] Because the ABC catalyst is genetically encoded and functions very well in whole cells, this catalyst can be incorporated into multi-enzyme pathways for biological synthesis in vivo, where multiple transformations of a substrate are carried out inside the cell. In particular embodiments, the EDA or other diazo reagent is provided exogenously to the medium and/or generated in situ.

[0466] The ability to extend the C400S mutation to other P450 scaffolds provides access to a variety of diazo compounds as carbenoid precursors. These include, but are not limited to, diazo esters (acceptor type), diazo -keto ester or -cyano esters (acceptor-aceptor type), and alkyl, aryl, or alkenyl substituted diazo esters (donor-acceptor) (FIG. 17A). These diazo compounds can be reacted inter- and intramolecularly with a variety of styrenes, aliphatic olefins, and allenes to provide biologically active compounds or organic building blocks for further reaction (FIG. 17B). For instance, P450 catalyzed reaction of a diazo ester with aryl or allylic silanes and boronic acids would form cyclopropanes that can then be used in Suzuki or Hiyama cross coupling reactions. Furthermore, cyclopropanation of geranylacetone at the C9 olefin by a trans selective P450 catalyst and EDA provides a key precursor to anthroplalone and noranthroplone, marine natural products that exhibit microgram cytotoxicity against B-16 melanoma cells (FIG. 17C). Lastly, treatment of 2,5-dimethylhexa-2,4-diene with a similar catalyst and EDA provides the ethyl ester of chrysanthemic acid, an important intermediate in the production of pyrethroid insecticides (FIG. 17D).

Materials and Methods

[0467] Unless otherwise noted, all chemicals and reagents for chemical reactions were obtained from commercial suppliers (Sigma-Aldrich, Acros) and used without further purification. Silica gel chromatography purifications were carried out using AMD Silica Gel 60, 230-400 mesh. .sup.1H and .sup.13C NMR spectra were recorded on either a Varian Mercury 300 spectrometer (300 MHz and 75 MHz, respectively), or a Varian Inova 500 MHz (500 MHz and 125 MHz, respectively), and are internally referenced to residual solvent peak. Data for .sup.1H NMR are reported in the conventional form: chemical shift ( ppm), multiplicity (s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet, br=broad), coupling constant (Hz), integration. Data for .sup.13C are reported in terms of chemical shift ( ppm) and multiplicity. High-resolution mass spectra were obtained with a JEOL JMS-600H High Resolution Mass Spectrometer at the California Institute of Technology Mass Spectral Facility. Reactions were monitored using thin layer chromatography (Merck 60 silica gel plates) using an UV-lamp for visualization.

[0468] Gas chromatography (GC) analyses were carried out using a Shimadzu GC-17A gas chromatograph, a FID detector, and an Agilent J&W cyclosil-B column (30 m0.25 mm, 0.25 m film) and 2-phenylethanol as an internal standard. Injector temperature=300 C., oven temperature=130 C. for 30 min, pressure=175 kPa. Elution time: cis-cyclopropanes [19.7 min (2R, 1S) and 21.0 min (2S,1R)], trans-cyclopropanes [25.8 min (2R,1R) and 26.4 min (2S,1S)]. Cyclopropane product standards for the reaction of ethyl diazoacetate (EDA) with styrene (ethyl 2-phenylcyclopropane-1-carboxylate) and -methylstyrene (ethyl 2-methyl-2-phenylcyclopropane-1-carboxylate) were prepared as reported (A. Penoni et al., Eur. J. Inorg. Chem. 2003, 1452 (2003)). These standards and enzyme-prepared cyclopropanes demonstrated identical retention times in gas chromatograms when co-injected, confirming product identity. Absolute stereoconfiguration of cyclopropane enantiomers was determined by measuring optical rotation of purified cyclopropane products from preparative bioconversion reactions using enantioselective BM3 variants and referenced to values taken from reference (N. Watanabe et al., Heterocycles 42, 537 (1996)). Authentic P450-catalyzed cyclopropane samples were also prepared as described herein and were characterized by NMR (.sup.1H and .sup.13C) and mass spectrometry.

[0469] Plasmids pCWori[BM3] and pET22 were used as cloning vectors. Site-directed mutagenesis was accomplished by standard overlap mutagenesis using primers bearing desired mutations (IDT, San Diego, Calif.). Electrocompetent Escherichia coli cells were prepared following the protocol of Sambrook et al., Molecular cloning: a laboratory manual. (Cold Spring Harbor Laboratory Press, New York, 1989), vol. 2. Restriction enzymes BamHI, EcoRI, XhoI, Phusion polymerase, and T4 ligase were purchased from New England Biolabs (NEB, Ipswich, Mass.). Alkaline phosphatase was obtained from Roche (Nutley, N.J.). The 1,000 trace metal mix used in expression cultures contained: 50 mM FeCl.sub.3, 20 mM CaCl.sub.2, 10 mM MnSO.sub.4, 10 mM ZnSO.sub.4, 2 mM CoSO.sub.4, 2 mM CuCl.sub.2, 2 mM NiCl.sub.2, 2 mM Na.sub.2MoO.sub.4, and 2 mM H.sub.3BO.sub.3.

[0470] CO binding assay. P450 concentration was determined from ferrous CO binding difference spectra using extinction coefficients of .sub.450-490=91 mM.sup.1 cm.sup.1 for cysteine-ligated BM3 (T. Omura, R. Sato, J. Biol. Chem. 239, 2370 (1964)) and .sub.411-490=103 mM.sup.1 cm.sup.1 for serine ligated ABC (K. P. Vatsis et al. J. Inorg. Biochem. 91, 542 (2002)).

[0471] P450 expression and purification. For in vitro cyclopropanation reactions, BM3 variants were used in purified form. Enzyme batches were prepared as follows. One liter TB.sub.amp was inoculated with an overnight culture (100 mL, LB.sub.amp) of recombinant E. coli BL21(DE3) cells harboring a pCWori plasmid encoding the P450 variant under the control of the tac promoter. After 3.5 h of incubation at 37 C. and 250 rpm shaking (OD.sub.600 ca. 1.8), the incubation temperature was reduced to 25 C. (30 min), and the cultures were induced by adding IPTG to a final concentration of 0.5 mM. The cultures were allowed to continue for another 24 hours at this temperature. After harvesting the cells by centrifugation (4 C., 15 min, 3,000g), the cell pellet was stored at 20 C. until further use but at least for 2 h. The cell pellet was resuspended in 2.5 mM Tris.Math.HCl buffer (pH 7.5 at 25 C.) and cells were lysed by sonication (21 min, output control 5, 50% duty cycle; Sonicator, Heat SystemsUltrasonic, Inc.). Cell debris was removed by centrifugation for 20 min at 4 C. and 27,000g and the supernatant was subjected to anion exchange chromatography on a Q Sepharose column (HiTrap Q HP, GE Healthcare, Piscataway, N.J.) using an AKTAxpress purifier FPLC system (GE healthcare). The P450 (or P411) was eluted from the Q column by running a gradient from 0 to 0.5 M NaCl over 10 column volumes (P450 elutes at 0.35 M NaCl). The P450 (or P411) fractions were collected and concentrated using a 30 kDa molecular weight cut-off centrifugal filter and buffer-exchanged with 0.1 M phosphate buffer (pH=8.0). The purified protein was flash-frozen on dry ice and stored at 20 C. P450 and P411 concentrations were determined in triplicate using the CO binding assay described above (10 L P450 and 190 L 0.1 M phosphate buffer, pH 8.0, per well).

[0472] For crystallization experiments, a two-step purification was performed using the AKTAxpress purifier FPLC system. Frozen cell pellets containing expressed, 6His tagged heme domains were resuspended in Ni-NTA buffer A (25 mM Tris.Math.HCl, 200 mM NaCl, 25 mM imidazole, pH 8.0, 0.5 mL/gcw) and lysed by sonication (21 min, output control 5, 50% duty cycle). The lysate was centrifuged at 27,000g for 20 min at 4 C. to remove cell debris. The collected supernatant was first subjected to a Ni-NTA chromatography step using a Ni sepharose column (HisTrap-HP, GE healthcare. Piscataway, N.J.). The P450 (or P411) was eluted from the Ni sepharose column using 25 mM Tris.Math.HCl, 200 mM NaCl, 300 mM imidazole, pH 8.0. Ni-purified protein was buffer exchanged into 25 mM Tris.Math.HCl pH 7.5 using a 30 kDa molecular weight cut-off centrifugal filter and subsequently loaded onto a Q sepharose column (HiTrap Q HP, GE healthcare, Piscataway, N.J.) and purified to homogeneity by anion exchange. The P450 (or P41 1) was eluted from the Q column by running a gradient from 0 to 0.5 M NaCl over 10 column volumes. P450 (or P411) fractions were collected and buffer exchanged into 25 mM) Tris.Math.HCl pH 7.5, 25 mM NaCl. The purified protein was concentrated with a 30 kDa molecular weight cut-off centrifugal filter to approximately 10 mg/mL. 50 L aliquots were flash frozen on dry ice and stored at 80 C. until needed.

[0473] Protein crystallography. BM3-CIS and ABC-CIS were crystallized by vapor diffusion. A 1:1 mixture of protein stock (10 mg/mL in 25 mM Tris.Math.HCl pH 7.5, 2.5 mM NaCl) and mother liquor was combined in 24 well sitting drop plates (Hampton Research). Optimal crystallization conditions for BM3-CIS were found in 0.1 M sodium cacadolyte, pH 5.7, 0.14 MgCl.sub.2 and 17% PEG 3350. BM3-CIS crystals typically grew over a span of 7-14 days. ABC-CIS crystals optimally formed in 0.1 M Bis-Tris, pH 5.3, 0.2 M sodium formate and 18% PEG 3350. Initial ABC-CIS drops are marked with a dense layer of protein precipitate; however, after 36-48 hours, noticeable protein crystals were observed underneath the precipitate layer.

[0474] X-ray data collection and protein structure determination. X-ray diffraction data were collected at the General Medical Sciences and Cancer Institutes Structural Biology Facility (GM/CA) at the Advanced Photon Source (APS, Argonne National Laboratory) using beamline ID23-D and a MAR300 CCD detector. Data were collected at 100K and a wavelength Of 1.033 A. Data collections statistics are listed in Table 38. Diffraction datasets were integrated with XDS (W. Kabsch, Acta Crystallogr. D66, 133 (2010)) and scaled using SCALA (P. Evans, Acta Crystallogr. D62, 72 (2006)). Initial phases were determined by molecular replacement against the closed form of wild type BM3.sub.heme structure taken from PDB 1JPZ (D. C. Haines et al., Biochemistry 40, 13456 (2001)), chain B using MOLREP software (A. Vagin, A. Teplyakov, J. App. Crystallogr. 30, 1022 (1997)), a component of the CCP4 crystallography software suite (S. Bailey, Acta Crystallogr. D50, 760 (1994)). Refinement was accomplished by iterative cycles of manual model building within COOT (P. Emsley, K. Cowtan, Coot: Acta Crystallogr. D60, 2126 (2004)) and automated refinement using REFMAC (G. N. Murshudov, A. A. Vagin, E. J. Dodson, Acta Crystallogr. D53, 240 (1997)) within CCP4. Final cycles of REFMAC refinement included TLS parameters. Non-crystallographic symmetry constraints were not used during refinement. Model quality was assessed using the complete validation tool inside of the PHENIX software suite (P. D. Adams et al., Acta Crystallogr. D66, 213 (2010)). Simulated annealing omit maps were also calculated using Phenix. Ramachandran outliers generally lie in poorly structured loops connecting BM3 F and G helices. These residues are often missing or marked by poor density in these and other BM3 structures within the protein database. All protein structure figures and alignments were generated using PyMol software (The PyMOL Molecular Graphics System, Version 1.3, Schrdinger, LLC.).

[0475] Thermostability measurements. Duplicate measurements were taken for all values reported in FIG. 30. Purified P450 (or P411) solutions (4 M, 200 L) were heated in a thermocycler (Eppendorf) over a range of temperatures (40 C.-70 C.) for 10 min followed by rapid cooling to 4 C. for 1 min. The precipitate was removed by centrifugation. The concentration of folded P450 (or P411) remaining in the supernatant was measured by CO-difference spectroscopy (as described above). The temperature at which half of the protein was denatured (T.sub.50) was determined by fitting the data to the equation:

[00001] f ( T ) = 100 1 + e - a ( 1 T - 1 T 50 )

(J. D. Bloom et al., Proc. Natl. Acad. U.S.A. 103, 5869 (2006)).

[0476] Typical procedure for in vitro small-scale cyclopropanation bioconversions under anaerobic conditions. Small-scale reactions (400 L) were conducted in 2 mL crimp vials (Agilent Technologies, San Diego, Calif.). P450 solution (80 L, 100 M) was added to the vial with a small stir bar before crimp sealing with a silicone septum. Phosphate buffer (260 L, 0.1 M, pH=8.0) and 40 L of a solution of the reductant (100 mM Na.sub.2S.sub.2O.sub.4, or 20 mM NADPH) were combined in a larger crimp-sealed vial and degassed by bubbling argon through the solution for at least 5 min (FIG. S1). In the meantime, the headspace of the 2 mL reaction vial with the P450 (or P411) solution was made anaerobic by flushing argon over the protein solution (with no bubbling). When multiple reactions were conducted in parallel, up to 8 reaction vials were degassed in series via cannulae. The buffer/reductant solution (300 L) was syringed into the reaction vial, while under argon. The gas lines were disconnected from the reaction vial before placing the vials on a plate stirrer. A 40 styrene solution in MeOH (10 L, typically 1.2 M) was added to the reaction vial via a glass syringe, and left to stir for about 30 s. A 40EDA solution in MeOH was then added (10 L, typically 400 mM) and the reaction was left stirring for the appropriate time. The final concentrations of the reagents were typically: 30 mM styrene, 10 mM EDA, 10 mM Na.sub.2S.sub.2O.sub.4, 20 M P450.

[0477] The reaction was quenched by adding 30 L HCl (3M) via syringe to the sealed reaction vial. The vials were opened and 20 L internal standard (20 mM 2-phenylethanol in MeOH) was added followed by 1 mL ethyl acetate. This mixture was transferred to a 1.8 mL eppendorf tube which was vortexed and centrifuged (16,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by chiral phase GC.

[0478] A slightly modified work-up was implemented for kinetic experiments. The reactions were quenched after the set time by syringing 1 mL EtOAc to the closed vials and immediately vortexing the mixture. The vials were then opened and 20 L internal standard was added. The mixture was transferred to a 1.8 mL eppendorf tube, vortexed and centrifuged (16,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by GC.

[0479] Media and cell cultures for in vivo cyclopropanation. E. coli [BL21(DE3))] cells were grown from glycerol stock overnight (37 C., 250 rpm) in 5 ml M9Y medium (1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 5.0 g NH.sub.4Cl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, 1.5% yeast extract, 1 mL micronutrients, 0.1 mg mL.sup.1 ampicillin). The pre-culture was used to inoculate 45 mL of M9Y medium in a 125 mL Erlenmeyer flask and this culture was incubated at 37 C., 250 rpm for 2 h and 30 min. At OD.sub.600=1.2, the cultures were cooled to 25 C. and the shaking was reduced to 160 rpm before inducing with IPTG (0.25 mM) and -aminolevulinic acid (0.25 mM). Cultures were harvested after 20 h and resuspended (OD.sub.600=30) in nitrogen-free M9 medium (1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, 1 mL micronutrients). The micronutrient solution contains 0.15 mM (NH.sub.4).sub.6Mo.sub.7O.sub.24, 20.0 mM H.sub.3BO.sub.3, 1.5 mM CoCl.sub.2, 0.5 mM CuSO.sub.4, 4.0 mM MnCl.sub.2, and 0.5 mM ZnSO.sub.4. Aliquots of the cell suspension were used for determination of the cell dry weight (cdw, 2 mL) and P450 (or P411) expression level (4 mL).

[0480] Small-scale whole-cell bioconversions. E. coli cells (OD.sub.600=30, 425 L) were made anaerobic by bubbling argon through the cell suspension in a crimped 2 mL vial. A degassed solution of glucose (50 L, 20 mM) was added to the cells before adding EDA (12.5 L of a 400 mM solution in MeOH) and olefin (12.5 L of a 1.2 M solution in MeOH). The reactions were stirred at room temperature for the appropriate and were worked up by adding 20 L of the internal standard (20 mM 2-phenylethanol) and extracting with 1 mL ethyl acetate. The organic layer was dried over Na.sub.2SO.sub.4 before analyzing the product mixture by chiral phase GC.

[0481] Preparative-scale whole-cell bioconversions. E coli [BL21(DE3)] cells were grown from glycerol stock overnight (37 C., 250 rpm) in 50 ml M9Y medium. The pre-culture was used to inoculate 2-475 ML of M9Y medium in 2-1 L Erlenmeyer flask (using 25 mL each) and this culture was incubated at 37 C., 250 rpm for 2 h and 30 min. At OD.sub.600=1.8, the cultures were cooled to 25 C. and the shaking was reduced to 150 rpm before inducing with IPTG (0.25 mM) and -aminolevulinic acid (0.25 mM). Cultures were harvested after 24 h and resuspended (OD.sub.600=75) in nitrogen-free M9 medium. Aliquots of the cell suspension were used for determination of the cell dry weight (cdw, 2 mL) and P450 (or P411) expression level (2 mL). E. coli cells (OD.sub.600=70, 53.6 mL) were made anaerobic by bubbling argon through the cell suspension in a 500 mL sealed round bottom flask. A degassed solution of glucose (1.4 mL, 500 mM) was added to the cells before adding EDA (1.36 mL, 85% EDA in DCM as packaged by Sigma Aldrich) and styrene (2.5 mL, neat). The reaction was stirred at room temperature under positive argon pressure for 24 h. The crude mixture was poured into 3-50 mL conical tubes and the reaction was quenched by the addition of HCl (1 mL, 3 M) to each tube. The aqueous mixtures were extracted with 1:1 EtOAc: hexanes (20 mL each) and centrifuged (5000 rpm, 5 min). The organics were collected and this extraction sequence was performed two more times. The organics were combined, dried over Na.sub.2SO.sub.4 then concentrated. Excess styrene was removed via azeotrope with H.sub.2O/benzene and 1.85 g of crude product was isolated. Cis/trans selectivity of the reaction was determined via gas chromatography of this crude mixture. Column chromatography of the crude product with 8% Et.sub.2O/hexanes afforded the desired products as a mixture of cis and trans isomers (1.63 g combined, 78% yield). Based on comparison of crude and purified yields, the crude product was approximately 88% pure. NMR of the isolated products were identical to those reported in the literature (P. S. Coelho et al., Science 339, 307 (2013)).

[0482] Time course of in vivo and in vitro reactions. Following the procedure for small scale bioconversions, a series of in vivo and in vitro reactions were set up and EDA was added to each sample at time 0 hours. Time points were taken at 0.5, 1, 1.5, 2, 3, 4, 5, 6, 7, and 8 hours. Each reported yield reflects an average of two independent reactions that were allowed to stir for the indicated amount of time. The error bars shown reflect the two unaveraged data points. Yields of each reaction were determined by GC.

[0483] Potentiometric titrations. Enzyme samples were buffer-exchanged into 100 mM KPO.sub.4, 100 mM KCl, pH 7.4, and deoxygenated via 420 gentle pump-backfill cycles with argon, with care taken to avoid bubbling. Potentiometric redox titrations were performed in an anaerobic glove box, using a quartz spectroelectrochemical cell with path length of 1 mm, platinum mesh working electrode, platinum wire counter electrode, and a Ag/AgCl electrode (Bioanalytical Systems, Inc.) was used as the reference (Ag/AgCl vs NHE: +197 mV). Protein solutions consisted of approximately 600 L of 50-100 M protein with the following mediators added to ensure electrochemical communication between the protein and electrode: methyl viologen (5 M), benzyl viologen (10 M) and 2-hydroxy-1,4-napthaquinone (20 M). Enzyme samples were titrated using sodium dithionite (reduction) and potassium ferricyanide (re-oxidation). The open circuit potential of the cell was monitored (WaveNow potentiostat, Pine Research Instrumentation) over a 10 minute equilibration period, and spectra were recorded using a Ocean Optics spectrometer (USB2000+). The reduction potentials (E) were determined by fitting the data to the one-electron Nernst equation.

[0484] Summary of P450-Derived Cyclopropanation Catalysts. Mutations in cyclopropanation catalysts are reported with respect to wild-type BM3. The heme domain comprises the first 462 amino acids in the BM3 sequence. [0485] ABC: BM3+C400S [0486] BM3-CIS: V78A, F87V, P142S, T175I, A184V, S226R, H236Q, E252G, T268A A290V, L353V, I366V, E442K. [0487] ABC-CIS: BM3-CIS+C400S

[0488] Rationale for the C400S Mutation. The very negative Fe.sup.III/II potential of cytochromes P450 relative to other heme proteins has been ascribed to the strong donating character of the axial cysteinate ligand. This effect has been modeled in cytochrome c: substitution of the native axial methionine for cysteine decreases the Fe.sup.III/II potential by an impressive 652 mV, from 262 mV vs SHE for the Met/His ligated variant to 390 mV vs SHE for the Cys/His variant (A. L. Raphael, H. B, Gray, J. Am. Chem. Soc. 113, 1038 (1991)). Even within cytochrome P450, the reduction potential can be further reduced by increasing the electron donating character of the cysteinate ligand. Removal of a single amide proton proposed to stabilize the cysteinate negative charge shifts the Fe.sup.III/II potential negative by 35-45 mV with respect to wild-type (S. Yoshioka et al., J. Am. Chem. Soc. 124, 14571 (2002)).

[0489] In order to facilitate cyclopropanation activity in vivo, it was necessary to shift the reduction potential sufficiently positive to allow reduction by NADPH. In cytochrome c, it was observed that axial ligation by a weakly donating water molecule raises the reduction potential of the His/H.sub.2O ligated variant (Fe.sup.III/II: 45 mV vs SHE) by 345 mV compared to the Cys/His variant (A. L. Raphael, H. B. Gray, J. Am. Chem. Soc. 113, 1038 (1991)). To that end, it was hypothesized that substitution of the P450 cysteinate axial ligand with the weakly donating serine alcohol would shift the C400S reduction potential positive compared to wild-type. The pK.sub.a of serine (15) is approximately 7 pH units above that of cysteine (8), and so while cysteine remains deprotonated as the cysteinate ligand in both ferric and ferrous states of the enzyme, serine would remain protonated in at least the ferrous form. The serine-ligated mammalian P450 mutant has been suggested to be serinate in the ferric form, and serine in the ferrous form based on analysis of absorption spectra and magnetic circular dichroism (R. Perera et al., Arch. Biochem. Biophys. 507, 119 (2011)), and it was hypothesized that similar ligation in Ser-P450-BM3 would result in a more positive potential.

Supplementary Data

Physical Characterization of the C400S Mutant

[0490] X-Ray Crystallography Statistics. To confirm heme coordination by an axial C400S mutation and to investigate the nature of enhanced stereoselectivity observed in ABC-CIS, crystal structures of both proteins were determined (Table 38) to assess any structural changes that may have occurred due to the axial Cys.fwdarw.Ser mutation. The top panels of FIG. 9 shows alignments of BM3-CIS (green) and ABC-CIS (peach) with left, middle and right panels showing active site residues, the active site I-helix, and global protein fold, respectively. No significant structural changes were observed (RMSD 0.52 ). FIG. 9, middle panels: Large variations are observed upon comparing BM3-CIS with the open (ligand-free) form of wild type BM3 (purple, taken from PDB #2IJ2, RMSD 1.2 ). Pronounced rearrangements are observed in active site side chain residues (left) as well as rotations within the I-helix. Global movements are also observed in the N-terminal beta domain as well as F- and G-helices (right, marked by double headed arrows). These movements are consistent with well-known transitions that occur upon substrate binding and are important for native monooxygenation catalysis. FIG. 9, bottom panels: Alignment of BM3-CIS with a ligand-bound BM3 structure (cyan, taken from PDB #1JPZ, RMSD 0.52 ) demonstrates that BM3-CIS and ABC-CIS mimic the closed protein conformation even in the absence of substrate. Protein augments were carried out using the align tool of PyMol (PyMOL Molecular Graphics System, Version 1.3 Schrdinger, LLC.).

UV-vis Spectroscopy

[0491] FIG. 21 illustrates the absolute spectra for ferric (blue), dithionite reduced ferrous (red) and carbon monoxide bound ferrous (green) ABC-CIS.sub.heme. Soret bands (nm): Fe.sup.III, 404; Fe.sup.II, 410, 425; Fe.sup.IICO, 411. Fe.sup.IICO displays and bands at 532 and 565 nm. Insert shows the carbon monoxide ferrous (pink) and the dithionite reduced ferrous (yellow) enzymes at 4.5 M protein concentration. The shoulder at 410 nm for the ferrous spectrum is due to incomplete reduction to FeII under the aerobic conditions in which these spectra were taken. Reduction of cytochrome P411 under strict anaerobic conditions, as is the case for the redox titrations (FIGS. 25 and 27) gives a single peak at 421 nm.

[0492] FIG. 22 illustrates the absolute spectra for ferric (blue), dithionite reduced ferrous (red) and carbon monoxide bound ferrous (green) ABC-CIS.sub.holo. Soret bands (nm): Fe.sup.III, 404; Fe.sup.II, 410, 422; Fe.sup.IICO, 411. Fe.sup.IICO displays and bands at 533 and 566 nm. Ferric spectrum displays a broad peak at 465 nm.

[0493] FIG. 23 illustrates the difference spectra for ferrous carbonyl with respect to ferrous for: (A) ABC-CIS.sub.heme and (B) ABC-CIS.sub.holo.

Redox Titrations

[0494] FIG. 24 illustrates the potentiometric redox titration for P450.sub.BM3-heme with overlaid Nernst curve fit to E=420 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0495] FIG. 25 illustrates the potentiometric redox titration for P411.sub.BM3-heme with overlaid Nernst curve fit to E=293 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0496] FIG. 26 illustrates the potentiometric redox titration for P450.sub.BM3-heme-CIS with overlaid Nernst curve fit to E=360 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

[0497] FIG. 27 illustrates the potentiometric redox titration for P411.sub.BM3-heme-CIS with overlaid Nernst curve fit to E=265 mV. Inset shows spectral changes upon each sub-stoichiometric addition of sodium dithionite (dashed line: fully ferric; solid line: fully ferrous).

In vitro Cyclopropanation Activities of ABC-CIS and ABC

Michaelis-Menten Kinetics

[0498] Determination of initial rates. Both styrene and EDA concentrations were varied in the presence of the enzymes expressed as the heme-domain (0.5 or 1.0 M BM3-CIS.sub.heme). Reactions were set up in phosphate buffer (pH=8.0) with Na.sub.2S.sub.2O.sub.4 as the reductant at 298 K, and were worked-up as described above. Three time points were taken and used to determine the rate of product formation by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min), Kinetic parameters were determined by fitting the data to the standard Michaelis-Menten model.

Enhanced cis Selectivity and Substrate Scope

[0499] FIG. 28 illustrates the activity under anaerobic vs. aerobic conditions with dithionite for variant 9-10A-TS-F87V-T268A (also called BM3-CIS or P450.sub.BM3-heme-CIS) and BM3-CIS-C400S (also called ABC-CIS or P411.sub.BM3-heme-CIS).

[0500] Small-scale reactions. Selected P450 catalysts were surveyed at a small-scale reaction (400 L total volume) for each combination of reagents (olefins and diazo esters). The small-scale anaerobic bioconversions were conducted as described above and were analyzed by GC. GC methods for these products are reported in reference (P. S. Coelho et al., Science 339, 307 (2013)). Table 41 shows the enhanced Z selectivity for ABC-CIS (P411.sub.BM3-CIS) over BM3-CIS (P450.sub.BM3-CIS).

Monooxygenation vs. Cyclopropanation Activities for BM3-CIS and ABC-CIS

[0501] Activity under anaerobic vs. aerobic conditions with NADPH as the reductant. Small-scale reactions (400 L total volume) were conducted as described above with the following modifications: glucose dehydrogenase (GDH, 4 L, 225 U mL.sup.1) was added to the reaction vial together with the P450 solution. Glucose (40 L, 250 mM) and NADPH (40 L, 5 mM) were degassed together with the buffer solution. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Table 36 illustrates in vitro activities for purified P411.sub.BM3-CIS vs P450.sub.BM3-CIS driven by NADPH.

Choice of Reductant: NADPH vs NADH

[0502] Table 42 illustrates in vitro ABC-CIS.sub.holo cyclopropanation driven by Na.sub.2S.sub.2O.sub.4, NADPH and NADH.

In Vitro Cyclopropanation Activities of BM3 and ABC

[0503] Small-scale (500 L) reactions were conducted as described above with purified BM3 and ABC catalysts. Table 44 illustrates in vitro cyclopropanation activities of BM3 and ABC driven by NADH.

Whole-Cell Cyclopropanation Catalysts

[0504] All experiments using whole-cells were done in triplicate; the error bars represent the standard deviation of the measurements. Total turnovers is defined herein as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

Effect of Glucose Addition

[0505] FIG. 29 illustrates the effect of adding exogenous glucose (2 mM) on olefin cyclopropanation catalyzed by E. coli whole cells expressing 9-10A-TS-F87V-T268A (also called BM3-CIS and P450.sub.BM3-CIS) or BM3-CIS-C400S (also called ABC-CIS and P411.sub.BM3-CIS).

Effect of C400S on Thermostability

[0506] FIG. 30 illustrates thermostabilities of heme domains of BM3-CIS (P450.sub.BM3-CIS in blue) and ABC-CIS (P411.sub.BM3-CIS in red). The C400S mutation stabilizes the heme domain by +1.7 C. The T.sub.50 is the temperature at which half of the enzyme population has unfolded. Error bars correspond to 1- (68.3%) confidence intervals for the T.sub.50.

[0507] Anaerobic vs Aerobic Reaction Conditions

[0508] FIG. 31 illustrates the effect of dioxygen exposure on whole-cell catalyzed cyclopropanation. ABC-CIS (P411.sub.BM3-CIS) is strongly inhibited by dioxygen in vivo. All reactions had a cell density equivalent to OD.sub.600=25. Reactions were conducted in the absence of exogenous glucose. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Product formation is defined as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

Empty Plasmid, No Induction Controls and Dithionite Addition to Whole-Cells

[0509] FIG. 32 illustrates empty plasmid, no-induction controls and dithionite addition to whole cells. E. coli cells carrying the ABC-CIS (P411.sub.BM3-CIS) gene but grown without the addition of IPTG (ABC-CIS no induction); E. coli cells carrying the pcWori plasmid but not the ABC-CIS gene (empty pcWori); ABC-CIS reaction with the addition of exogenous dithionite instead of glucose (ABC-CIS dithionite). Reactions were left for two hours at 298 K. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Product formation is defined as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

Effect of Cell Density

[0510] FIG. 33 illustrates that increasing cell density increases cyclopropane yields up 80%. Total turnovers do not increase for cell densities higher than OD.sub.600=20. Measurements were taken in triplicate and the error bars represent the standard deviation from the mean value. Product formation is defined as the amount of cyclopropane product (mmol) formed per mass of catalyst (g.sub.cdw).

Effect of Styrene Concentration

[0511] FIG. 14 illustrates the effect of using 1, 2, 3, 4 and 5 equivalents of styrene on reaction yield. Excess styrene gives only small improvements in yield.

Lysate Compared to Intact Whole-Cells

[0512] Table 45 illustrates lysate activity compared to in vivo activity.

Lyophilization of Whole-Cell Catalysts

[0513] Cells were lyophilized in 10% sucrose (m/V) and were stored at 4 C. for two weeks. An appropriate mass of the resulting powder was transferred to a 2 mL glass vial, which was crimp sealed and purged with argon. Degassed solutions of nitrogen-free M9 medium and glucose (20 mM) were added via syringe. Cells were resuspended to OD.sub.600=25 and 2 mM final concentration of glucose.

[0514] Table 47 illustrates the cyclopropanation activity of lyophilized ABC-CIS whole-cell catalysts.

[0515] Example 4

A Serine-Substituted P450 Catalyzes Highly Efficient Carbene Transfer to Olefins In Vivo

[0516] Genetically encoded catalysts for non-natural chemical reactions will open new routes to sustainable production of chemicals. This example illustrates the design of a unique serine-heme ligated cytochrome P411 that catalyzes efficient and selective carbene transfers from diazoesters to olefins in intact Escherichia coli cells. The mutation C400S in cytochrome P450.sub.BM3 gives a signature ferrous-CO Soret peak at 411 nm, abolishes monooxygenation activity, raises the resting state Fe.sup.III/II reduction potential, and significantly improves NAD(P)H-driven cyclopropanation activity.

Introduction

[0517] Genetically programmed whole-cell biocatalysts are readily produced in simple: growth media, do not require further purification or isolation and can be engineered with biosynthetic pathways for the elaboration of complex molecules (Ajikumar, P. K. et al. Science 330, 70-74 (2010); Westfall, P. J. et al. Proc. Natl. Acad. Sci. U.S.A. 109, E111-E118 (2012); Kataoka, M. et al. Appl. Microbial. Biotechnol. 62, 437-445 (2003)). The range of accessible transformations, however, is currently limited to the chemical repertoire of natural enzymes. Designing enzymes for non-natural reactions in vivo has been challenging due to the requirements for assembly of the functional catalyst, the compatibility of synthetic reagents in the cellular milieu, and cell permeability to allow substrate influx and product release. The catalysis of non-natural transformations inside cells will enable alternative biosynthetic routes to natural and artificial products, biocatalytic production of chemicals currently made using synthetic reactions, and will expand the chemical toolbox available for in vivo studies of cellular function (Boyce, M. & Bertozzi, C. R. Nature Methods 8, 638-642 (2011)).

[0518] The preceding examples demonstrate that a few amino acid mutations in a bacterial cytochrome P450 monooxygenase can unlock significant cyclopropanation activity in vitro. Variants of P450.sub.BM3 from Bacillus megaterium catalyze hundreds of turnovers of formal carbene transfers from diazoesters (e.g., ethyl diazoacetate, EDA) to olefins (e.g., styrene) in the presence of a reductant, forming cyclopropane products with high levels of diastereoselectivity and enantioselectivity (Coelho, P. S. et al. Science 339, 307-310 (2013)). Olefin cyclopropanation is widely used in the synthesis of fine chemicals (Lebel, H. et al. Chem. Rev. 103, 977-1050 (2003)), and state-of-the-art asymmetric organometallic catalysts are able to catalyze thousands to tens of thousands of turnovers (Evans, D. A. et al. J. Am. Chem. Soc. 113, 726-728 (1991); Davies, H. M. L. & Venkataramani, C. Org. Lett. 5, 1403-1406 (2003); Maas, G. Chem. Soc. Rev. 33, 183-190 (2004)). Because P450.sub.BM3 variants are readily expressed in functional form and can catalyze non-natural carbene transfers without requiring artificial cofactors or posttranslational modifications, this system may be suitable for in vivo catalysis. To initiate the catalytic cycle inside a cell, it is necessary to reduce the enzyme to the catalytically active ferrous-P450 with an endogenous reducing agent such as NAD(P)H. Based on consideration of heme ligation control of the P450 Fe.sup.III/Fe.sup.II reduction potential, genetically encoded cytochrome P411 enzymes have been designed which catalyze efficient and selective olefin cyclopropanation in intact cells.

Results

[0519] Cytochrome P450.sub.BM3-catalyzed cyclopropanations require substoichiometric (with respect to diazoester and olefin) reductant and proceed optimally under anaerobic conditions (Coelho, P. S. et al. Science 339, 307-310 (2013)). This suggests that diazoester activation and carbene transfer involve a reduced P450-bound Fe.sup.II-heme prosthetic group as opposed to the resting state Fe.sup.III-heme (FIG. 35A). Active cyclopropanation catalysts derived from either full-length P450.sub.BM3, which contains a catalytic heme domain fused to a NADPH-driven P450-reductase domain, or the isolated heme domain (P450.sub.BM3-heme) show marked preference for strong reducing agents such as dithionite (E=660 mV, all potentials vs SHE) over native NAD(P)H (E=320 mV) (Coelho, P. S. et al. Science 339, 307-310 (2013)). Reduced activity in the presence of NAD(P)H suggests a limited substrate-induced low-spin (E Fe.sup.III/II=430 mV) to high-spin (E Fe.sup.III/II=290 mV) transition of the P450 heme-iron (Ost, T. W. B. et al. Biochemistry 40, 13421-13429 (2001)), which, while essential for monooxygenation, may not be achievable in this engineered system due to the poor affinity for the non-natural substrates (K.sub.M 5 mM) (Coelho, P. S. et al. Science 339, 307-310 (2013)). It was hypothesized that raising the reduction potential of the resting state enzyme to facilitate NAD(P)H-driven reduction would enhance Fe.sup.II catalysis in vivo. Aware that the reduction potential of heme proteins can be tuned by axial ligand mutations (Wuttke, D. S. & Gray, H. B. Curr. Opin. Struct. Biol. 3, 555-563 (1993); Reedy, C. J. et al. Nucleic Acids Research 36, D307-D313 (2008)), it was reasoned that substituting the axial cysteine thiolate in P450.sub.BM3 with the weakly donating serine alcohol should raise the Fe.sup.III/II potential (FIG. 35A). Furthermore, axial cysteinate ligation is essential for dioxygen activation and stabilization of the active ferryl-porphyrin cation radical oxidant (FIG. 1, compound I) during monooxygenation (Dawson, J. H. Science 240, 433-439 (1988)), and axial cysteine to serine substitutions have been reported to abolish monooxygenation activity in mammalian P450s (Vatsis, K. P. et al. J. Inorg. Biochem. 91, 542-553 (2002)). Because free hemin is also a (poor) cyclopropanation catalyst (Coelho, P. S. et al. Science 339, 307-310 (2013)), an axial cysteine to serine mutation (C400S in P450.sub.BM3) would maintain carbene transfer activity while eliminating monooxygenation activity.

[0520] The C400S mutation was introduced into a cis-selective cyclopropanation catalyst from the preceding examples, P450.sub.BM3-CIS (13 mutations from P450.sub.BM3), to contrast with the trans-selectivity observed with iron-porphyrins (Wolf, J. R. et al. J. Am. Chem. Soc. 117, 9194-9199 (1995)). P450.sub.BM3-CIS catalyzes hundreds of turnovers in the presence of dithionite in vitro and forms the ethyl 2-phenylcyclopropane-1-carboxylate product with 71% cis-selectivity and 94% enantiomeric excess (ee.sub.cis) (Coelho, P. S. et al. Science 339, 307-310 (2013)). UV-vis spectra for the green-brown P450.sub.BM3-CIS-C400S (P411.sub.BM3-CIS, FIGS. 21-23), marked by a ferrous carbon monoxide-bound complex at 411 nm, were consistent with those reported for a Ser-ligated mammalian P450 (Vatsis, K. P. et al. J. Inorg. Biochem. 91, 542-553 (2002); Perera, R. et al. Arch. Bioch. Bioph. 507, 119-125 (2011)) (Table 39). Because of this signature Fe.sup.IICO band at 411 nm, these new P450-derived Ser-ligated enzymes cytochrome are called P411s. The C400S P450.sub.BM3variants will hereafter be referred to as P411.sub.BM3 enzymes. Heme-serine ligation in P411.sub.BM3-CIS was further confirmed by determining the crystal structures of the P450.sub.BM3-CIS and P411.sub.BM3-CIS heme domains at 2.5 and 3.3 , respectively (FIG. 9 and Table 38; PDB: 4H23 and 4H24); the structures were superimposable (RMSD=0.52 ; FIG. 9). Despite the limited resolution of the P411.sub.BM3-CIS structure, simulated annealing omit maps generated in the absence of modeled heme and C400S showed density consistent with heme coordination by a proximal amino acid side chain (FIG. 35B and FIG. 20).

[0521] Potentiometric redox titrations were performed using the truncated heme domains of wild-type P450.sub.BM3, its C400S variant (P411.sub.BM3), P450.sub.BM3-CIS and P411.sub.BM3-CIS (FIGS. 24-27). The C400S mutation raised the reduction potential of the resting state wild-type P450.sub.BM3-heme by +127 mV (E Fe.sup.III/II.sub.Ser=293 mV for P411.sub.BM3-heme), a shift similar in magnitude to that which occurs in P450.sub.BM3 upon substrate binding (Ost, T. W. B. et al. Biochemistry 40, 13421-13429 (2001)). The 13 amino acid mutations in P450.sub.BM3-heme-CIS increased the reduction potential by +60 mV with respect to wild-type P450.sub.BM3-heme (E Fe.sup.III/II.sub.Cys=360 mV for P450.sub.BM3-heme-CIS), but still left P450.sub.BM3-heme-CIS with a lower reduction potential than NAD(P).sup./NAD(P)H. Introducing the C400S mutation in P450.sub.BM3-heme-CIS raised its reduction potential by another +95 mV (E Fe.sup.III/II.sub.Ser=265 mV for P411.sub.BM3-heme-CIS). That the two C400S enzymes have resting state reduction potentials more positive than that of NAD(P).sup./NAD(P)H should allow full-length P411s to be reduced by NAD(P)H even in the absence of substrate.

[0522] The truncated P411.sub.BM3-heme-CIS was an active dithionite-driven cyclopropanation catalyst in vitro, with Michaelis-Menten parameters (k.sub.cat=82 min.sup.1, K.sub.M-styrene=4.6 mM, K.sub.M-FDA=5.7 mM, FIG. 8), comparable to those of P450.sub.BM3-heme-CIS (Table 40). P411.sub.BM3-heme-CIS displayed considerably improved diastereo-(cis:trans 93:7) and enantioselectivity (99% ee.sub.cis) compared to its cysteine homologue (FIG. 28), an unexpected result given the similar active site geometries of the two catalysts (FIG. 9). For a variety of styrenyl substrates, P411.sub.BM3-heme-CIS showed superior cis-selectivity relative to P450.sub.BM3-heme-CIS (Table 41). The full-length, reductase-fused P411.sub.BM3-CIS showed increased activity compared to holo P450.sub.BM3-CIS when NADPH was used as the reductant under anaerobic conditions (FIG. 35C and Table 36). P450.sub.BM3-CIS only formed small amounts of cyclopropanes when NADPH was used, and formed styrene oxide, via monooxygenation, as the major product under aerobic conditions. In contrast, P411.sub.BM3-CIS produced negligible amounts of styrene oxide, confirming removal of monooxygenase activity, and was still able to form cyclopropanes under aerobic conditions, albeit with lower yields (43 TTN) due to oxygen inhibition (FIG. 35C). Dioxygen inhibition could be due to a two-electron oxidase activity as reported for CYP2B4-C436S (Vatsis, K. P. et al. J. Inorg. Biochem. 91, 542-553 (2002)). NADH drove P411.sub.BM3-CIS-mediated cyclopropanation as efficiently as NADPH (Table 42), indicating that P411.sub.BM3-CIS should be well suited for in vivo catalysis under anaerobic conditions where NADPH biosynthesis in E. coli does not take place. The apparent lack of the substoichiometric cofactor preference for cyclopropanation TTN contrasts with P450.sub.BM3's reported specificity for NADPH (Dunford, A. J. et al. Biochim. Bioph. Acta. Proteins and Proteomics 1794, 1181-1189 (2009)).

[0523] The efficiency of cyclopropanation using resting Escherichia coli [BL21(DE3)] cells grown in M9Y media (M9, 1.5% yeast extract) expressing full-length P450.sub.BM3-CIS and P411.sub.BM3-CIS was next investigated. Addition of glucose under anaerobic conditions significantly increased product yield (FIG. 29), presumably due to enhanced intracellular production of NADH, although other cellular reductants could also be involved in reducing the enzyme in vivo, P411.sub.BM3-CIS catalyzed thousands of turnovers in vivo, was about four times more active than P450.sub.BM3-CIS in the whole-cell system, and provided the cyclopropane products with enhanced cis-enantioselectivity (Table 43, entries 1 and 2). The C400S mutation compromises protein expression such that P411BM3-CIS accounts for 2% of dry cell mass compared to 6% for BM3-CIS (entries 1 and 2). The reduced expression was not due to decreased protein stability, as C400S contributed to increased thermostability in the purified P411.sub.BM3-CIS heme domain (P411.sub.BM3-heme-CIS, FIG. 10). Full-length P411.sub.BM3-CIS (entry 2), which contains both heme and diflavin reductase domains, was over two times more active on a molar basis than the truncated heme domain (P411.sub.BM3-heme-CIS, entry 3), confirming that reduction to the ferrous state in vivo was important, but also showing that the reducing intracellular environment achieved heme reduction even in the absence of the reductase domain. The single C400S mutation in P411.sub.BM3 (entry 4) improved the in vivo cyclopropanation activity of wild-type P450.sub.BM3 (entry 5) by over two orders of magnitude. Purified full-length P411.sub.BM3 was also an efficient NADH-driven cyclopropanation catalyst in vitro, whereas P450.sub.BM3 was barely active (Table 44).

[0524] Both P411.sub.BM3-CIS and P450.sub.BM3-CIS whole cells were significantly inhibited by dioxygen (FIG. 31). Whole cells containing the P411.sub.BM3-CIS gene but with no induction and whole cells devoid of the P411.sub.BM3-CIS gene were able to form small amounts of cyclopropanes, but did so with stereoselectivity similar to that of free hemin (FIG. 32). This is not surprising since free hemin and other heme proteins present in cells are also able to catalyze styrene cyclopropanation at low levels (Coelho, P. S. et al. Science 339, 307-310 (2013)). Whole-cell P411.sub.BM3-CIS catalysts were as stereoselective as purified P411.sub.BM3-CIS in vitro at equivalent catalyst loading (vide infra), demonstrating that the overexpressed P411 enzyme outcompeted background catalysis. In vivo cyclopropanation was strongly inhibited by carbon monoxide (Table 43, entry 6), which irreversibly binds ferrous heme, confirming that catalysis occurs in the enzyme active site. Yield could be increased to 80% by increasing the cell density up to OD.sub.600=50 (FIG. 33). Using excess styrene only slightly improved reaction yield (FIG. 14). Lysate of cells expressing full-length P411.sub.BM3-CIS that were supplemented with NADH retained only about 30% of the activity of the intact whole cells and were not active in the absence of exogenous reductant (Table 45). Addition of dithionite inhibited P411.sub.BM3-CIS whole-cell reactions and was less efficient than NADH in driving the reaction in cell lysate (FIG. 32 and Table 45).

[0525] In order to provide a direct comparison of full-length P411.sub.BM3-CIS activity in vivo versus in vitro, both reactions were monitored at the same enzyme concentration over 8 hours (FIG. 34). On a molar basis, the in vivo catalyst showed almost 6 times higher TTN than the purified enzyme after 6 hours and retained the same stereoselectivity (75:25 cis:trans, 95% ee.sub.cis). Both catalysts remained active over this period, indicating that the observed differences in yield and TTN are due to improved activity rather than enhanced catalyst stability in vivo. Gradual addition of EDA did not improve the reaction yield.

[0526] At high substrate loading (170 mM EDA, 400 mM styrene, added as neat reagents), more than 60,000 catalytic turnovers were observed in the in vivo reaction with P411.sub.BM3-CIS (Table 43, entry 7). P411.sub.BM3-CIS whole-cell reactions were readily scalable to make gram quantities of cyclopropanes with high stereoselectivity, product titer (27 g L.sup.1) and yield (78%, entry 8). No organic cosolvent was necessary, and the cyclopropane products were readily obtained by extraction with organic solvent at the end of the reaction. Furthermore, the cells could be lyophilized with a cryoprotectant such as sucrose and stored as a powder for weeks at 4 C. without degradation of catalytic activity or diastereo- and enantioselectivity (Table 47). Lyophilized cells can be readily packaged and distributed. These features render whole-cell P411 catalysts attractive for facile benchtop synthesis.

[0527] Cytochrome P411s are spectroscopically, electrochemically, and catalytically distinct from cytochrome P450s, providing a scaffold for engineering orthogonal heme-enzyme catalysis. Whole-cell catalysts based on serine-heme ligated P411s are easy to use and deliver enzymatic cyclopropanation with high conversion, optical purity and yield for substrate input in the tens of background catalysis. In vivo cyclopropanation was strongly inhibited by carbon monoxide (Table 43, entry 6), which irreversibly binds ferrous heme, confirming that catalysis occurs in the enzyme active site. Yield could be increased to 80% by increasing the cell density up to OD.sub.600=50 (FIG. 33). Using excess styrene only slightly improved reaction yield (FIG. 14). Lysate of cells expressing full-length P411.sub.BM3-CIS that were supplemented with NADH retained only about 30% of the activity of the intact whole cells and were not active in the absence of exogenous reductant (Table 45). Addition of dithionite inhibited P411.sub.BM3-CIS whole-cell reactions and was less efficient than NADH in driving the reaction in cell lysate (FIG. 32 and Table 45).

[0528] In order to provide a direct comparison of full-length P411.sub.BM3-CIS activity in vivo versus in vitro, both reactions were monitored at the same enzyme concentration over 8 hours (FIG. 34). On a molar basis, the in vivo catalyst showed almost 6 times higher TTN than the purified enzyme after 6 hours and retained the same stereoselectivity (75:25 cis:trans, 95% ee.sub.cis). Both catalysts remained active over this period, indicating that the observed differences in yield and TTN are due to improved activity rather than enhanced catalyst stability in vivo. Gradual addition of EDA did not improve the reaction yield.

[0529] At high substrate loading (170 mM EDA, 400 mM styrene, added as neat reagents), more than 60,000 catalytic turnovers were observed in the in vivo reaction with P411.sub.BM3-CIS (Table 43, entry 7). P411BM3-CIS whole-cell reactions were readily scalable to make gram quantities of cyclopropanes with high stereoselectivity, product titer (27 g L.sup.1) and yield (78%, entry 8). No organic cosolvent was necessary, and the cyclopropane products were readily obtained by extraction with organic solvent at the end of the reaction. Furthermore, the cells could be lyophilized with a cryoprotectant such as sucrose and stored as a powder for weeks at 4 C. without degradation of catalytic activity or diastereo- and enantioselectivity (Table 47). Lyophilized cells can be readily packaged and distributed. These features render whole-cell P411 catalysts attractive for facile benchtop synthesis.

[0530] Cytochrome P411s are spectroscopically, electrochemically, and catalytically distinct from cytochrome P450s, providing a scaffold for engineering orthogonal heme-enzyme catalysis. Whole-cell catalysts based on serine-heme ligated P411s are easy to use and deliver enzymatic cyclopropanation with high conversion, optical purity and yield for substrate input in the tens of grams per liter. The ability to catalyze this non-natural CC bond forming reaction in vivo expands the scope of transformations accessible to microbial organic synthesis and provides artificial metabolic pathways to complement nature's existing strategies for making cyclopropanes (Wessjohann, L. A. et al. Chem. Rev. 103, 1625-1647 (2003)).

Materials and Methods

[0531] All reagents were obtained from commercial suppliers (Sigma-Aldrich) and used without further purification. .sup.1H and .sup.13C NMR spectra were recorded on either a Varian Mercury 300 spectrometer (300 MHz and 75 MHz, respectively), or a Varian Inova 500 MHz (500 MHz and 125 MHz, respectively), and are internally referenced to residual solvent peak. High-resolution mass spectra were obtained with a JEOL JMS-600H High Resolution Mass Spectrometer. Gas chromatography (GC) analyses were carried out using a GC-17A gas chromatograph (Shimadzu), a FID detector, and a J&W cyclosil-B column (30 m0.25 mm, 0.25 m film, Agilent) and 2-phenylethanol as an internal standard. Injector temperature=300 C., oven temperature=130 C. for 30 min, pressure=175 kPa. Elution time: cis-cyclopropanes [19.7 min (2R, 1S) and 21.0 min (2S,1R)], trans-cyclopropanes [25.8 min (2R,1R) and 26.4 min (2S,1S)]. Cyclopropane product standards for the reaction of ethyl diazoacetate (EDA) with styrene (ethyl 2-phenylcyclopropane-1-carboxylate) and -methylstyrene (ethyl 2-methyl-2-phenylcyclopropane-1-carboxylate) were prepared as reported (Penoni, A. et al. Eur. J Inorg. Chem., 1452-1460 (2003)). These standards and enzyme-prepared cyclopropanes demonstrated identical retention times in gas chromatograms when co-injected, confirming product identity. Absolute stereoconfiguration of cyclopropane enantiomers was determined by measuring optical rotation of purified cyclopropane products from preparative bioconversion reactions using enantioselective P450.sub.BM3 variants and referenced to values taken from reference (Watanabe, N. et al. Heterocycles 42, 537-542 (1996)). Authentic P450-catalyzed cyclopropane samples were also prepared and were characterized by NMR (.sup.1H and .sup.13C) and mass spectrometry, which matched literature values.

[0532] Plasmids pCWori[P450.sub.BM3] and pET22 were used as cloning vectors. The C400S mutation was introduced by standard overlap mutagenesis using primers bearing the desired mutation (IDT, San Diego, Calif.).

TABLE-US-00051 ForwardPrimers(SEQIDNOS:70and71): HF1: CAGGAAACAGGATCAGCTTACTCCCC BM3_C400S_F_nheI: GAAACGGTCAGCGTGCTAGCATCGGTCAGCAGTTCG RespectiveReversePrimers(SEQIDNOS:72and73): BM3_C400S_R_nheI: CGAACTGCTGACCGATGCTAGCACGCTGACCGTTTC pCWori-Rev: GCGTATCACGAGGCCCTTTCGTCTTCAAGC

[0533] Electrocompetent Escherichia coli cells were prepared following the protocol of Sambrook et al., Molecular cloning: a laboratory manual. Vol. 2 (Cold Spring Harbor Laboratory Press, New York, 1989)). Restriction enzymes BamHI, EcoRI, XhoI, Phusion polymerase, and T4 ligase were purchased from New England Biolabs (NEB, Ipswich, Mass.). Alkaline phosphatase was obtained from Roche (Nutley, N.J.). The 1,000 trace metal mix used in expression cultures contained 50 mM FeCl.sub.3, 20 mM CaCl.sub.2, 10 mM MnSO.sub.4, 10 mM ZnSO.sub.4, 2 mM CoSO.sub.4, 2 mM CuCl.sub.2, 2 mM NiCl.sub.2, 2 mM Na.sub.2MoO.sub.4, and 2 mM H.sub.3BO.sub.3.

[0534] CO binding assay. P450 concentration was determined from ferrous CO binding difference spectra using extinction coefficients of .sub.450-490=91 mM.sup.1 cm.sup.1 for cysteine-ligated P450.sub.BM3 (Omura, T. & Sato, R. J. Biol. Chem. 239, 2370-2378 (1964)) and .sub.411-490=103 mM.sup.1 cm.sup.1 for serine ligated P411.sub.BM3 (Vatsis, K. P. et at J. Inorg. Biochem. 91, 542-553 (2002)). The in vivo P450 (or P411) concentration was determined by conducting the CO assay in the lysate of an aliquot of cells in the same cell density as used for the whole-cell reactions.

[0535] P450 expression and purification. For in vitro cyclopropanation reactions, P450.sub.BM3 variants were used in purified form. Enzyme batches were prepared as follows. One liter TB.sub.amp was inoculated with an overnight culture (100 mL, LB.sub.amp) of recombinant E. coli BL21(DE3) cells harboring a pCWori plasmid encoding the P450 variant under the control of the tac promoter. After 3.5 h of incubation at 37 C. and 250 rpm shaking (OD.sub.600 ca. 1.8), the incubation temperature was reduced to 2.5 C. (30 min), and the cultures were induced by adding IPTG to a final concentration of 0.5 mM. The cultures were allowed to continue for another 24 hours at this temperature. After harvesting the cells by centrifugation (4 C., 15 min, 3,000g), the cell pellet was stored at 20 C. until further use but at least for 2 h. The cell pellet was resuspended in 25 mM Tris.Math.HCl buffer (pH 7.5 at 25 C.) and cells were lysed by sonication (21 min, output control 5, 50% duty cycle; Sonicator, Heat SystemsUltrasonic, Inc.). Cell debris was removed by centrifugation for 20 min at 4 C. and 27,000g and the supernatant was subjected to anion exchange chromatography on a Q Sepharose column (HiTrap Q HP, GE Healthcare, Piscataway, N.J.) using an AKTAxpress purifier FPLC system (GE healthcare). The P450 (or P411) was eluted from the Q column by running a gradient from 0 to 0.5 M NaCl over 10 column volumes. The P450 (or P411) fractions were collected and concentrated using a 30 kDa molecular weight cutoff centrifugal filter and buffer-exchanged with 0.1 M phosphate buffer (pH=8.0). The purified protein was flash-frozen on dry ice and stored at 20 C.

[0536] For crystallization experiments, a two-step purification was performed using the AKTAxpress purifier FPLC system. Frozen cell pellets containing expressed, 6His tagged heme domains were resuspended in Ni-NTA buffer A (25 mM Tris.Math.HCl, 200 mM NaCl, 25 mM imidazole, pH 8.0, 0.5 mL/gcw) and lysed by sonication (21 min, output control 5, 50% duty cycle). The lysate was centrifuged at 27,000g for 20 min at 4 C. to remove cell debris. The collected supernatant was first subjected to a Ni-NTA chromatography step using a Ni sepharose column (HisTrap-HP, GE healthcare, Piscataway, N.J.). The P450 (or P411) was eluted from the Ni sepharose column using 25 mM Tris.Math.HCl, 200 mM NaCl, 300 mM imidazole, pH 8.0. Ni-purified protein was buffer exchanged into 25 mM Tris.Math.HCl pH 7.5 using a 30 kDa molecular weight cutoff centrifugal filter and subsequently loaded onto a Q sepharose column (HiTrap Q HP, GE healthcare, Piscataway, N.J.) and purified to homogeneity by anion exchange. The P450 (or P411) was eluted from the Q column by running a gradient from 0 to 0.5 M NaCl over 10 column volumes. P450 (or P411) fractions were collected and buffer exchanged into 25 mM Tris.Math.HCl pH 7.5, 25 mM NaCl. The purified protein was concentrated with a 30 kDa molecular weight cut-off centrifugal filter to approximately 10 mg mL.sup.1. Aliquots (50 L) were flash frozen on dry ice and stored at 80 C. until needed.

[0537] Mutations in cyclopropanation catalysts are reported with respect to wild-type P450.sub.BM3. The heme domain comprises the first 462 amino acids in the P450.sub.BM3 sequence. P411.sub.BM3=P450.sub.BM3C400S. P450.sub.BM3-CIS=P450.sub.BM3+V78A, F87V, P142S, T175I, A184V, S226, H236Q, E252G, T268A A290V, L353V, I366V, E442K. P411.sub.BM3-CIS=P450.sub.BM3-CIS+C400S.

[0538] Protein crystallography. P450.sub.BM3-heme-CIS and P411.sub.BM3-heme-CIS were crystallized by vapor diffusion. A 1:1 mixture of protein stock (10 mg/mL in 25 mM Tris.Math.HCl pH 7.5, 25 mM NaCl) and mother liquor was combined in 24 well sitting drop plates (Hampton Research). Optimal crystallization conditions for P450.sub.BM3-heme-CIS were found in 0.1 M sodium cacadolyte, pH 5.7, 0.14 MgCl.sub.2 and 17% PEG 3350. P450.sub.BM3-heme-CIS crystals typically grew over a span of 7-14 days. P411.sub.BM3-heme-CIS crystals optimally formed in 0.1 M Bis-Tris, pH 5.3, 0.2 M sodium formate and 18% PEG 3350. Initial P411.sub.BM3-heme-CIS drops are marked with a dense layer of protein precipitate; however, after 36-48 hours, noticeable protein crystals were observed underneath the precipitate layer.

[0539] X-ray data collection and protein structure determination. X-ray diffraction data were collected at the General Medical Sciences and Cancer Institutes Structural Biology Facility (GM/CA) at the Advanced Photon Source (APS, Argonne National Laboratory) using beamline ID23-D and a MAR300 CCD detector. Data were collected at 100K and a wavelength of 1.033 . Data collection statistics are listed in Table 38. Diffraction datasets were integrated with XDS (Kabsch, W. Acta Crystallogr., Sect. D: Biol. Crystallogr. D 66, 133-144 (2010)) and scaled using SCALA (Evans, P. Acta Crystallogr., Sect. D: Biol. Crystallogr. D 62, 72-82 (2006)). Initial phases were determined by molecular replacement against the closed form of wild type P450.sub.BM3-heme structure taken from PDB 1JPZ (Haines, D. C. et al. Biochemistry 40, 13456-13465 (2001)), chain B using MOLREP software (Vagin, A. & Teplyakov, A. Journal of Applied Crystallography 30, 1022-1025 (1997)), a component of the CCP4 crystallography software suite (Bailey, S. Acta Crystallogr., Sect. D: Biol. Crystallogr. D 50, 760-763 (1994)). Refinement was accomplished by iterative cycles of manual model building within COOT (Emsley, P. & Cowtan, K. Acta Crystallogr., Sect. D: Biol. Crystallogr. D 60, 2126-2132 (2004)) and automated refinement using REFMAC (Murshudov, G. N. et al. Acta Crystallogr., Sect. D: Biol. Crystallogr. D 53, 240-255 (1997)) within CCP4. Final cycles of REFMAC refinement included TLS parameters. Non-crystallographic symmetry constraints were not used during refinement. Model quality was assessed using the complete validation tool inside of the PHENIX software suite (Adams, P. D. et al. Acta Crystallogr., Sect. D: Biol. Crystallogr. D 66, 213-221 (2010)). Simulated annealing omit maps were also calculated using Phenix. Ramachandran outliers generally lie in poorly structured loops connecting P450.sub.BM3-heme F and G helices. These residues are often missing or marked by poor density in these and other P450.sub.BM3-heme structures within the protein database. All protein structure figures and alignments were generated using PyMol software (The PyMOL Molecular Graphics System, Version 1.3, Schrdinger, LLC.).

[0540] Potentiometric titrations. Enzyme samples were buffer-exchanged into 100 mM KPO.sub.4, 100 mM KCl, pH 7.4, and deoxygenated via 420 gentle pump-backfill cycles with argon, with care taken to avoid bubbling. Potentiometric redox titrations were performed in an anaerobic glove box, using a quartz spectroelectrochemical cell with path length of 1 mm, platinum mesh working electrode, platinum wire counter electrode, and a Ag/AgCl electrode (Bioanalytical Systems, Inc.) was used as the reference (Ag/AgCl vs NHE: +197 mV). Protein solutions consisted of approximately 600 L of 50-100 M protein with the following mediators added to ensure electrochemical communication between the protein and electrode: methyl viologen (5 M), benzyl viologen (10 M) and 2-hydroxy-1,4-napthaquinone (20 M). Enzyme samples were titrated using sodium dithionite (reduction) and potassium ferricyanide (re-oxidation). The open circuit potential of the cell was monitored (WaveNow potentiostat, Pine Research Instrumentation) over a 10 minute equilibration period, and spectra were recorded using a Ocean Optics spectrometer (USB2000+). The reduction potentials (E) were determined by fitting the data to the one-electron Nernst equation.

[0541] Typical procedure for in vitro small-scale cyclopropanation bioconversions under anaerobic conditions. Small-scale reactions (400 L) were conducted in 2 mL crimp vials (Agilent Technologies, San Diego, Calif.). P450 solution (80 L, 100 M) was added to the vial with a small stir bar before crimp sealing with a silicone septum. Phosphate buffer (260 L, 0.1 M, pH=8.0) and 40 L of a solution of the reductant (100 mM Na.sub.2S.sub.2O.sub.4, or 20 mM NADPH) were combined in a larger crimp-sealed vial and degassed by bubbling argon through the solution for at least 5 min. In the meantime, the headspace of the 2 mL reaction vial with the P450 (or P411) solution was made anaerobic by flushing argon over the protein solution (with no bubbling). When multiple reactions were conducted in parallel, up to 8 reaction vials were degassed in series via cannulae. The buffer/reductant solution (300 L) was syringed into the reaction vial, while under argon. The gas lines were disconnected from the reaction vial before placing the vials on a plate stirrer. A 40 styrene solution in MeOH (10 L, typically 1.2 M) was added to the reaction vial via a glass syringe, and left to stir for about 30 s. A 40EDA solution in MeOH was then added (10 L, typically 400 mM) and the reaction was left stirring for the appropriate time. The final concentrations of the reagents were typically: 30 mM styrene, 10 mM EDA, 10 mM Na.sub.2S.sub.2O.sub.4, 20 M P450. The reaction was quenched by adding 30 L HCl (3M) via syringe to the sealed reaction vial. The vials were opened and 20 L internal standard (20 mM 2-phenylethanol in MeOH) was added followed by 1 mL ethyl acetate. This mixture was transferred to a 1.8 mL Eppendorf tube which was vortexed and centrifuged (16,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by chiral phase GC.

[0542] Determination of initial rates. A slightly modified work-up was implemented for kinetic experiments. The reactions were quenched after the set time by syringing 1 mL EtOAc to the closed vials and immediately vortexing the mixture. The vials were then opened and 20 L internal standard was added. The mixture was transferred to a 1.8 mL Eppendorf tube, vortexed and centrifuged (16,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed by GC. Both styrene and EDA concentrations were varied in the presence of the enzymes expressed as the heme-domain (0.5 or 1.0 M BM3-CIS.sub.heme). Reactions were set up in phosphate buffer (pH=8.0) with Na.sub.2S.sub.2O.sub.4 as the reductant at 298 K, and were worked-up as described herein. Three time points were taken and used to determine the rate of product formation by GC (cyclosil-B 30 m0.32 mm0.25 m): oven temperature=100 C. 5 min, 5 C./min to 200 C., 20 C./min to 250 C., 250 C. for 5 min. Elution time: cis-cyclopropanes (19.20 min and 19.33 min), trans-cyclopropanes (20.44 min). Apparent kinetic constants were determined by fitting the data to the standard Michaelis-Menten model.

[0543] Media and cell cultures for in vivo cyclopropanation. E. coli [BL21(DE3)] cells were grown from glycerol stock overnight (37 C., 250 rpm) in 5 ml M9Y medium [1 L of 5M9 medium contains 31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 5.0 g NH.sub.4Cl, 0.24 g MgSO.sub.4, and 0.01 g CaCl.sub.2. 1 L M9Y contains 200 mL 5M9, 800 mL deionized water, 15 g yeast extract, 1 mL micronutrients, and 0.1 mg mL.sup.1 ampicillin). The pre-culture was used to inoculate 45 mL of M9Y medium in a 125 mL Erlenmeyer flask and this culture was incubated at 37 C., 250 rpm for 2 h and 30 min. At OD.sub.600=1.2, the cultures were cooled to 25 C. and the shaking was reduced to 160 rpm before inducing with IPTG (0.25 mM) and -aminolevulinic acid (0.25 mM). Cultures were harvested after 20 h and resuspended (OD.sub.600=30) in nitrogen-free M9 medium (1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, 1 mL micronutrients). The micronutrient solution contains 0.15 mM (NH.sub.4).sub.6Mo.sub.7O.sub.24, 20.0 mM H.sub.3BO.sub.3, 1.5 mM CoCl.sub.2, 0.5 mM CuSO.sub.4, 4.0 mM MnCl.sub.2, and 0.5 mM ZnSO.sub.4. Aliquots of the cell suspension were used for determination of the cell dry weight (cdw, 2 mL) and P450 (or P411) expression level (3 mL).

[0544] Small-scale whole-cell bioconversions. Reaction conditions were as follows: 2 eq styrene, 1 eq EDA, 0.2 eq glucose, E. coli whole-cells in aqueous nitrogen-free M9 minimal medium and 5% MeOH cosolvent under anaerobic conditions for twelve hours at 298 K. E. coli cells (OD.sub.600=30, 425 L) were made anaerobic by bubbling argon through the cell suspension in a crimped 2 mL vial. A degassed solution of glucose (50 L, 20 mM) was added to the cells before adding EDA (12.5 L of a 400 mM solution in MeOH) and olefin (12.5 L of a 800 mM solution in MeOH). The reactions were stirred at room temperature for the appropriate and were worked up by adding 20 L of the internal standard (20 mM 2-phenylethanol) and extracting with 1 mL ethyl acetate. The organic layer was dried over Na.sub.2SO.sub.4 before analyzing the product mixture by chiral phase GC. Yields, diastereomeric ratios, and enantiomeric excess were determined by GC analysis. Yields based on EDA.

[0545] Preparative-scale whole-cell bioconversions. E. coli [BL21(DE3)] cells were grown from glycerol stock overnight (37 C., 250 rpm) in 50 ml M9Y medium. The pre-culture was used to inoculate two 475 mL of M9Y medium in two 1 L Erlenmeyer flask (using 25 mL each) and this culture was incubated at 37 C., 250 rpm for 2 h and 30 min. At OD.sub.600=1.8, the cultures were cooled to 25 C. and the shaking was reduced to 150 rpm before inducing with IPTG (0.25 mM) and -aminolevulinic acid (0.25 mM). Cultures were harvested after 24 h and resuspended (OD.sub.600=75) in nitrogen-free M9 medium. E. coli cells (OD.sub.600=70, 53.6 mL) were made anaerobic by bubbling argon through the cell suspension in a 500 mL sealed round bottom flask. A degassed solution of glucose (1.4 mL, 500 mM) was added to the cells before adding EDA (1.36 mL, 85% EDA in DCM as packaged by Sigma Aldrich) and styrene (2.5 mL, neat). The reaction was stirred at room temperature under positive argon pressure for 24 h. The crude mixture was poured into three 50 mL conical tubes and the reaction was quenched by the addition of HCl (1 mL, 3 M) to each tube. The aqueous mixtures were extracted with 1:1 EtOAc: hexanes (20 mL each) and centrifuged (5000 rpm, 5 min). The organics were collected and this extraction sequence was performed two more times. The organics were combined, dried over Na.sub.2SO.sub.4 then concentrated. Excess styrene was removed via azeotrope with H.sub.2O/benzene and 1.85 g of crude product was isolated. Cis/trans selectivity of the reaction was determined via gas chromatography of this crude mixture. Column chromatography of the crude product with 8% Et.sub.2O/hexanes afforded the desired products as a mixture of cis and trans isomers (1.63 g combined, 78% yield). Based on comparison of crude and purified yields, the crude product was approximately 88% pure. NMR of the isolated products were identical to those reported in the literature (Coelho, P. S. et al. Science 339, 307-310 (2013)).

[0546] Time course of in vivo and in vitro reactions. Following the procedure for small scale bioconversions, a series of in vivo and in vitro reactions were set up and EDA was added to each sample at time 0 hours. Time points were taken at 0.5, 1, 1.5, 2, 3, 4, 5, 6, 7, and 8 hours. Each reported yield reflects an average of two independent reactions that were allowed to stir for the indicated amount of time. The error bars shown reflect the two unaveraged data points. Yields of each reaction were determined by GC.

[0547] Thermostability measurements. Duplicate measurements were taken for all values reported in FIG. 30. Purified P450 (or P411) solutions (4 M, 200 L) were heated in a thermocycler (Eppendorf) over a range of temperatures (40-70 C.) for 10 min followed by rapid cooling to 4 C. for 1 min. The precipitate was removed by centrifugation. The concentration of folded P450 (or P411) remaining in the supernatant was measured by CO-difference spectroscopy. The temperature at which half of the protein was denatured (T.sub.50) was determined by fitting the data to the equation:

[00002] f ( T ) = 100 1 + e - a ( 1 T - 1 T 50 ) .

[0548] Accession codes: Atomic coordinates and structure factors have been deposited with the PDB (accession codes: 4H23 and 4H24).

Example 5

Enzymatic Synthesis of Milnacipran and Levomilnacipran

[0549] Variants of cytochrome P450.sub.BM3 (CYP102A1 or BM3) and whole cells expressing these enzymes have previously been used for the cyclopropanation of alpha-substituted styrenes with ethyl diazoacetate (EDA) (Coelho, P. S. et al. Science 339:307-310 (2013); Coelho, P. S. et al., Nat. Chem. Bio., 9:485-487 (2013)). This example illustrates the application of this method to the concise and stereoselective synthesis of milnacipran [racemic Z-2-(aminomethyl)-N,N-diethyl-1-phenylcyclopropanecarboxamide] and levomilnacipran [(1S,2R)-milnacipran] via both intermolecular and intramolecular olefin cyclopropanation. This example also illustrates the use of the method described herein to prepare aryl and amide derivatives of levomilnacipran as well as other drugs with similar chemical structure, such as bicifadine and DOV-216,303.

Background

[0550] Milnacipran is a drug used to treat major depressive disorder (MDD) and fibromyalgia (a long-lasting condition that may cause pain, muscle stiffness and tenderness, tiredness, and difficulty falling asleep or staying asleep). Milnacipran is a selective serotonin (5-HT) and norepinephrine (NE) reuptake inhibitor (SSNRI) that works by blocking the 5-HT and NE transporters, thus increasing the extracellular levels of these two monoamine neurotransmitters in the brain. Levomilnacipran, the most psychoactive stereoisomer of milnacipran, is currently in phase III clinical trials for the treatment of major depressive disorders.

[0551] Several strategies have been developed for the synthesis of milnacipran (Pineiro-Nunez, M. in The Art of Drug Synthesis (ed J. J. Li D. S. Johnson) Ch. 14, 205-207 (Wiley, 2007)). Because the commercial drug is a racemate, the synthetic routes are simply concerned with the relative stereochemistry around the cyclopropane ring. The original synthesis of milnacipran employed an alkylation and epoxide ring-opening sequence starting from 2-phenylacetonitrile and 2-(chloromethyl)oxirane (FIG. 36A) (Bonnaud, B. et al., European Patent No. 0200638B1; Bonnaud, B. et al., J. Medicinal Chemistry 30, 318-325 (1987)), which yielded a mixture of Z and E cyclopropanes. Lactonization of the resulting products under thermal conditions yielded key intermediate 1 ((1S, 5R)-1-phenyl-3-oxabicyclo[3.1.0]hexan-2-one), which contained the requisite Z-geometry at stereocenters 1 and 2. This intermediate has been converted to milnacipran using three routes outlined in FIG. 36B. In Route A, phthalimide ring opening yielded 2, which was readily converted to milnacipran after amidation and pthalimide deprotection. In Route B, 1 was opened with hydrobromic acid and treated with thionyl chloride to generate doubly functionalized intermediate 3 (Mouzin, G. et al., Synthesis, 4, 304-305 (1978)). Stepwise treatment with diethylamine and potassium phtalimide generated an intermediate, which was common to the synthesis in Route A. In Route C, direct amide formation using n-BuLi and HNEt.sub.2 yielded 4 which could be converted to milnacipran after azide nucleophilic substitution followed by hydrogenation (Shuto, S. et al., J. Med Chem. 38, 2964-2968 (1995)). FIG. 36C shows an entirely different approach to milnacipran synthesis. The general strategy is based on position selective deprotonation of the commercially available cyclopropane carboxamide 5 (Zhang, M.-X. et al., Angew. Chem. Int. Ed., 41, 2169-2170 (2002)).

[0552] Enantioselective syntheses of levomilnacipran have focused on asymmetric methods for formation of the key intermediate 1. FIG. 37A shows the first route which employed a chiral dirhodium(II) tetrakis[methyl 2-oxaazetidine-4(S)-carboxylate], Rh2(4S-MEAZ).sub.4 complex for intramolecular cyclopropanation of 6 and produced 1 in 68% enantioselectivity (Doyle, M. P. et al., Org Lett. 2, 1145 (2000)). More recently, Alliot et al. prepared 1 from 2-phenylacetic acid using asymmetric alkylation using a chiral tetramine auxiliary (Alliot, J. et al., Chem. Commun. 48, 8111-8113 (2012)) (FIG. 37B). Treatment of the alkylation product with I.sub.2 produced a masked halohydrin 7, which underwent esterification and epoxide ring formation under basic conditions. The overall sequence produced 1 in 41% yield and 88% ee.

Results

[0553] In certain aspects, this example describes the formal synthesis of levomilnacipran via direct enantioselective cyclopropanation of N,N-diethyl-2-phenylacrylamide by diazoacetonitrile or ethyl diazoacetate (EDA). Selective nitrile hydrogenation or ester to alcohol reduction then provides levomilnacipran or product 8 (FIG. 38), which is converted to levomilnacipran following previously published amination protocols (Alliot, J. et al., Chem. Commun. 48, 8111-8113 (2012)). Alternatively, an intramolecular cyclopropanation route such as the one shown in FIG. 37A is employed for synthesis of intermediate 1 using P450 enzymes. In both strategies, all stereocenters in the final product would be constructed via enzymatic cyclopropanation.

[0554] These methods are an improvement over previous racemic synthesis because the proposed routes advantageously provide the more psychoactive isomer of milnacipran. Furthermore, the intermolecular route proposed in FIG. 38 is the first route to employ late stage cyclopropanation for synthesis of milnacipran and is highly convergent as the amide moiety is installed prior to cyclopropanation. The intramolecular route is advantageous over previously reported routes because it is concise and enables the use of P450.sub.BM3 or whole cells expressing these proteins in place of costly rhodium complexes with highly designed synthetic ligands.

[0555] The preceding examples show that P450 are excellent catalysts for carbene transfer from diazo compounds to olefins to form cyclopropanes. This reaction has been explored for a variety of substituted olefins and in particular, the present examples show that cyclopropanation can be performed on mono- and disubstituted styrenes. Additionally, functional groups and substitution on the aryl ring of styrene is also well-tolerated by this reaction including electron donating groups such as methoxy and electron withdrawing groups such as trifluoromethyl. This example demonstrates that 1) amide and ester functionalities are compatible with P450-mediated cyclopropanation and 2) significant steric bulk can be tolerated in the alpha position of styrene.

[0556] This example shows that P450s are competent catalysts for the cyclopropanation of substituted styrenes of the general form 9, where R=ester or amide. Treatment of the acrylate ester 9a (20 mM) and EDA (8.5 mM) with WT-T268A-C400S (2 mutations from wild-type BM3, herein called P411-T268A, 10 M, where P411 denotes the C400S mutation) and sodium dithionite (10 mM) yielded appreciable amounts of the corresponding product 10a. BM3-CIS-C400S (14 mutations from wild-type, herein called P411-CIS) was also able to catalyze the cyclopropanation of the acrylamide 9b, albeit at very low conversions (<1%). A screen of axial mutants at position C400 in BM3-CIS yielded variant BM3-CIS-AxH (where AxH denotes a Cys to His substitution in the 400 position of BM3), which exhibited high activity in the reaction of 9b and EDA to provide 10b at 91% yield, 93:7 Z:E diastereoselectivity, and 42% enantioselectivity after 16 h at 25 C. (Table 48).

TABLE-US-00052 TABLE 48 P450-screen for cyclopropanation of milnacipran precursors. [00175]embedded image [00176]embedded image Entry Catalyst Substrate Yield (%) E/Z Ratio 1 BM3-CIS 9a <5 N/A 2 P411-T268A 9a >80 43:57 3 P411-T268A 9b 1 N/A 4 BM3-CIS 9b 0 N/A 5 P411-CIS 9b 0 N/A 6 BM3-CIS-AxD 9b 44 13:87 7 BM3-CIS-AxY 9b 38 16:84 8 BM3-CIS-AxK 9b 45 17:83 9 BM3-CIS-AxH 9b 91 7:93 10 BM3-CIS-AxM 9b 46 17:83 11 Hemin 9b 3 18:82 P411denotes the C400S mutation and Ax denotes a mutation to all other amino acid at the axial position (position 400 in BM3). Reactions were carried out under anaerobic conditions with 8.5 mM EDA, 20 mM 9a or 10 mM 9b, 10 M P450, and 10 mM Na.sub.2S.sub.2O.sub.4.

[0557] Intact whole cells expressing BM3-CIS-AxH can also be used for the cyclopropanation of 9b. E. coli cells expressing P450 were grown in Hyperbroth then resuspended in nitrogen-free M9 minimal media at pH 7 to OD.sub.600=30 (7.8 g.sub.CDW/L). Reaction of 9b and EDA in the presence of these cells and glucose under anaerobic conditions provided 10b in 82% yield. Optimization of BM3-CIS-AxD by site saturation mutagenesis at position T438 yielded BM3-CIS-AXH-T438W, which catalyzed the reaction to 52% yield and 78% enantioselectivity in vivo.

[0558] The preceding examples demonstrate that aryl substitution and alpha substitution on styrene are well tolerated by P450 cyclopropanation. Thus, the method described herein may also be used to prepare aryl and amide derivatives of levomilnacipran as well as other drugs with similar chemical structure, such as bicifadine and DOV-216,303 (FIG. 40). For instance, bicifadine and DOV-216,303 can both be prepared using alpha-styrenyl amides and esters similar to the substrates shown herein. Again, cyclopropanation constructs both stereocenters and subsequent functional group manipulation and cyclization would yield bicifadine or DOV-216,303.

Materials and Methods

[0559] Procedure for Reactions with isolated Enzymes: Small-scale reactions (400 L) were conducted in 2 mL crimp vials (Agilent Technologies, San Diego, Calif.). P450 solution (60 L, 67 M) was added to the vial before crimp sealing with a silicone septum. A solution of Na.sub.2S.sub.2O.sub.4 (12.5 mM) in phosphate buffer (0.1 M, pH=8.0) was prepared and sealed in a larger crimp-sealed vial and degassed by bubbling argon through the solution for 5 min. In the meantime, the headspace of the 2 mL reaction vial with the protein solution was made anaerobic by flushing argon over the vial headspace (with no bubbling). When multiple reactions were conducted in parallel, up to 8 reaction vials were degassed in series via cannulae. The buffer/reductant solution (320 L) was syringed into the reaction vial, while under argon. A 40 styrene solution in EtOH (10 L, 400 mM) was added to the reaction vial via a glass syringe followed by a 40EDA solution in EtOH (10 L, 400 mM). The reactions were shaken on a shake plate at 350 rpm for 16-20 h. The final concentrations of the reagents were typically: 10 mM styrene, 8.5 mM EDA, 10 mM Na.sub.2S.sub.2O.sub.4, 10 M protein. The reaction was quenched by adding 30 L HCl (3M) via syringe to the sealed reaction vial. The vials were opened and 20 L internal standard (20 mM 2-phenylethanol in EtOH) was added followed by 1 mL cyclohexane. This mixture was transferred to an eppendorf tube which was vortexed and centrifuged (13,000g, 1 min). The top organic layer was dried over an anhydrous sodium sulfate plug and analyzed for yield and enantioselectivity.

[0560] Procedure for Whole Cell Reactions: E. coli cells (OD.sub.600=30, 425 L) were made anaerobic by bubbling argon through the cell suspension in a crimped 2 mL vial. A degassed solution of glucose (50 L, 200 mM) was added to the cells before adding EDA (12.5 L of a 400 mM solution in EtOH) and olefin (12.5 L of a 400 mM solution in EtOH). The final concentrations of the reagents were typically: 10 mM styrene, 8.5 mM EDA, and 20 mM glucose. The reactions were shaken at room temperature for 16-20 h and were worked up by adding 20 L of the internal standard (20 mM 2-phenylethanol) and extracting with 1 mL cyclohexane. The organic layer was dried over Na.sub.2SO.sub.4 then analyzed for yield and enantioselectivity.

[0561] Determination of Yield, Enantioselectivity and Absolute Chirality: Yield for purified enzyme and whole cell reactions were determined via gas chromatography using a flame ionization detector, relative to phenethyl alcohol as internal standard (FIG. 39). Gas chromatography was performed using Agilent cycloSil-B column, 30 m0.25 um0.32 mm, method: 90 C. (hold 2 min), 90-110 (6 C./min), 110-190 (40 C./min), and 190-280 (20 C./min): internal standard at 4.8 min, starting material at 10.4 min, and product at 14.8 min (E-isomer) and 15.4 min (Z-isomer). Independently synthesized product 10b was used to generate a GC calibration curve. Identity of the product was confirmed by proton NMR and relative stereochemistry of the major diastereomer was determined by Nuclear Overhauser effect spectroscopy (NOESY). Enantioselectivity was established by chiral HPLC (on ChiralPak AS column, eluting with 4% IPA/supercritical CO.sub.2), using a racemic sample of 10b prepared from 9b EDA, and hemin as reference. The absolute stereochemistry of 10b was established by polarimetry after reduction of 10b to 8 using LiBH.sub.4. Comparison of the optical rotation of product to published specific rotation of 8 (Alliot, J. et al., Chem. Commun. 48, 8111-8113 (2012)) allowed assignment of stereocenters in position 1 and 2 (FIG. 38) as IS, 2R, in agreement with levomilnacipran.

[0562] Amino acid sequences: BM3-CIS contains the following mutations from wild type: V78A F87V P142S T175I A184V S226R H236Q E252G T268A A290V L353V I366V E442K. P411-CIS contains BM3-CIS and Cys to Ser at position 400 of BM3. BM3-CIS-AxX (where X=H, D, A, M, etc.) mutants contains Cys to X mutation at position 400 of BM3. The complete P450.sub.BM3 sequence is set forth in SEQ ID NO:1.

Example 6

Enzymatic Synthesis of Pyrethroid and Pyrethrin Insecticides

[0563] This example illustrates the synthesis of ethyl chrysanthemate using the cytochrome P450 catalysts of the present invention. The resulting ethyl chrysanthemate can be converted chemically or enzymatically to pyrethroid and pyrethrin insecticides.

[0564] Cytochrome P450 derived cyclopropanation catalysts show a measurable promiscuous activity towards the synthesis of pyrethric acids from ethyl diazoacetate (EDA) and diolefins. This example illustrates that P450 catalysts can make ethyl chrysanthemate from EDA and 2,5-dimethyl-2,4-hexadiene. Intact E. coli cells expressing a double mutant of wild-type cytochrome P450.sub.BM3 (CYP102A1), BM3-T268A-C400S, displayed measurable activity for the synthesis of ethyl chrysanthemate as shown in FIG. 41. Purified BM3-T268A-C400S was also capable of making chrysanthemate in vitro.

[0565] The reaction solution was quenched with acid (final concentration of 1% HCL) and extracted with ethyl acetate. 2-Phenylethanol was used an internal standard for analysis by gas-chromatography. An authentic sample of ethyl chrysanthemate was purchased from Sigma-Aldrich. Enzymatic production of chrysanthemate was confirmed by GC-FID and GC-MS (FIGS. 42 and 43).

[0566] The resulting ethyl chrysanthemate can be converted chemically or enzymatically to pyrethroid and pyrethrin insecticides as shown in FIG. 44. For example, a lipase enzyme can be used to catalyze the transesterification reaction shown in FIG. 44(d).

Example 7

Cytochrome P450-Cam Catalyzed Cyclopropanation of Styrene

[0567] This example illustrates that cytochrome P450-Cam (Cyp101A1, SEQ ID NO:25) and its cis-axial C357S variant (P411-Cam, wherein the variant has a C357S substitution at the axial position in SEQ ID NO:25) are capable of catalyzing the cyclopropanation of styrene using ethyl diazoacetate (EDA) as the carbene precursor, thereby resulting in ethyl 2-phenylcyclopropane-1-carboxylate.

[0568] E. coli BL21 (DE3) cells expressing cytochrome P450-Cam and P411-Cam from plasmid pET22 were grown from glycerol stock overnight (37 C., 250 rpm) in 5 ml Hyperbroth medium (54.0 g/L Hyperbroth mix as purchased from Athena Enzyme Systems, 0.1 g/L ampicillin). The pre-culture was used to inoculate 45 mL of M9Y medium (per 1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 5.0 g NH.sub.4Cl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, 1.5% yeast extract, 1 mL micronutrients (0.15 mM (NH.sub.4).sub.6Mo.sub.7O.sub.24, 20.0 mM H.sub.3BO.sub.3, 1.5 mM CoCl.sub.2, 0.5 mM CuSO.sub.4, 4.0 mM MnCl.sub.2, and 0.5 mM ZnSO.sub.4), 0.1 mg mL.sup.1 ampicillin) in a 125 mL Erlenmeyer flask and this culture was incubated at 37 C., 250 rpm for 2 h and 30 min. At OD.sub.6001.2, the cultures were cooled to 25 C. and the shaking was reduced to 160 rpm before inducing with IPTG (0.25 mM) and -aminolevulinic acid (0.25 mM). Cultures were harvested after 20 h and resuspended (OD.sub.600=30) in nitrogen-free M9 medium (per 1 L:31 g Na.sub.2HPO.sub.4, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, 0.24 g MgSO.sub.4, 0.01 g CaCl.sub.2, micronutrients (0.15 mM (NH.sub.4).sub.6Mo.sub.7O.sub.24, 20.0 mM H.sub.3BO.sub.3, 1.5 mM CoCl.sub.2, 0.5 mM CuSO.sub.4, 4.0 mM MnCl.sub.2, and 0.5 mM ZnSO.sub.4)). The micronutrient solution contains 0.15 mM (NH.sub.4).sub.6Mo.sub.7O.sub.24, 20.0 mM H.sub.3BO.sub.3, 1.5 mM CoCl.sub.2, 0.5 mM CuSO.sub.4, 4.0 mM MnCl.sub.2, and 0.5 mM ZnSO.sub.4. Aliquots of the cell suspension were used for determination of the cell dry weight (2 mL) and P450 (or P411) expression level (4 mL).

[0569] Prior the styrene cyclopropanation using ethyl diazoacetate as the carbene precursor, the cells at specified cell density (see, Table 49) were made anaerobic by bubbling argon through the cell suspension in a crimped 2 mL vial. A degassed solution of glucose (50 L, 20 mM) was added to the cells before adding EDA (12.5 L of a 400 mM solution in MeOH) and styrene (12.5 L of a 1.2 M solution in MeOH). The reactions were shaken at room temperature for 16 h and were worked up by adding 20 L of the internal standard (20 mM 2-phenylethanol) and extracting with 1 mL cyclohexane. The organic layer was analyzed by chiral phase GC.

[0570] Gas chromatography (GC) analyses were carried out using a Shimadzu GC-17A gas chromatograph, a FID detector, and an Agilent J&W cyclosil-B column (30 m0.25 mm, 0.25 m film) and 2-phenylethanol as an internal standard. Injector temperature=300 C., oven temperature=130 C. for 30 min, pressure=175 kPa, Elution time: cis-cyclopropanes [19.7 min (2R,1S) and 21.0 min (2S,1R)], trans-cyclopropanes [25.8 min (2R,1R) and 26.4 min (2S,1S)]. The ethyl 2-phenylcyclopropane-1-carboxylate product standard for the reaction of ethyl diazoacetate (EDA) with styrene was prepared as reported (A. Penoni et al., Eur. J. Inorg. Chem. 2003, 1452 (2003)). These standards and enzyme-prepared cyclopropanes demonstrated identical retention times in gas chromatograms when co-injected, confirming product identity. Absolute stereoconfiguration of cyclopropane enantiomers was determined by measuring optical rotation of purified cyclopropane products from preparative bioconversion reactions using enantioselective BM3 variants and referenced to values taken from reference (N. Watanabe et al., Heterocycles 42, 537 (1996)).

[0571] The cytochrome P450 concentration was determined from ferrous CO binding difference spectra of lysate using extinction coefficients of .sub.450-490=91 mM.sup.1 cm.sup.1 for cysteine-ligated P450-Cam (T. Omura, R. Sato, J. Biol. Chem. 239, 2370 (1964)) and .sub.411-490=103 mM.sup.1 cm.sup.1 for serine ligated P411-Cam (K. P. Vatsis et al. J. Inorg. Biochem. 91, 542 (2002)).

[0572] Results are shown in Table 49 and demonstrate that both P450-Cam and P411-Cam catalyze cyclopropropanation of styrene with EDA.

TABLE-US-00053 TABLE 49 P450-Cam and P411-Cam catalyzed cyclopropanation of styrene c.sub.(styrene) c.sub.(EDA) c.sub.(P450 or P411) c.sub.(cells) c.sub.(product) Yield ee.sub.cis ee.sub.trans Enzyme [mM] [mM] [M] [g/L] [mM] [%] TTN Cis:Trans [%] [%] P450-Cam 20 8.5 9.6 5.4 4.8 56 480 82:18 43% 0 P411-Cam 20 8.5 1.0 8 2.4 28 2400 13:87 <5% <5%

Example 8

Cyclopropanation by Axial Mutants of P450-BM3

[0573] This example illustrates that cytochrome variants of P450-BM3 containing mutations at position 400, the axial heme coordination site, from Cys to Ala, Asp, His, Lys, Asn, Met, Thr, or Tyr, are capable of catalyzing the cyclopranation of styrene using ethyl diazoacetate (EDA) as the carbene precursor, resulting in ethyl 2-phenylcyclopropane-1-carboxylate. The convention AxX, wherein X is the single letter amino acid code of the amino acid at the axial position, can be used to describe this series of enzymes.

[0574] P450 were used as isolated and purified proteins. One liter TB.sub.amp was inoculated with an overnight culture (25 mL, TB.sub.amp) of recombinant E. coli BL21 cells harboring pET22 plasmid encoding the His6 (SEQ ID NO:74) tagged P450 variants under the control of the tac promoter. The cultures were shaken at 200 rpm at 37 C. for roughly 3.5 h or until an optical of density of 1.2-1.8 was reached. The temperature was reduced to 25 C. and the shake rate was reduced to 180 rpm for 20 min, then the cultures were induced by adding IPTG and aminolevulinic acid to a final concentration of 0.5 mM. The cultures were allowed to continue for another 20 hours at this temperature. Cells were harvested by centrifugation (4 C., 15 min, 3,000g), and the cell pellet was stored at 20 C. for at least 2 h.

[0575] For the purification of His6 (SEQ ID NO:74) tagged P450s, the thawed cell pellet was resuspended in Ni-NTA buffer A (25 mM Tris.Math.HCl, 200 mM NaCl, 25 mM imidazole, pH 8.0, 0.5 mL/gcw) and lysed by sonication (21 min, output control 5, 50% duty cycle). The lysate was centrifuged at 27,000g for 20 min at 4 C. to remove cell debris. The collected supernatant was first subjected to a Ni-NTA chromatography step using a Ni Sepharose column (HisTrap-HP, GE healthcare, Piscataway, N.J.). The P450 was eluted from the Ni Sepharose column using 25 mM Tris.Math.HCl, 200 MM NaCl, 300 mM imidazole, pH 8.0. Ni-purified protein was buffer exchanged into 0.1 M phosphate buffer (pH=8.0) using a 30 kDa molecular weight cut-off centrifugal filter. Protein concentrations were determined by CO-assay as described above. For storage, proteins were portioned into 300 uL aliquots and stored at 80 C.

[0576] Reactions (400 L) were conducted in 2 mL crimp vials (Agilent Technologies, San Diego, Calif.). P450 solution (80 L, 100 M) was added to the vial with a small stir bar before crimp sealing with a silicone septum. Phosphate buffer (260 L, 0.1 M, pH=8.0) and 40 L of a solution of the reductant (100 mM Na.sub.2S.sub.2O.sub.4) were combined in a larger crimp-sealed vial and degassed by bubbling argon through the solution for at least 5 min. In the meantime, the headspace of the 2 mL reaction vial with the P450 solution was made anaerobic by flushing argon over the protein solution (with no bubbling). When multiple reactions were conducted in parallel, up to 8 reaction vials were degassed in series via cannulae. The buffer/reductant solution (300 L) was syringed into the reaction vial, while under argon. The gas lines were disconnected from the reaction vial before placing the vials on a plate stirrer. A styrene solution in MeOH (10 L, 800 mM) was added to the reaction vial via a glass syringe, and left to stir for about 30 s. A EDA solution in MeOH was then added (10 L, 340 mM) and the reaction was left shaking for 16 h at room temperature. The final concentrations of the reagents were: 20 mM styrene, 8.5 mM EDA, 10 mM Na.sub.2S.sub.2O.sub.4, 20 M P450.

[0577] After16 h, the vials were opened and 20 L internal standard (20 mM 2-phenylethanol in MeOH) was added followed by 1 mL cyclohexane. This mixture was transferred to a 1.8 mL eppendorf tube which was vortexed and centrifuged (16,000g, 1 min). The top organic layer was analyzed by chiral phase GC.

[0578] Gas chromatography (GC) analyses were carried out using a Shimadzu GC-17A gas chromatograph, a FID detector, and an Agilent J&W cyclosil-B column (30 m0.25 mm, 0.25 m film) and 2-phenylethanol as an internal standard. Injector temperature=300 C., oven temperature=130 C. for 30 min, pressure=175 kPa, Elution time: cis-cyclopropanes [19.7 min (2R,1S) and 21.0 min (2S,1R)], trans-cyclopropanes [25.8 min (2R,1R) and 26.4 min (2S,1S)]. The ethyl 2-phenylcyclopropane-1-carboxylate product standard for the reaction of ethyl diazoacetate (EDA) with styrene was prepared as reported (A. Penoni et al., Eur. J. Inorg. Chem. 2003, 1452 (2003)). These standards and enzyme-prepared cyclopropanes demonstrated identical retention times in gas chromatograms when co-injected, confirming product identity. Absolute stereoconfiguration of cyclopropane enantiomers was determined by measuring optical rotation of purified cyclopropane products from preparative bioconversion reactions using enantioselective BM3 variants and referenced to values taken from reference (N. Watanabe et al., Heterocycles 42, 537 (1996)).

[0579] The cytochrome P450 concentration was determined from hemechrome assay of purified protein using extinction coefficients of .sub.418=196 mM.sup.1 cm.sup.1 for the hemechrome complex (J. E. Falk, Porphyrins and Metalloporphyrins, Elsevier: Amsterdam, 1975. p 801-807).

[0580] Results are shown in Table 50 and demonstrate that axial mutants are active cyclopropanation catalysts.

TABLE-US-00054 TABLE 50 Cyclopropanation of styrene catalyzed by P450-BM3 axial mutants (5 uM) AA at c.sub.(styrene) c.sub.(EDA) c.sub.(product) Yield SEQ ID Enzyme name Backbone position 400 [mM] [mM] [mM] [%] TTN Cis:Trans NO: WT-AxA (heme) WT Ala 20 8.5 3.9 56 780 12:88 50 WT-AxD (heme) WT Asp 20 8.5 3.4 28 670 13:87 51 WT-AxH (heme) WT His 20 8.5 3.9 46 780 8:92 52 WT-AxK (heme) WT Lys 20 8.5 3.8 45 760 13:87 53 WT-AxM (heme) WT Met 20 8.5 3.3 39 650 11:89 54 WT-AxN (heme) WT Asn 20 8.5 4.3 51 870 13:87 55 BM3-CIS-T438S-AxA BM3-CIS-T438S Ala 20 8.5 2.8 33 560 10:90 56 BM3-CIS- T438S-AxD BM3-CIS-T438S Asp 20 8.5 2.2 26 430 16:84 57 BM3-CIS- T438S-AxM BM3-CIS-T438S Met 20 8.5 5.4 63 1070 69:31 58 BM3-CIS- T438S-AxY BM3-CIS-T438S Tyr 20 8.5 2.0 23 390 21:79 59 BM3-CIS- T438S-AxT BM3-CIS-T438S Thr 20 8.5 3.0 35 590 15:85 60 The term (heme) refers to a truncated variant of wild-type (WT) P450-BM3 comprising amino acids 1-463 of SEQ ID NO: 1 and the indicated point mutation at amino acid position 400, the axial heme coordination site. The term BM3-CIS-T438S refers to a full-length vairant of WT P450-BM3 comprising the following amino acid substitutions in SEQ ID NO: 1: V78A, F87V, P142S, T175I, A184V, S226R, IT236Q, E252G, T268A, A290V, L353V, I366V, T438S, and E442K.

Example 9

Identification of Cys Axial Ligand in Cytochromes P450

[0581] This example illustrates how to identify the conserved cysteine residue in cytochrome P450 enzymes that serves as the heme axial ligand via sequence alignment.

[0582] The known cytochrome P450-BM3 axial ligand was used to identify the axial ligand in a new P450, CYP2D7 from Homo sapiens, GenBank accession number AAO49806.1. To identify the axial ligand in this enzyme, a protein alignment algorithm provided by the National Institute of Health's NCBI BLASTp suite, version 2.2.28+ (http://blast.ncbi.nlm.nih.gov/Blast.cgi, S. F. Altschul, et al. (1997), Nucleic Acids Res. 25:3389-3402; S. F. Altschul, et al. (2005) FEBS J. 272:5101-5109) was used using the following parameters: E value=10, word size=3, Matrix=Blosum62, and Gap opening=11 and gap extension=1, and conditional compositional score matrix adjustment. Upon entering the protein sequences for P450-BM3 (SEQ ID NO:1) as subject and CYP2D7 (SEQ ID NO:22) as query and requesting an alignment between the two sequences, BLASTp returned a proposed alignment that included the BM3 C400 site (FIG. 45A). On the last row of this alignment, a semi-conserved region including a cysteine was apparent. The cysteine on the lower subject line is BM3's C400 axial ligand. Accordingly, the C461 above in the query line can be identified as the axial ligand in the CYP2D7 protein.

[0583] As a second example, the known P450-BM3 axial ligand was used to identify the axial ligand in P450C27, a mitochondrial P450 from Rattus norvegicus, GenBank accession number AAB02287.1. Upon entering the protein sequences for P450-BM3 (SEQ ID NO:1) as subject and P450C27 (SEQ ID NO:23) as query into BLASTp and requesting an alignment between the two sequences using the parameters described above, a proposed alignment that included the BM3 C400 site (FIG. 45B) was returned.

[0584] On the second to last row of this alignment, a semi-conserved region including a cysteine was apparent. The cysteine on the lower subject line is BM3's C400 axial ligand. Accordingly, the C478 above in the query line can be identified as the axial ligand in the P450C27 protein.

[0585] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.

TABLE-US-00055 INFORMALSEQUENCELISTING SEQIDNO:1 CYP102A1 CytochromeP450(BM3) Bacillusmegaterium GenBankAccessionNo.AAA87602 >gi|142798|gb|AAA87602.1| cytochromeP-450:NADPH-P-450reductaseprecursor [Bacillusmegaterium] TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIK EACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM VDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVRKKAENAHN TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH PPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAD RGEADASDDFEGTYEEWREHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMK GAFSTNVVASKELQQPGSARSTRHLEIELPKEASYQEGDHLGVIPRNYEGIVNRVTARFG LDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE LEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLI MVGPGTGVAPFRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQSEGIIT LHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDGSQMAPAVEATLMKSYAD VHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:2 CYP102A1 B.megaterium >gi|281191140|gb|ADA57069.1| NADPH-cytochromeP450reductase102A1V9 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQKAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADTAMSKGFAPQVATLDSHAGNLPREGAVLTVTASYNGHPPDNAKEFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVPAFTDETLAAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LDIENSEENASTLSLQFVDSAADMPLAKMHRAFSANVVASKELQKPGSARSTRHLEIELPKEASYQEGDH LGVIPRNYSGIVNRVATRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEVLLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKGPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQKELENAQNEGTITLHTAFSRVPNQPKTYVQHVM EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:3 CYP102A1 B.megaterium >gi|281191138|gb|ADA57068.1| NADPH-cytochromeP450reductase102A1V10 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKEFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVPAFIDETFAAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LDIENSEENASTLSLQFVDSAADMPLAKMHRAFSANVVASKELQKPGSARSTRHLEIELPKEASYQEGDH LGVIPRNYEGIVNRVATRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEVLLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKGPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPKEDYLYQKELENAQNEGIITLHTAFSRVPNQPKTYVQHVM EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:4 CYP102A1 B.megaterium >gi|281191126|gb|ADA57062.1| NADPH-cytochromeP450reductase102A1V4 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEATRVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGEDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVRKKVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADDV KGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFN LDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSANVVASKELQQPGSERSTRHLEIALPKEASYQEGDH LGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSIRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKDSETPLTMVGPGTGVAP FRSFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIITLHTAFSRVPNQPKTYVQHVM EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYADVYEVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:5 CYP102A1 B.megaterium >gi|281191124|gb|ADA57061.1NADPH-cytochromeP450reductase102A1V8 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPRVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKEFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LDIENSEENASTLSLQFVDSAADMPLAKMHRAFSANVVASKELQKPGSARSTRHLEIELPKEASYQEGDH LGVIPRNYEGIVNRVATRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEVLLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKGPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQKELENAQNEGIITLHTAFSRVPNQPKTYVQHVM EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:6 CYP102A1 B.megaterium >gi|281191120|gb|ADA57059.1| NADPH-cytochromeP450reductase102A1V3 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVRKKVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADDV KGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFN LDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSANVVASKELQQLGSERSTRHLEIALPKEASYQEGDH LGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEALLEKQAYKEQVLAKRLTMLSLLEKYPACEMEFSEFIALLPSISPRYYSISSSPHVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKDSETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIITLHTAFSRVPNQPKTYVQHVM ERDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYADVYEVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:7 CYP102A1 B.megaterium >gi|281191118|gb|ADA57058.1| NADPH-cytochromeP450reductase102A1V7 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPPEGAVLIVTASYNGHPPDNAKEFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LDIENSEENASTLSLQFVDSAADMPLAKMHRAFSANVVASKELQKPGSARSTRHLEIELPKEASYQEGDH LGVIPRNYEGIVNRVATRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEVLLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKGPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQKELENAQNEGIITLHTAFSRVPNEPKTYVQHVM EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:8 CYP102A1 B.megaterium >gi|281191112|gb|ADA57055.1| NADPH-cytochromeP450reductase102A1V2 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEATRVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGEDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVRKKVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADDV KGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFN LDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSANVVASKELQQLGSERSTRHLEIALPKEASYQEGDH LGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSISPRYYSISSSPHVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKDSETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIITLHTAFSRVPNQPKTYVQHVM ERDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYADVYEVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:9 CYP102A1 B.megaterium >gi|269315992|gb|ACZ37122.1| cytochromeP450:NADPHP450reductase[Bacillus megaterium] MTIKEMPQPKTFGELKNLPLLNTDKPIQTLMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNTLLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNTDEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKEFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LDIENSEENASTLSLQFVDSAADMPLAKMHRAFSANVVASKELQKPGSARSTRHLEIELPKEASYQEGDH LGVIPRNYEGIVNRVATRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEVLLEKQAYKEQVLAKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLANLQEGDTITCFVSTPQSGFTLPKGPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQKELENAQNEGIITLHTAFSRVPNQPKTYVQHVM EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:10 CYP102A1 B.megaterium >gi|281191116|gb|ADA57057.1| NADPHcytochromeP450reductase102A1V6 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNADEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQDDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVFAFIDETLSAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LNIENSEDNASTLSLQFVDSAADMPLAKMHGAFSANVVASKELQQPGSARSTRHLEIELPKEASYQEGDH LGVIPRNYEGIVNRVTTRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEALLEKQAYKEQVLTKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFVSTPQSGFTLPKDPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIITLHTAFSRVPNQPKTYVQKVV EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHKVSEADARLWLQQLEEKSRYAKDVWAG SEQIDNO:11 CYP102A1 B.megaterium >gi|281191114|gb|ADA57056.1| NADPH-cytochromeP450reductase102A1V5 [Bacillusmegaterium] MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDK NLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNADEHI EVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQDDI KVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYF LVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEK GDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKQIPLGGIPSPSREQSAKKERKTVENAHNTPLLVLYGSN MGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADEV KGVRYSVFGCGDKNWATTYQKVPAFIDETLSAKGAENIAERGEADASDDFEGTYEEWREHMWSDLAAYFN LNIENSEDNASTLSLQFVDSAADMPLAKMHGAFSANVVASKELQQPGSARSTRHLEIELPKEASYQEGDH LGVTPRNYEGIVNRVTTRFGLDASQQIRLEAEEEKLAHLPLGKTVSVEELLQYVELQDPVTRTQLRAMAA KTVCPPHKVELEALLEKQAYKEQVLTKRLTMLELLEKYPACEMEFSEFIALLPSMRPRYYSISSSPRVDE KQASTTVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFVSTPQSGFTLPKDPETPLIMVGPGTGVAP FRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQNEGIITLHTAFSRVPNQPKTYVQHVV EQDGKKLIELLDQGAHFYICGDGSQMAPDVEATLMKSYAEVHKVSEADARLWLQQLEEKSRYAKDVWAG SEQIDNO:12 CYP153A6 Mycobacteriumsp.HXN-1500 GenBankAccessionNo.:CAH04396 >gi|51997117|emb|CAH04396.1| cytochromeP450alkanehydroxylase [Mycobacteriumsp.HXN-1500] 1 MTEMTVAASDATNAAYGMALEDIDVSNPVLFRDNTWHPYFKRLREEDPVHYCKSSMFGPY 61 WSVTKYRDIMAVETNPKVFSSEAKSGGITIMDDNAAASLPMFIAMDPPKHDVQRKTVSPI 121 VAPENLATMESVIRQRTADLLDGLPINEEFDWVHRVSIELTTKMLATLFDFPWDDRAKLT 181 RWSDVTTALPGGGIIDSEEQRMAELMECATYFTELWNQRVNAEPKNDLISMMAHSESTRH 241 MAPEEYLGNIVLLIVGGNDTTRNSMTGGVLALNEFPDEYRKLSANPALISSMVSEIIRWQ 301 TPLSHMRRTALEDIEFGGKHIRQGDKVVMWYVSGNRDPEATDNPDTFIIDRAKPRQHLSF 361 GFGIHRCVGNRLAELQLNILWEEILKRWPDPLQIQVLQEPTRVLSPFVKGYESLPVRINA SEQIDNO:13 CYP5013C2 Tetrahymenathermophile GenBankAccessionNo.:ABY59989 >gi|164519863|gb|ABY59989.1| cytochromeP450monooxygenaseCYP5013C2 [Tetrahymenathermophila] 1 MIFELILIAVALFAYFKIAKPYFSYLKYRKYGKGFYYPILGEMIEQEQDLKQHADADYSV 61 HHALDKDPDQKLFVTNLGTKVKLRLIEPETIKDFFSKSQYYQKDQTFIQNITRFLKNGIV 121 FSEGNTWKESRKLFSPAFHYEYIQKLTPLINDITDTIFNLAVKNQELKNFDPIAQIQEIT 181 GRVIIASFFGEVIEGEKFQGLTIIQCLSHIINTLGNQTYSIMYFLFGSKYFELGVTEEHR 241 KFNKFIAEFNKYLLQKIDQQIEIMSNELQTKGYIQNPCILAQLISTHKIDEITRNQLFQD 301 FKTFYIAGMDTTGHLLGMTIYYVSQNKDIYTKLQSEIDSNTDQSAHGLIKNLPYLNAVIK 361 ETLRYYGPGNILFDRIAIKDHELAGIPIKKGTIVTPYAMSMQRNSKYYQDPHKYNPSRWL 421 EKQSSDLHPDANIPFSAGQRKCTGEQLALLEARIILNKFIKMFDFTCPQDYKLMMNYKFL 481 SEPVNPLPLQLTLRKQ SEQIDNO:14 Nonomuraeadietziae >gi|445067389|gb|AGE14547.1| cytochromeP450hydroxylasesb8[Nonomuraea dietziae] GenBankAccessionNo.:AGE14547 VNIDLVDQDHYATFGPPHEQMRWLREHAPVYWHEGEPGFWAVTRHEDVVHVSRHSDLFSSARRLALFNEMPEEQREL QRMMMLNQDPPEHTRRRSLVNRGFTPRTIRALEQHIRDICDDLLDQCSGEGDFVTDLAAPLPLYVICELLGAPVADR DKIFAWSNRMIGAQDPDYAASPEEGGAAAMEVYAYASELAAQRRAAPRDDIVTKLLQSDENGESLTENEFELFVLLL VVAGNETTRNAASGGMLTLFEHPDQWDRLVADPSLAATAADEIVRWVSPVNLFRRTATADLTLGGQQVKADDKVVVF YSSANRDASVFSDPEVFDIGRSPNPHIGFGGGGAHFCLGNHLAKLELRVLFEQLARRFPRMRQTGEARRLRSNFING IKTLPVTLG SEQIDNO:15 CYP2R1 Homosapiens GenBankAccessionNo.:NP078790 >gi|45267826|ref|NP_078790.2| vitaminD25-hydroxylase[Homosapiens] 1 MWKLWRAEEGAAALGGALFLLLFALGVRQLLKQRRPMGFPPGPPGLPFIGNIYSLAASSE 61 LPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTK 121 MGGLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKTLEETKFFNDAIETYKGRPFDFK 181 QLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPF 241 GKHQQLFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENL 301 IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPY 361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVF 421 HPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPD 481 LKPRLGMTLQPQPYLICAERR SEQIDNO:16 CYP2R1 Macacamulatta GenBankAccessionNo.:NP001180887 >gi|302565346|ref|NP_001180887.1| vitaminD25-hydroxylase[Macacamulatta] 1 MWKLWGGEEGAAALGGALFLLLFALGVRQLLKLRRPMGFPPGPPGLPFIGNIYSLAASAE 61 LPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSGIFADRPCLPLFMKMTK 121 MGGLLNSRYGQGWVEHRRLAVNSFRYFGYGQKSFESKILEETKFFTDAIETYKGRPFDFK 181 QLITSAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPF 241 GKHQQLFRNASVVYDFLSRLIEKASVNRKPQLPQHFVDAYFDEMDQGKNDPSSTFSKENL 301 IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKFKMPY 361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVF 421 HPERFLDSSGYFAKKEALVPFSLGRRHCLGEQLARMEMFLFFTALLQRFHLHFPHELVPD 481 LKPRLGMTLQPQPYLICAERR SEQIDNO:17 CYP2R1 Canisfamiliaris GenBankAccessionNo.:XP_854533 >gi|73988871|ref|XP_854533.1| PREDICTED:vitaminD25-hydroxylase[Canis lupusfamiliaris] 1 MRGPPGAEACAAGLGAALLLLLFVLGVRQLLKQRRPAGFPPGPSGLPFIGNIYSLAASGE 61 LAHVYMRKQSRVYGEIFSLDLGGISAVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTK 121 MGGLLNSRYGRGWVDHRKLAVNSFRCFGYGQKSFESKILEETNFFIDAIETYKGRPFDLK 181 QLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGIIPF 241 GKHQQLFRNAAVVYDFLSRLIEKASINRKPQSPQHFVDAYLNEMDQGKNDPSCTFSKENL 301 IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPTGKPSWDDKCKMPY 361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRNPEIF 421 YPFRFLDSSGYFAKKEALVPFSLGKRHCLGEQLARMEMFLFFTALLQRFHLHFPHGLVPD 481 LKPRLGMTLQPQPYLICAERR SEQIDNO:18 CYP2R1 Musmusculus GenBankAccessionNo.:AAI08963 >gi|80477959|gb|AAI08963.1| Cyp2r1protein[Musmusculus] 1 MGDEMDQGQNDPLSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVHKE 61 IDLIVGHNRRPSVVEYKCKMYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTT 121 VITNLYSVHFDEKYWKDPDMFYPERFLDSNGYFTKKEALIPFSLGRRHCLGEQLARMEMF 181 LFFTSLLQQFHLHFPHELVPNLKPRLGMTLQPQPYLICAERR SEQIDNO:19 CYP152A6 BacillushaloduransC-125 GenBankAccessionNo.:NP_242623 >gi|15614320|ref|NP_242623.1| fattyacidalphahydroxylase[Bacillus haloduransC-125] 1 MKSNDPIPKDSPLDHTMNLMREGYEFLSHRKERFQTDLFETRVMGQKVLCIRGAEAVKLF 61 YDPERFKRHRATPKRIQKSLFGENAIQTMDDKAHLHRKQLFLSMMKPEDEQELARLTHET 121 WRRVAEGWKKSRPIVLFDEAKRVLCQVACEWAEVPLKSTEIDRRAEDFHAMVDAFGAVGP 181 RHWRGRKGRRRTERWIQSIIHQVRTGSLQAREGSPLYKVSYHRELNGKLLDERMAAIELI 241 NVLRPIVAIATFISFAAIALQEHPEWQERLKNGSNEEFHMFVQEVRRYYPFAPLIGAKVR 301 KSFTWKGVRFKKGRLVFLDMYGTNHDPKLWDEPDAFRPERFQERKDSLYDFIPQGGGDPT 361 KGHRCPGEGITVEVMKTTMDFLVNDIDYDVPDQDISYSLSRMPTRPESGYIMANIERKYE 421 HA SEQIDNO:20 aryC Streptomycesparvus GenBankAccessionNo.:AFM80022 >gi|392601346|gb|AFM80022.1| cytochromeP450[Streptomycesparvus] 1 MYLGGRRGTEAVGESREPGVWEVFRYDEAVQVLGDHRTFSSDMNHFIPEEQRQLARAARG 61 NFVGIDPPDHTQLRGLVSQAFSPRVTAALEPRIGRLAEQLLDDIVAERGDKASCDLVGEF 121 AGPLSAIVIAELFGIPESDHTMIAEWAKALLGSRPAGELSIADEAAMQNTADLVRRAGEY 181 LVHHITERRARPQDDLTSRLATTEVDGKRLDDEEIVGVIGMFLIAGYLPASVLTANTVMA 241 LDEHPAALAEVRSDPALLPGAIEEVLRWRPPLVRDQRLTTRDADLGGRTVPAGSMVCVWL 301 ASAHRDPFRFENPDLFDIHRNAGRHLAFGKGIHYCLGAPLARLEARIAVETLLRRFERIE 361 IPRDESVEFHESIGVLGPVRLPTTLFARR SEQIDNO:21 CYP101A1 Pseudomonasputida UniprotAccessionNo.:P00183 >sp|P00183|CPXA_PSEPUCamphor5-monooxygenaseOS= PseudomonasputidaGN= camC PE= 1SV= 2 TTETIQSNANLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRCNGGHWIATRGQLIREAYED YRHFSSECPFIPREAGEAYDFIPTSMDPPEQRQFRALANQVVGMPVVDKLENRIQELACSLIESLRPQGQCNFTEDY AEPFPIRIFMLLAGLPEEDIPHLKYLTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPGTDAISIVANGQVNGR PITSDEAKRMCGLLLVGGLDTVVNFLSFSMEFLAKSPEHRQELIERPERIPAACEELLRRFSLVADGRILTSDYEFH GVQLKKGDQILLPQMLSGLDERENACPMHVDFSRQKVSHTTFGHGSHLCLGQHLARREIIVTLKEWLTRIPDFSIAP GAQIQHKSGIVSGVQALPLVWDPATTKAV SEQIDNO:22 Homosapiens CYP2D7 GenBankAccessionNo.:AAO49806 >gi|37901459|gb|AAO49806.1| cytochromeP450[Homosapiens] GLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ LRRRFGDVFNLQLAWTPVVVLNGLAAVREAMVTRGEDTADRPPAPTYQVLGFGPRSQGVI LSRYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFADQAGRPFRPNGLLDK AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLPHIPALAGKV LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKEKAKGSPESSFNDENLRIVVG NLFLAGMVTTLTTLAWGLLLMILHLDVQRGRRVSPGCSPIVGTHVCPVRVQQEIDDVIGQ VRRPEMGDQVHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSS VLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLL QHFSFSVAAGQPRPSHSRVVSFLVTPSPYELCAVPR SEQIDNO:23 Rattusnorvegicus CYPC27 GenBankAccessionNo.:AAB02287 >gi|1374714|gb|AAB02287.1| cytochromeP450[Rattusnorvegicus] AVLSRMRLRWALLDTRVMGHGLCPQGARAKAAIPAALRDHESTEGPGTGQDRPRLRSLAELPGPGTLRF LFQLFLRGYVLHLHELQALNKAKYGPMWTTTFGTRTNVNLASAPLLEQVMRQEGKYPIRDSMEQWKEHRD HKGLSYGIFITQGQQWYKLRHSLNQRMLKPAEAALYTDALNEVISDFIARLDQVRTESASGDQVPDVAHL LYHLALEAICYILFEKRVGCLEPSXPEDTATFIRSVGLMFKNSVYVTFLPKWSRPLLPFWKRYMNNWDNI FSFGEKMIHQKVQEIEAQLQAAGPDGVQVSGYLHFLLTKELLSPQETVGTFPELILAGVDTTSNTLTWAL YHLSKNPEIQEALHKEVTGVVPFGKVPQNKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGFL FPKNTQFVLCTYVVSRDPSVFPEPESFQPHRWLRKREDDNSGIQHPFGSVPFGYGVRSCLGRRIAELEMQ LLLSRLIQKYEWLSPGMGEVKSVSRIVLVPSKKVSLRFLQRQ SEQIDNO:24 CYP2B4 Oryctolaguscuniculus GenBankAccessionNo.AAA65840 >gi|164959|gb|AAA65840.1| cytochromeP-450[Oryctolaguscuniculus] MEFSLLLLLAFLAGLLLLLFRGHPKAHGRLPPGPSPLPVLGNLLQMDRKGLLRSFLRLRE KYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGER WRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNTIC SIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKHFPGTHRQIYRNLQE INTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGT ETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSKRPPALDDRAKMPYTDAVIHEIQRLG DLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGAL KRNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSTASPVPPEDIDLTPRESGVGNV PPSYQIRFLAR SEQIDNO:25 CYP102A2 Bacillussubtilis UniprotAccessionNo.O08394 >sp|O08394|CYPD_BACSUProbablebifunctionalP-450/NADPH-P450reductase1 OS= Bacillussubtilis(strain168)GN= cypDPE= 3SV= 1 MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV RALDEAMHQMQRLDVQDKLMVRTKRQFRHDIQTMFSLVDSIIAERRANGDQDEKDLLARM LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTNDRISVLI PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI LKYFTLIDHENYELDIKQTLTLKPGDFHIRVQSRNQDAIHADVQAVEKAASDEQKEKTEA KGTSVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHGVRTETAPLNDRIGKLPKEGAV VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL AAFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR YYSISSSPRVNPRQASITVGVVRGPAWSGRGEYRGVASNDLAERQAGDDVVMFIRTPESR FQLPKDPETPIIMVGPGTGVAPFRGFLQARDVLKREGKTLGEAHLYFGCRNDRDFIYRDE LERFEKDGIVTVHTAFSRKEGMPKTYVQHLMADQADTLISILDRGGRLYVCGDGSKMAPD VEAALQKAYQAVHGTGEQEAQNWLRHLQDTGMYAKDVWAGI SEQIDNO:26 CYP102A3 Bacillussubtilis UniprotAccessionNo.O08336 >sp|O08336|CYPE_BACSUProbablebifunctionalP-450/NADPH-P450reductase2 OS= Bacillussubtilis(strain168)GN= cypEPE= 2SV= 1 MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLV AEVCDESRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAKRILLPSFSQKAMKGYHSM MLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGFNYRFNSFYRDSQHPFITSML RALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLVDRMIAERKANPDDNIKDLLSLM LYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRV LTDDTPEYKQIQQLKYTRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLI PKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLV LKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQADIKAETKPKETKP KHGTPLLVLYGSNLGTAEGIAGELAAQGRQMGFTAETAPLDDYIGKLPEEGAVVIVTASY NGSPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGASR LTEIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSIAFLSEATETPVA KAYGAFEGVVLENRELQTADSTRSTRHIELETPAGKTYKEGDHIGIMPKNSRELVQRVLS RFGLQSNHVIKVSGSAHMSHLPMDRPIKVADLLSSYVELQEPASRLQLRELASYTVCPPH QKELEQLVLDDGIYKEQVLAKRLTMLDFLSDYPACEMPFERFLALLPSLKPRYYSISSSP KVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPDEPE TPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQE GLVTIRRCYSRVENESKGYVQHLLKQDSQKLMTLTEKGAHTYVCGDGSQMAPDVEKTLRW AYETEKGASQEESADWLQKLQDQKRYIKDVWTGN SEQIDNO:27 CYP102A1 B.megateriumDSM32 UniprotAccessionNo.P14779 >sp|P14779|CPXB_BACMEBifunctionalP-450/NADPH-P450reductaseOS= Bacillus megateriumGN= cyp102A1PE= 1SV= 2 1 MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIK 61 EACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMM 121 VDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR 181 ALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN 241 GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLV 301 DPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQ 361 LHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLK 421 HFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVRKKAENAHN 481 TPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGH 541 PPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENTAD 601 RGEADASDDFEGTYEEWREHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMH 661 GAFSTNVVASKELQQPGSARSTRHLEIELPKEASYQEGDHLGVIPRNYEGIVNRVTARFG 721 LDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKTVCPPHKVE 781 LEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDE 841 KQASITVSVVSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLI 901 MVGPGTGVAPFRGFVQARKQLKEQGQSLGEAHLYFGCRSPHEDYLYQEELENAQSEGIIT 961 LHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDGSQMAPAVEATLMKSYAD 1021 VHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:28 CYP102A5 B.cereusATCC14579 GenBankAccessionNo.AAP10153 >gi|29896875|gb|AAP10153.1| NADPH-cytochromeP450reductase[Bacilluscereus ATCC14579] 1 MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL 61 VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA 121 MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM 181 TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR 241 MLNVPDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR 301 VLTDPTPTYQQVMKLKYMRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV 361 LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG 421 MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLAPTEDKLKNDEIKQ 481 HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRTGSLPKE 541 GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID 601 EQMAQKGATRFSKRGEADASGDFEEQLEQWKQNMWSDAMKAFGLELNKNMEKERSTLSLQ 661 FVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLPV 721 NSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLALLSYSVEVQEAATRAQI 781 REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL 841 KPRYYSISSSPLVAHNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP 901 QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNLGQAHLYFGCRHPEKDYL 961 YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSK 1021 MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI SEQIDNO:29 CYP102A7 B.licheniformisATTC1458 GenBankAccessionNo.YP079990 >gi|52081199|ref|YP_079990.1| cytochromeP450/NADPH-ferrihemoprotein reductase[BacilluslicheniformisDSM13= ATCC14580] 1 MNKLDGIPIPKTYGPLGNLPLLDKNRVSQSLWKTADEMGPIFQFKFADAIGVFVSSHELV 61 KEVSEESRFDKNMGKGLLKVREFSGDGLFTSWTEEPNWRKAHNILLPSFSQKAMKGYHPM 121 MQDIAVQLTQKWSRLNQDESIDVPDDMTRLTLDTIGLCGFNYRFNSFYREGQHPFIESMV 181 RGLSEAMRQTKRFPLQDKLMIQTKRRFNSDVESMFSLVDRIIADRKQAESESGNDLLSLM 241 LHAKDPETGEKLDDENTRYQIITFLIAGHETTSGLLSFAIYLLLKHPDKLKKAYEEADRV 301 LTDPVPSYKQVQQLKYIRMILNESIRLWPTAPAFSLYAKEETVIGGKYLIPKGQSVTVLI 361 PKLHRDQSVWGEDAEAFRPERFEQMDSIPAHAYKPFGNGQRACIGMQFALHEATLVLGMI 421 LQYFDLEDHANYQLKIKESLTLKPDGFTIRVRPRKKEAMTAMPGAQPEENGRQEERPSAP 481 AAENTHGTPLLVLYGSNLGTAEEIAKELAEEAREQGFHSRTAELDQYAGAIPAEGAVIIV 541 TASYNGNPPDCAKEFVNWLSHDQTDDLRGVKYAVFGCGNRSWASTYQRIPRLIDSVLEKK 601 GAQRLHKLGEGDAGDDFEGQFESWKYDLWPLLRTEFSLAEPEPNQTETDRQALSVEFVNA 661 PAASPLAKAYQVFTAKISANRELQCEKSGRSTRHIEISLPEGAAYQEGDHLGVLPQNSEV 721 LIGRVFQRFGLNGNEQILISGRNQASHLPLERPVHVKDLFQHCVELQEPATRAQIRELAA 781 HTVCPPHQRELEDLLKDDVYKDQVLNKRLTMLDLLEQYPACELPFARFLALLPPLKPRYY 841 SISSSPQLNPRQTSITVSVVSGPALSGRGHYKGVASNYLAGLEPGDATSCFTREPQSGFR 901 LPEDPETPVIMVGPGTGIAPYRGFLQARRIQRDAGVKLGEAHLYFGCRRPNEDFLYRDEL 961 EQAEKDGIVHLHTAFSRLEGRPKTYVQDLLREDAALLIHLLNEGGRLYVCGDGSRMAPAV 1021 EQALCEAYRIVQGASREESQSWLSALLEEGRYAKDVWDGGVSQHNVKADCIART SEQIDNO:30 CYPX B.thuringiensisserovarkonkukian str.97-27 GenBankAccessionNo.YP037304 >gi|49480099|ref|YP_037304.1| NADPH-cytochromeP450reductase[Bacillus thuringiensisserovarkonkukianstr.97-27] 1 MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFQIQTLSDTIIVVSGHEL 61 VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQRAMKDYHA 121 MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM 181 TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSENQEENDLLSR 241 MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR 301 VLTDSTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV 361 LIPQLHRDKDAWGDDVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG 421 MLLQHFEFIDYEDYQLDVKQTLTLKPGDFKIRIVPRNQTISHTTVLAPTEEKLKKHEIKK 481 QVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRIGSLPKE 541 GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID 601 EQMAQKGATRFSTRGEADASGDFEEQLEQWKQSMWSDAMKAFGLELNKNMEKERSTLSLQ 661 FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI 721 NNEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI 781 REMVTFTACPPHKKELESLLEDGVYQEQILKKRISMLDLLEKYEACEIRFERFLELLPAL 841 KPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP 901 QSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMKVGEAHLYFGCRHPEKDYL 961 YRTELENDERDGLISLHTAFSRLEGHPKTYVQHVIKEDRIHLISLLDNGAHLYICGDGSK 1021 MAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQEEGRYGKDVWAGI SSQIDNO:31 CYP102E1 R.metalliduransCH34 GenBankAccessionNo.YP585608 >gi|94312398|ref|YP_585608.1| putativebifunctionalP-450:NADPH-P450 reductase2[CupriavidusmetalliduransCH34] 1 MSTATPAAALEPIPRDPGWPIFGNLFQITPGEVGQHLLARSRHHDGIFELDFAGKRVPFV 61 SSVALASELCDATRFRKIIGPPLSYLRDMAGDGLFTAKSDEPNWGCAHRILMPAFSQRAM 121 KAYFDVMLRVANRLVDKWDRQGPDADIAVADDMTRLTLDTIALAGFGYDFASFASDELDP 181 FVMAMVGALGEAMQKLTRLPIQDRFMGRAHRQAAEDIAYMRNLVDDVIRQRRVSPTSGMD 241 LLNLMLEARDPETDRRLDDANIRNQVITFLIAGHETTSGLLTFALYELLRNPGVLAQAYA 301 EVDTVLPGDALPVYADLARMPVLDRVLKETLRLWPTAPAFAVAPFDDVVLGGRYRLRKDR 361 RISVVLTALHRDPKVWANPERFDIDRFLPENEAKLPAHAYMPFGQGERACIGRQFALTEA 421 KLALALMLRNFAFQDPHDYQFRLKETLTIKPDQFVLRVRRRRPHERFVTRQASQAVADAA 481 QTDVRGHGQAMTVLCASSLGTARELAEQIHAGAIAAGFDAKLADLDDAVGVLPTSGLVVV 541 VAATYNGRAPDSARKFEAMLDADDASGYRANGMRLALLGCGNSQWATYQAFPRRVFDFFI 601 TAGAVPLLPRGEADGNGDFDQAAERWLAQLWQALQADGAGTGGLGVDVQVRSMAAIRAET 661 LPAGTQAFTVLSNDELVGDPSGLWDFSIEAPRTSTRDIRLQLPPGITYRTGDHIAVWPQN 721 DAQLVSELCERLDLDPDAQATISAPHGMGRGLPIDQALPVRQLLTHFIELQDVVSRQTLR 781 ALAQATRCPFTKQSIEQLASDDAEHGYATKVVARRLGILDVLVEHPAIALTLQELLACTV 841 PMRPRLYSIASSPLVSPDVATLLVGTVCAPALSGRGQFRGVASTWLQHLPPGARVSASIR 901 TPNPPFAPDPDPAAPMLLIGPGTGIAPFRGFLEERALRKMAGNAVTPAQLYFGCRHPQHD 961 WLYREDIERWAGQGVVEVHPAYSVVPDAPRYVQDLLWQRREQVWAQVRDGATIYVCGDGR 1021 RMAPAVRQTLIEIGMAQGGMTDKAASDWFGGLVAQGRYRQDVFN SEQIDNO:32 CYP505X A.fumigatusAf293 GenBankAccessionNo.EAL92660 >gi|66852335|gb|EAL92660.1| P450familyfattyacidhydroxylase,putative [AspergillusfumigatusAf293] 1 MSESKTVPIPGPRGVPLLGNIYDIEQEVPLRSINLMADQYGPIYRLTTFGWSRVFVSTHE 61 LVDEVCDEERFTKVVTAGLNQIRNGVHDGLFTANFPGEENWAIAHRVLVPAFGPLSIRGM 121 FDEMYDIATQLVMKWARHGPTVPIMVTDDFTRLTLDTIALCAMGTRFNSFYHEEMHPFVE 181 AMVGLLQGSGDRARRPALLNNLPTSENSKYWDDIAFLRNLAQELVEARRKNPEDKKDLLN 241 ALILGRDPKTGKGLTDESIIDNMITFLIAGHETTSGLLSFLFYYLLKTPNAYKKAQEEVD 301 SVVGRRKITVEDMSRLPYLNAVMRETLRLRSTAPLIAVHAHPEKNKEDPVTLGGGKYVLN 361 KDEPIVIILDKLHRDPQVYGPDAEEFKPERMLDENFEKLPKNAWKPFGNGMRACIGRPFA 421 WQEALLVVAILLQNFNFQMDDPSYNLHIKQTLTIKPKDFHMRATLRHGLDATKLGIALSG 481 SADRAPPESSGAASRVRKQATPPAGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFAAD 541 VQSLDSAMQNVPKDEPVVFITASYEGQPPDNAAHFFEWLSALKENELEGVNYAVFGCGHH 601 DWQATFHRIPKAVNQLVAEHGGNRLCDLGLADAANSDMFTDFDSWGESTFWPAITSKFGG 661 GKSDEPKPSSSLQVEVSTGMRASTLGLQLQEGLVIDNQLLSAPDVPAKRMIRFKLPSDMS 721 YRCGDYLAVLPVNPTSVVRRAIRRFDLPWDAMLTIRKPSQAPKGSTSIPLDTPISAFELL 781 STYVELSQPASKRDLTALADAAITDADAQAELRYLASSPTRFTEEIVKKRMSPLDLLIRY 841 PSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECSITFSVLNAPALAAASLPPAERAEA 901 EQYMGVASTYLSELKPGERAHIAVRPSHSGFKPPMDLKAPMIMACAGSGLAPFRGFIMDR 961 AEKIRGRRSSVGADGQLPEVEQPAKAILYVGCRTKGKDDIHATELAEWAQLGAVDVRWAY 1021 SRPEDGSKGRHVQDLMLEDREELVSLFDQGARIYVCGSTGVGNGVRQACKDIYLERRRQL 1081 RQAARERGEEVPAEEDEDAAAEQFLDNLRTKERYATDVFT SEQIDNO:33 CYP505A8 A.nidulansFGSCA4 GenBankAccessionNo.EAA58234 >gi|40739044|gb|EAA58234.1| hypotheticalproteinAN6835.2[Aspergillus nidulansFGSCA4] 1 MAEIPEPKGLPLIGNIGTXDQEFPLGSMVALAEEHGEIYRLRFPGRTVVVVSTHALVNET 61 CDEKRFRKSVNSALAHVREGVHDGLFTAKMGEVNWEIAHRVLMPAFGPLSIRGMFDEMHD 121 IASQLALKWARYGPECPIMVTDDFTRLTLDTLALCSMGYRFNSYYSPVLHPFIEAMGDFL 181 TEAGEKPRRPPLPAVFFRNRDQKFQDDIAVLRDTAQGVLQARKEGKSDRNDLLSAMLRGV 241 DSQTGQKMTDESIMDNLITFLIAGHETTSGLLSFVFYQLLKHPETYRTAQQEVDNVVGQG 301 VIEVSHLSKLPYINSVLRETLRLNATTPLFTVEAFEDTLLAGKYPVKAGETIVNLLAKSH 361 LDPEVYGEDALEFKPERKSDELFNARLKQFPSAWKPFGNGMRACIGRPFAWQEALLVMAM 421 LLQNFDFSLADPNYDLKFKQTLTIKPKDMFMKARLRHGLTPTTLERRLAGLAVESATQDK 481 IVTNPADNSVTGTRLTILYGSNSGTCETLARRIAADAPSKGFHVMRFDGLDSGRSALPTD 541 HPVVTVTSSYEGQPPENAKQFVSWLEELEQQNESLQLKGVDFAVFGCFKEWAQTFHRIPK 601 LVDSLLEKLGGSRLTDLGLADVSTDELFSTFETWADDVLWPRLVAQYGADGKTQAHGSSA 661 GHEAASNAAVEVTVSNSRTQALRQDVGQAMVVETRLLTAESEKERRKKHLETRLPDGVSY 721 TAGDYLAVLPINPPETVRRAMRQFKLSWDAQITIAPSGPTTALPTDGPIAANDIFSTYVE 781 LSQPATRKDLRIMADATTDPDVQKILRTYANETYTAEILTKSISVLDILEQHPAIDLPLG 841 TFLLMLPSMRMRQYSISSSPLLTPTTATTTISVLDAPSRSRSNGSRHLGVATSYLDSLSV 901 GDHLQVTVRKNPSSGFRLPSEPETTPMICIAAGSGIAPFRAFLQERAVMMEQDKDRKLAP 961 ALLFFGCRAPGIDDLYREQLEEWQARGVVDARWAFSRQSDDTKGCRHVDDRTLADREDVV 1021 KLWRDGARVYVCGSGALAQSVRSAMVTVLRDEMETTGDGSDNGKAEKWFDEQRNVRYVMD 1081 VFD SEQIDNO:34 CYP505A3 A.oryzaeATCC42149 UniprotAccessionNo.Q2U4F1 >qi|121928062|sp|Q2U4F1|Q2U4F1_ASPORCytochromeP450 1 MRQNDNEKQICPIPGPQGLPFLGNILDIDLDNGTMSTLKIAKTYYPIFKFTFAGETSIVI 61 NSVALLSELCDETRFHKHVSFGLELLRSGTHDGLFTAYDHEKNWELAHRLLVPAFGPLRI 121 REMFPQMHDIAQQLCLKWQRYGPRRPLNLVDDFTRTTLDTIALCAMGYRFNSFYSEGDFH 181 PFIKSMVRFLKEAETQATLPSFISNLRVRAKRRTQLDIDLMRTVCREIVTERRQTNLDHK 241 NDLLDTMLTSRDSLSGDALSDESIIDNILTFLVAGHETTSGLLSFAVYYLLTTPDAMAKA 301 AHEVDDVVGDQELTIEHLSMLKYLNAILRETLRLMPTAPGFSVTPYKPEIIGGKYEVKPG 361 DSLDVFLAAVHRDPAVYGSDADEFRPERMSDEHFQKLPANSWKPFGNGKRSCIGRAFAWQ 421 EALMILALILQSFSLNLVDRGYTLKLKESLTIKPDNLWAYATPRPGRNVLHTRLALQTNS 481 THPEGLMSLKHETVESQPATILYGSNSGTCEALAHRLAIEMSSKGRFVCKVQPMDAISHR 541 RLPRGQPVIIITGSYDGRPPENARHFVKWLQSLKGNDLEGIQYAVFGCGLPGHHDWSTTF 601 YKIPTLIDTIMAEHGGARLAPRGSADTAEDDPFAELESWSERSVWPGLEAAFDLVRHNSS 661 DGTGKSTRITIRSPYTLRAAHETAVVHQVRVLTSAETTKKVHVELALPDTINYRPGDHLA 721 ILPLNSRQSVQRVLSLFQIGSDTILYMTSSSATSLPTDTPISAHDLLSGYVELNQVATPT 781 SLRSLAAKATDEKTAEYLEALATDRYTTEVRGNHLSLLDILESYSVPSIEIQKYIQMLPL 841 LRPRQYTISSSPRLNRGQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQ 901 ANPDFRLPDESCSHPIIMVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLD 961 DLYREELDAFEEQGVVTLFRAFSRAQSESHGCKYVQDLLWMERVRVKTLWGQDAKVFVCG 1021 SVRMNEGVKAIISKIVSPTPTEELARRYIAETFI SEQIDNO:35 CYPX A.oryzaeATCC42149 UniprotAccessionNo.Q2UNA2 >gi|121938553|sp|Q2UNA2|Q2UNA2_ASPORCytochromeP450 1 MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGPIYRLTTFGFSRCKISS 61 HELAAEVFDEERFTKKIMAGLSELRHGIHDGLFTAHMGEENWEIAHRVLMPAFGPLNIQN 121 MFDEMHDIATQLVMKWARQGPKQKIMVTDDFTRLTLDTTALCAMGTRFNSFYSEEMHPFV 181 DAMVGMLKTAGDRSRRPGLVNNLPTTENNKYWEDIDYLRNLCKELVDTRKKNPTDKKDLL 241 NALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTSGSLSFAFYNMLKNPQAYQKAQEEV 301 DRVIGRRRITVEBLQKLPYITAVMRETLRLTPTAPAIAVGPHPTKNHEDPVTLGNGKYVL 361 GKDEPCALLLGKIQRDPKVYGPDAEEFKPERMLDEHFNKLPKHAWKPFGNGMRACTGRPF 421 AWQEALLVIAMLLQNFNFQMDDPSYNIQLKQTLTIKPNHFYMRAALREGLDAVHLGSALS 481 ASSSEHADHAAGHGKAGAAKKGADLKPMHVYYGSNTGTCEAFARRLADDATSYGYSAEVE 541 SLDSAKDSIPKNGPVVFITASYEGQPPDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHD 601 WQTTFYRIPKEVNRLVGENGANRLCEIGLADTANADIVTDFDTWGETSFWPAVAAKFGSN 661 TQGSQKSSTFRVEVSSGHRATTLGLQLQEGLVVENTLLTQAGVPAKRTIRFKLPTDTQYK 721 CGDYLAILPVNPSTVVRKVMSRFDLPWDAVLRIEKASPSSSKHISIPMDTQVSAYDLFAT 781 YVELSQPASKRDLAVLADAAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPST 841 NLAIGDFVAMLPPMRVRQYSISSSPLVDPTECSITFSVLKAPSLAALTKEDEYLGVASTY 901 LSELRSGERVQLSVRPSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRAEKIRGRRSS 961 GSMPEQPAKAILYAGCRTQGKDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLM 1021 MEDKKELIDLFESGARIYVCGTPGVGNAVRDSIKSMFLERREEIRRIAKEKGEPVSDDDE 1081 ETAFEKFLDDMKTKERYTTDIFA SEQIDNO:36 CYP505A1 F.oxysporum UniprotAccessionNo.Q9Y8G7 >gi|22653677|sp|Q9Y8G7.1|C505_FUSOXRecName:Full= BifunctionalP-450:NADPH- P450reductase;AltName:Full= CytochromeP450foxy;AltName:Full= Fattyacid omega-hydroxylase;Includes:RecName:Full= CytochromeP450505;Includes: RecName:Full= NADPH--cytochromeP450reductase 1 maesvpipeppgyplignlgeftsnplsdlnrladtygpifrlrlgakapifvssnslin 61 evcdekrfkktlksvlsqvregvhdglftafedepnwgkahrilvpafgplsirgmfpem 121 hdiatqlcmkfarhgprtpidtsdnftrlaldtlalcamdfrfysyykeelhpfieamgd 181 fltesgnrnrrppfapnflyraanekfygdialmksvadevvaarkaspsdrkdllaaml 241 ngvdpqtgeklsdenitnqlitfliaghettsgtlsfamyqllknpeayskvqkevdevv 301 grgpvlvehltklpyisavlretlrlnspitafgleaiddtflggkylvkkgeivtalls 361 rghvdpvvygndadkfipermlddefarlnkeypncwkpfgngkracigrpfawqeslla 421 mvvlfqnfnftmtdpnyaleikqtltikpdhfyinatlrhgmtptelehvlagngatsss 481 thnikaaanldakagsgkpmaifygsnsgtcealanrlasdapshgfsattvgpldqakq 541 nlpedrpvvivtasyegqppsnaahfikwmedldgndmekvsyavfacghhdwvetfhri 601 pklvdstlekrggtrlvpmgsadaatsamfsdfeawedivlwpglkekykisdeesggqk 661 gllvevstprktslrqdveealvvaektltksgpakkhieiqlpsamtykagdylailpl 721 npkstvarvfrrfslawdsflkiqscgpttlptnvaisafdvfsayvelsqpatkrnila 781 laeatedkdtiqelerlagdayqaeispkrvsvldllekfpavalpissylamlppmrvr 841 qysissspfadpskltltyslldapslsgqgrhvgvatnflshltagdklhvsvrassea 901 fhlpsdaektpiicvaagtglaplrgfiqeraamlaagrtlapallffgcrnpeiddlya 961 eeferwekmgavdvrraysratdksegckyvqdrvyhdradvfkvwdqgakvficgsrei 1021 gkavedvcvrlaiekaqqngrdvteemarawfersrnerfatdvfd SEQIDNO:37 CYPX G.moniliformis GenBankAccessionNo.AAG27132 >gi|11035011|gb|AAG27132.1| Fum6p[Fusariumverticillioides] 1 MSATALFTRRSVSTSNPELRPIPGPKPLPLLGNLFDFDFDNLTKSLGELGKIHGPIYSIT 61 FGASTEIMVTSREIAQELCDETRFCKLPGGALDVMKAVVGDGLFTAETSNPKWAIAHRII 121 TPLFGAMRIRGMFDDMKDICEQMCLRWARFGPDEPLNVCDNMTKLTLDTIALCTIDYRFN 181 SFYRENGAAHPFAEAVVDVMTESFDQSNLPDFVNNYVRFRAMAKFKRQAAELRRQTEELI 241 AARRQNPVDRDDLLNAMLSAKDPKTGEGLSPESIVDNLLTFLIAGHETTSSLLSFCFYYL 301 LENPHVLRRVQQEVDTVVGSDTITVDHLSSMPYLEAVLRETLRLRDPGPGFYVKPLKDEV 361 VAGKYAVNKDQPLFIVFDSVHRDQSTYGADADEFRPERMLKDGFDKLPPCAWKPFGNGVR 421 ACVGRPFAMQQAILAVAMVLHKFDLVKDESYTLKYHVTMTVRPVGFTMKVRLRQGQRATD 481 LAMGLHRGHSQEASAAASPSRASLKRLSSDVNGDDTDHKSQTAVLYASNSGSCEALAYRL 541 AAEATERGFGIRAVDVVNNAIDRIPVGSPVILITASYNGEPADDAQEFVPWLKSLESGRL 601 NGVKFAVFGNGHRDWANTLFAVPRLIDSELARCGAERVSLMGVSDTCDSSDPFSDFERWI 661 DEKLFPELETPHGPGGVKNGDRAVPRQELQVSLGQPPRTTMRKGYVRAIVTEARSLSSPG 721 VPEKRHLELLLPKDFNYKAGDHVYILPRNSPRDVVRALSYFGLGEDTLITIRNTARKLSL 781 GLPLDTPITATDLLGAYVELGRTASLKNLWTLVDAAGHGSRAALLSLTEPERFRAEVQDR 841 HVSILDLLERFPDIDLSLSCFLPMLAQIRPRAYSFSSAPDWKPGHATLTYTVVDFATPAT 901 QGINGSSKSKAVGDGTAVVQRQGLASSYLSSLGPGTSLYVSLHRASPYFCLQKSTSLPVI 961 MVGAGTGLAPFRAFLQERRMAAEGAKQRFGPALLFFGCRGPRLDSLYSVELSAYETIGLV 1021 QVRRAYSRDPSAQDAQGCKYVTDRLGKCRDEVARLWMDGAQVLVCGGKKMANDVLEVLGP 1081 MLLEIDQKRGETTAKTVVEWRARLDKSRYVESVYV SEQIDNO:38 CYP505A7 G.zeaePH1 GenBankAccessionNo.EAA67736 >gi|42544893|gb|EAA67736.1| C505_FUSOXBifunctionalP-450:NADPH-P450 reductase(Fattyacidomega-hydroxylase)(P450foxy)[GibberellazeaePH-1] 1 MAESVPIPEPPGYPLIGNLGEFKTNPLNDLNRLADTYGPIFRLHLGSKTPTFVSSNAFIN 61 EVCDEKRFKKTLKSVLSVVREGVHDGLFTAFEDEPNWGKAHRILIPAFGPLSIRNMFPEM 121 HEIANQLCMKLARHGPHTPVDASDNFTRLALDTLALCAMDFRFNSYYKEELHPFIEAMGD 181 FLLESGNRNRRPAFAPNFLYRAANDKFYADIALMKSVADEVVATRKQNPTDRKDLLAAML 241 EGVDPQTGEKLSDDNITNQLITFLIAGHETTSGTLSFAMYHLLKNPEAYNKLQKEIDEVI 301 GRDPVTVEHLTKLPYLSAVLRETLRISSPITGFGVEAIEDTFLGGKYLIKKGETVLSVLS 361 RGHVDPVVYGPDAEKFVPERMLDDEFARLNKEFPNCWKPFGNGKRACIGRPFAWQESLLA 421 MALLFQNFNFTQTDPNYELQIKQNLTIKPDNFFFNCTLRHGMTPTDLEGQLAGKGATTSI 481 ASHIKAPAASKGAKASNGKPMAIYYGSNSGTCEALANRLASDAAGHGFSASVIGTLDQAK 541 QNLPEDRPVVIVTASYEGQPPSNAAHFIKWMEDLAGNEMEKVSYAVFGCGHHDWVDTFLR 601 IPKLVDTTLEQRGGTRLVPMGSADAATSDMFSDFEAWEDTVLWPSLKEKYNVTDDEASGQ 661 RGLLVEVTTPRKTTLRQDVEEALVVSEKTLTKTGPAKKHIEIQLPSGMTYKAGDYLAILP 721 LNPRKTVSRVFRRFSLAWDSFLKIQSDGPTTLPINIAISAFDVFSAYVELSQPATKRNIL 781 ALSEATEDKATIQELEKLAGDAYQEDVSAKKVSVLDLLEKYPAVALPISSYLAMLPPMRV 841 RQYSISSSPFADPSKLTLTYSLLDAPSLSGQGRHVGVATNFLSQLIAGDKLHISVRASSA 901 AFHLPSDPETTPIICVAAGTGLAPFRGFIQERAAMLAAGRKLAPALLFFGCRDPENDDLY 961 AEELARWEQMGAVDVRRAYSRATDKSEGCKYVQDRIYHDRADVFKVWDQGAKVFICGSRE 1021 IGKAVEDICVRLAMERSEATQEGKGATEEKAREWFERSRNERFATDVFD SEQIDNO:39 CYP505C2 G.zeaePH1a GenBankAccessionNo.EAA77183 >gi|42554340|gb|EAA77183.1| hypotheticalproteinFG07596.1[Gibberellazeae PH-1] 1 MAIKDGGKKSGQIPGPKGLPVLGNLFDLDLSDSLTSLINIGQKYAPIFSLELGGHREVMI 61 CSRDLLDELCDETRFHKIVTGGVDKLRPLAGDGLFTAQHGNHDWGIAHRILMPLFGPLKI 121 REMFDDMQDVSEQLCLKWARLGPSATIDVANDFTRLTLDTIALCTMGYRFNSFYSNDKMH 181 PFVDSMVAALIDADKQSMFPDFIGACRVKALSAFRKHAAIMKGTCNELIQERRKNPIEGT 241 DLLTAMMEGKDPKTGEGMSDDLIVQNLITFLIAGHETTSGLLSFAFYYLLENPHTLEKAR 301 AEVDEVVGDQALNVDHLTKMPYVNMILRETLRLMPTAPGFFVTPHKDEIIGGKYAVPANE 361 SLFCFLHLIHRDPKVWGADAEEFRPERMADEFFEALPKNAWKPFGNGMRGCIGREFAWQE 421 AKLITVMILQNFELSKADPSYKLKIKQSLTIKPDGFNMHAKLRNDRKVSGLFKAPSLSSQ 481 QPSLSSRQSINAINAKDLKPISIFYGSNTGTCEALAQKLSADCVASGFMPSKPLPLDMAT 541 KNLSKDGPNILLAASYDGRPSDNAEEFTKWAESLKPGELEGVQFAVFGCGHKDWVSTYFK 601 IPKILDKCLADAGAERLVEIGLTDASTGRLYSDFDDWENQKLFTELSKRQGVTPTDDSHL 661 ELNVTVIQPQNNDMGGNFKRAEVVENTLLTYPGVSRKHSLLLKLPKDMEYTPGDHVLVLP 721 KNPPQLVEQAMSCFGVDSDTALTISSKRPTFLPTDTPILISSLLSSLVELSQTVSRTSLK 781 RLADFADDDDTKACVERIAGDDYTVEVEEQRMSLLDILRKYPGINMPLSTFLSMLPQMRP 841 RTYSFASAPEWKQGHGMLLFSVVEAEEGTVSRPGGLATNYMAQLRQGDSILVEPRPCRPE 901 LRTTMMLPEPKVPIIMIAVGAGLAPFLGYLQKRFLQAQSQRTALPPCTLLFGCRGAKMDD 961 ICRAQLDEYSRAGVVSVHRAYSRDPDSQCKYVQGLVTKHSETLAKQWAQGAIVMVCSGKK 1021 VSDGVMNVLSPILFAEEKRSGMTGADSVDVWRQNVPKERMILEVFG SEQIDNO:40 CYP505A5 M.grisea70-15syn GenBankAccessionNo.XP365223 >gi|145601517|ref|XP_365223.2| hypotheticalproteinMGG_01925[Magnaporthe oryzae70-15] 1 MFFLSSSLAYMAATQSRDWASFGVSLPSTALGRHLQAAMPFLSEENHKSQGTVLIPDAQG 61 PIPFLGSVPLVDPELPSQSLQRLARQYGEIYRFVIPGRQSPILVSTHALVNELCDEKRFK 121 KKVAAALLGLREAIHDGLFTAHNDEPNWGIAHRILMPAFGPMAIKGMFDEMHDVASQMTL 181 KWARHGSTTPIMVSDDFTRLTLDTIALCSMGYRFNSFYHDSMHEFIEAMTCWMKESGNKT 241 RRLLPDVFYRTTDKKWHDDAEILRRTADEVLKARKENPSGRKDLLTAMIEGVDPKTGGKL 301 SDSSIIDNLITFLIAGHETTSGMLSFAFYLLLKNPTAYRKAQQEIDDLCGREPITVEHLS 361 KMPYITAVLRETLRLYSTIPAFVVEAIEDTVVGGKYAIPKNHPIFLMIAESHRDPKVYGD 421 DAQEFEPERMLDGQFERRNREFPNSWKPFGNGMRGCIGRAFAWQEALLITAMLLQNFNFV 481 MHDPAYQLSIKENLTLKPDNFYMRAILRHGKSPTELERSISGVAPTGNKTPPRNATRTSS 541 PDPEDGGIPMSIYYGSNSGTCESLAHKLAVDASAQGFKAETVDVLDAANQKLPAGNRGPV 601 VLITASYEGLPPDNAKHFVEWLENLKGGDELVDTSYAVFGCGHQDWTKTFKRIPKLVDEK 661 LAEHGAVRLAPLGLSNAAHGDMFVDFETWEFETLWPALADRYKTGAGRQDAAATDLTAAL 721 SQLSVEVSHPRAADLRQDVGEAVVVAARDLTAPGAPPKRHMEIRLPKTGGRVHYSAGDYL 781 AVLPVNPKSTVERAMRRFGLAWDAHVTIRSGGRTTLPTGAPVSAREVLSSYVELTQPATK 841 RGIAVLAGAVTGGPAAEQEQAKAALLDLAGDSYALEVSAKRVGVLDLLERFPACAVPFGT 901 FLALLPPMRVRQYSISSSPLWNDEHATLTYSVLSAPSLADPARTHVGVASSYLAGLGEGD 961 HLHVALRPSHVAFRLPSPETPVVCVCAGSGMAPFRAFAQERAALVGAGRKVAPLLLFFGC 1021 REPGVDDLYREELEGWEAKGVLSVRRAYSRRTEQSEGCRYVQDRLLKNRAEVKSLWSQDA 1081 KVFVCGSREVAEGVKEAMFKVVAGKEGSSEEVQAWYEEVRNVRYASDIFD SEQIDNO:41 CYP505A2 N.crassaOR74A GenBankAccessionNo.XP961848 >gi|85104987|ref|XP_961848.1| bifunctionalP-450:NADPH-P450reductase [NeurosporacrassaOR74A] 1 MSSDETPQTIPIPGPPGLPLVGNSFDIDTEFPLGSMLNFADQYGEIFRLNFPGRNTVFVT 61 SQALVHELCDEKRFQKTVNSALHEIRHGIHDGLFTARNDEPNWGIAHRILMPAFGPMAIQ 121 NMFPEMHEIASQLALKWARHGPNQSIKVTDDFTRLTLDTIALCSMDYRFNSYYHDDMHPF 181 IDAMASFLVESGNRSRRPALPAFMYSKVDRKFYDDIRVLRETAEGVLKSRKEHPSERKDL 241 LTAMLDGVDPKTGGKLSDDSIIDNLITFLIAGHETTSGLLSFAFVQLLKNPETYRKAQKE 301 VDDVCGKGPIKLEHMNKLHYIAAVLRETLRLCPTIPVIGVESKEDTVIGGKYEVSKGQPF 361 ALLFAKSHVDPAVYGDTANDFDPERMLDENFERLNKEFPDCWKPFGNGMRACIGRPFAWQ 421 EALLVMAVCLQNFNFMPEDPNYTLQYKQTLTTKPKGFYMRAMLRDGMSALDLERRLKGEL 481 VAPKPTAQGPVSGQPKKSGEGKPISIYYGSNTGTCETFAQRLASDAEAHGFTATIIDSLD 541 AANQNLPKDRPVVFITASYEGQPPDNAALFVGWLESLTGNELEGVQYAVFGCGHHDWAQT 601 FHRIPKLVDNTVSERGGDRICSLGLADAGKGEMFTEFSQWEDEVFWPAMEEKYEVSRKED 661 DNEALLQSGLTVNFSKPRSSTLRQDVQEAVVVDAKTITAPGAPPKRHIEVQLSSDSGAYR 721 SGDYLAVLPINPKETVNRVMRRFQLAWDTNITIEASRQTTILPTGVPMPVHDVLGAYVEL 781 SQPATKKNILALAEAADNAETKATLRQLAGPEYTEKITSRRVSILDLLEQFPSIPLPFSS 841 FLSLLPPMRVRQYSISSSPLWNPSHVTLTYSLLESPSLSNPDKKHVGVATSYLASLEAGD 901 KLNVSIRPSHKAFHLPVDADKTPLIMIAAGSGLAPFRGFVQERAAQIAAGRSLAPAMLFY 961 GCRHPEQDDLYRDEFDKWESIGAVSVRRAFSRCPESQETKGCKYVGDRLWEDREEVTGLW 1021 DRGAKVYVCGSREVGESVKKVVVRIALERQKMIVEAREKGELDSLPEGIVEGLKLKGLTV 1081 EDVEVSEERALKWFEGIRNERYATDVFD SEQIDNO:42 CYP97C Oryzasativa GenBankAccessionNo.ABB47954 >gi|78708979|gb|ABB47954.1| CytochromeP450familyprotein,expressed[Oryza sativaJaponicaGroup] 1 MAAAAAAAVPCVPFLCPPPPPLVSPRLRRGHVRLRLRPPRSSGGGGGGGAGGDEPPITTS 61 WVSPDWLTALSRSVATRLGGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYR 121 LAAGPRDLVVVSDPAVARHVLRGYGSRYEKGLVAEVSEFLFGSGFAIAEGALWTVRRRSV 181 VPSLHKRFLSVMVDRVFCKCAERLVEKLETSALSGKPVNMEARFSQMTLDVIGLSLFNYN 241 FDSLTSDSPVIDAVYTALKEAELRSTDLLPYWKIDLLCKIVPRQIKAEKAVNIIRNTVED 301 LITKCKKIVDAENEQIEGEEYVNEADPSILRFLLASREEVTSVQLRDDLLSMLVAGHETT 361 GSVLTWTIYLLSKDPAALRRAQAEVDRVLQGRLPRYEDLKELKYLMRCINESMRLYPHPP 421 VLIRRAIVDDVLPGNYKIKAGQDIMISVYNIHRSPEVWDRADDFIPERFDLEGPVPNETN 481 TEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIELVPDQKINMTTGATIHTTNGL 541 YMNVSLRKVDREPDFALSGSR SEQIDNO:43 ChimerichemeenzymeC2G9 MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELVKEVCDEERFDKSIEGAL EKVRAFSGDGLATSWTHEPNWRKAHNILMPTFSQRAMKDYHEKMVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDT IGLCGFNYRFNSYYRETPHPFINSMVRALDEAMHQMQRLDVQDKLMVRTKRQFRYDTQTMFSLVDRMIAERKANPDE NIKDLLSLMLYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSY KQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPERFEDP SSIPHHAYKPFGNGQRACIGMQFALHEATLVLGMILKYFTLIDHENYELDIKQTLTLKPGDFHISVQSRHQEAIHAD VQAAE SEQIDNO:44 ChimerichemeenzymeX7 MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIWSGHELVKEVCDEERFDKSIEGAL EKVRAFSGDGLATSWTHEPNWRKAHNILMPTFSQRAMKDYHEKMVDIATQLIQKWSRLNPNEEIDVADDMTRLTLDT IGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDSIIAERRANGDQ DEKDLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRVLTDDTPEY KQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPERFEDP SSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLVLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQ RKEQA SEQIDNO:45 ChimerichemeenzymeX7-12 MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDEERFDKSIEGALE KVRAFSGDGLATSWTHEPNWRKAHNILMPTFSQRAMKDYHEKMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTI GLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDSIIAERRANGDQD EKDLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRVLTDDTPEYK QIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPERFEDPS SIPHHAYKPFGNGQRACIGMQFALQEATMVLGLVLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQR KEQA SEQIDNO:46 ChimerichemeenzymeC2E6 MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALK FVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTI GLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDRMIAERKANPDEN IKDLLSLMLYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRVLTDDTPEYK QIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPS AIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPS PST SEQIDNO:47 ChimerichemeenzymeX7-9 MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLVAEVCDEERFDKSIEGAL EKVRAFSGDGLATSWTHEPNWRKAHNILMPTFSQRAMKDYHEKMVDIATQLIQKWSRLNPNEEIDVADDMTRLTLDT IGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDSIIAERRANGDQ DEKDLLARMLNVEDPETGEKLDDFNTRFQTITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRVLTDDTPEY KQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPSRFEDP SSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLVLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQ RKEQA SEQIDNO:48 ChimerichemeenzymeC2B12 MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLVAEVCDEERFDKSIEGAL EKVRAFSGDGLATSWTHEPNWRKAHNILMPTFSQRAMKDYHEKMVDIATQLIQKWSRLNPNEEIDVADDMTRLTLDT IGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDRMIAERKANPDE NIKDLLSLMLYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRVLTDAAPTY KQVLELTYIRMILNESLRLWPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPERFEDP SSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLVLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQ RKEQA SEQIDNO:49 ChimerichemeenzymeTSP234 MKETSPIPQPKTFGPLCNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSCHELVKEVCDEERFDKSIEGAL EKVRAFSGDGLATSWTHEPNWRKAHNILMPTFSQRAMKDYHEKMVDIATQLIQKWSRLNPNEEIDVADDMTRLTLDT IGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDRMIAERKANPDE NIKDLLSLMLYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRVLTDDTPEY KQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPERFEDP SSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLVLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQ RKEQA SEQIDNO:50 WT-AxA(heme) TIKEMPQPKTFGELKNLPLLNTDKPVQALKKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF VRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSD DLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQV KQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAI PQHAFKPFGNGQRAAIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPS T SEQIDNO:51 WT-AxD(heme) TTKFMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF VRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSD DLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEFAARVLVDPVPSYKQV KQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAI PQHAFKPFGNGQRADIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPS T SEQIDNO:52 WT-AxH(heme) TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF VRDFAGDGLFTSWTHEKNWKKAKNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSD DLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQV KQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLSKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAI PQHAFKPFGNGQRAHIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPS T SEQIDNO:53 WT-AxK(heme) TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF VRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSD DLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQV KQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAI PQHAFKPFGNGQRAKIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPS T SEQIDNO:54 WT-AxM(heme) TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF VRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSD DLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQV KQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAI PQHAFKPFGNGQRAMIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPS T SEQIDNO:55 WT-AxN(heme) TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF VRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSD DLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQV KQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAI PQHAFKPFGNGQRANIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPS T SEQIDNO:56 BM3-CIS-T438S-AXA TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF ARDFAGDGLVTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVSEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFIISMVRALDEVMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDIIADRKARGEQSDD LLTQMLNGKDPETGEPLDDGNIRYQIITFLIAGHEATSGLLSFALYFLVKNPHVLQKVAEEAARVLVDPVPSYKQVK QLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDEVMVLIPQLHRDKTVWGDDVEEFRPERFENPSAIP QHAFKPFGNGQRAAIGQQFALHEATLVLGKMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPST EQSAKKVRKKAENAHNTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHP PDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWR EHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSTNVVASKELQQPGSARSTRHLEIELPKEASY QEGDHLGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKT VCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDEKQASITVSV VSGEAWSGYGEYKGIASNYLAE1QEGDTITCFISTPQSEFTLPKDPETPLIMVGPGTGVAPFRGFVQARKQLKEQGQ SLGEAHLYFGCRSPHEDYLYQEELENAQSEGIITLHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDG SQMAPAVEATLMKSYADVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:57 BM3-CIS-T438S-AxD TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF ARDFAGDGLVTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVSEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFIISMVRALDEVMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDIIADRKARGEQSDD LLTQMLNGKDPETGEPLDDGNIRYQIITFLIAGHEATSGLLSFALYFLVKNPHVLQKVAEEAARVLVDPVPSYKQVK QLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDEVMVLIPQLHRDKTVWGDDVEEFRPERFENPSAIP QHAFKPFGNGQRADIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPST EQSAKKVRKKAENAHNTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHP PDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDFTLAAKGAENIADRGEADASDDFEGTYESWR EHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSTNVVASKELQQPGSARSTRHLEIELPKEASY QEGDHLGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKT VCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDEKQASITVSV VSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLIMVGPGTGVAPFRGFVQARKQLKEQGQ SLGEAHLYFGCRSPHEDYLYQEELENAQSEGIITLHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDG SQMAPAVEATLMKSYADVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:58 BM3-CIS-T438S-AxM TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF ARDFAGDGLVTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDTAVQLVQKWERLNADEHIEVSEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFIISMVRALDEVMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDIIADRKARGEQSDD LLTQMLNGKDPETGEPLDDGNIRYQIITFLIAGHSATSGLLSFALYFLVKNPHVLQKVAEEAARVLVDPVPSYKQVK QLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDEVMVLIPQLHRDKTVWGDDVEEFRPERFENPSAIP QHAFKPFGNGQRAMIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPST EQSAKKVRKKAENAHNTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHP PDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWR EHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSTNVVASKELQQPGSARSTRHLEIELPKEASY QEGDHLGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKT VCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDEKQASITVSV VSGEAWSGYGEYKGIASNYTAELQEGDTITCFISTPQSEFTLPKDPETPLIMVGPGTGVAPFRGFVQARKQLKEQGQ SLGEAHLYFGCRSPHEDYLYQEELENAQSEGIITLHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDG SQMAPAVEATLMKSYADVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:59 BM3-CIS-T438S-AxY TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKF ARDFAGDGLVTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVSEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFIISMVRALDEVMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDIIADRKARGEQSDD LLTQMLNGKDPETGEPLDDGNIRYQIITFLIAGHEATSGLLSFALYFLVKNPHVLQKVAEEAARVLVDPVPSYKQVK QLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDEVMVLIPQLHRDKTVWGDDVEEFRPERFENPSAIP QHAFKPFGNGQRAYIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPST EQSAKKVRKKAENAHNTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHP PDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWR EHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSTNVVASKELQQPGSARSTRHLEIELPKEASY QEGDHLGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKT VCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDEKQASITVSV VSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLIMVGPGTGVAPFRGFVQARKQLKEQGQ SLGEAHLYFGCRSPHEDYLYQEELENAQSEGIITLHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDG SQMAPAVEATLMKSYADVHQVSEADARLWLQQLEEKGRYAKDVWAG SEQIDNO:60 BM3-CIS-T438S-AXT TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKSACDESRFDKNLSQALKF ARDFAGDGLVTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVSEDMTRLTLDTIG LCGFNYRFNSFYRDQPHPFIISMVRALDEVMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDIIADRKARGEQSDD LLTQMLNGKDPETGEPLDDGNIRYQIITFLIAGHEATSGLLSFALYFLVKNPHVLQKVAEEAARVLVDPVPSYKQVK QLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDEVMVLIPQLHRDKTVWGDDVEEFRPERFENPSAIP QHAFKPFGNGQRATIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLSLKPKGFVVKAKSKKIPLGGIPSPST EQSAKKVRKKAENAHNTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHP PDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWR EHMWSDVAAYFNLDIENSEDNKSTLSLQFVDSAADMPLAKMHGAFSTNVVASKELQQPGSARSTRHLEIELPKEASY QEGDHLGVIPRNYEGIVNRVTARFGLDASQQIRLEAEEEKLAHLPLAKTVSVEELLQYVELQDPVTRTQLRAMAAKT VCPPHKVELEALLEKQAYKEQVLAKRLTMLELLEKYPACEMKFSEFIALLPSIRPRYYSISSSPRVDEKQASITVSV VSGEAWSGYGEYKGIASNYLAELQEGDTITCFISTPQSEFTLPKDPETPLIMVGPGTGVAPFRGFVQARKQLKEQGQ SLGEAHLYFGCRSPHEDYLYQEELENAQSEGIITLHTAFSRMPNQPKTYVQHVMEQDGKKLIELLDQGAHFYICGDG SQMAPAVEATLMKSYADVHQVSEADARLWLQQLEEKGRYAKDVWAG