Car enzymes and improved production of fatty alcohols
10301603 ยท 2019-05-28
Assignee
Inventors
- Derek L. GREENFIELD (South San Francisco, CA, US)
- Elizabeth J. CLARKE (South San Francisco, CA, US)
- Eli S. GROBAN (South San Francisco, CA, US)
- Vikranth Arlagadda (South San Francisco, CA)
- Sungwon Lee (South San Francisco, CA, US)
- Xuezhi Li (South San Francisco, CA, US)
- Zhihao Hu (South San Francisco, CA)
- Baolong Zhu (South San Francisco, CA)
Cpc classification
C12Y203/01041
CHEMISTRY; METALLURGY
Y02E50/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N9/1029
CHEMISTRY; METALLURGY
Y02P20/52
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12Y102/0105
CHEMISTRY; METALLURGY
C12N9/0008
CHEMISTRY; METALLURGY
International classification
Abstract
The disclosure relates to variant carboxylic acid reductase (CAR) enzymes for the improved production of fatty alcohols in recombinant host cells.
Claims
1. A variant carboxylic acid reductase (CAR) polypeptide comprising an amino acid sequence having at least 85% sequence identity to the wild-type CAR polypeptide of SEQ ID NO: 7, wherein said variant CAR polypeptide is genetically engineered to have at least one mutation at an amino acid position selected from the group consisting of S3R, D18R, D18L, D18T, D18P, E20V, E20S, E20R, S22R, S22N, S22G, L80R, R87G, R87E, V191 S, F288R, F288S, F288G, Q473L, Q473W, Q473Y, Q473I, Q473H, A535S, D750A, R827C, R827A, I870L, R873S, V926A, V926E, S927K, S927G, M930K, M930R and L1128W, wherein expression of said variant CAR polypeptide in a recombinant host cell results in a fatty alcohol composition, a fatty aldehyde composition or a composition that is a mixture of fatty aldehydes and fatty alcohols wherein the fatty alcohols and fatty aldehydes are produced at a higher titer than is produced by a recombinant host cell expressing the wild type CAR polypeptide of SEQ ID NO:7.
2. The variant CAR polypeptide of claim 1, wherein said variant polypeptide comprises: (a) mutation A535S; (b) mutations E20R, F288G, Q473I and A535S; (c) mutations E20R, F288G, Q473H, A535S, R827A and S927G; (d) mutations E20R, S22R, F288G, Q473H, A535S, R827A and S927G (e) mutations S3R, E20R, S22R, F288G, Q473H, A535S, R873S, S927G, M930R and L1128W; (f) mutations E20R, S22R, F288G, Q473H, A535S, R873S, S927G, M930R and LI 128W, (g) mutations D18R, E20R, S22R, F288G, Q473I, A535S, S927G, M930K and L1128W; (h) mutations E20R, S22R, F288G, Q473I, A535S, R827C, V926E, S927K and M930R; (i) mutations D18R, E20R, 288G, Q473I, A535S, R827C, V926E, M930K and LI 128W; (j) mutations E20R, S22R, F288G, Q473H, A535S, R827C, V926A, S927K and M930R; (k) mutations E20R, S22R, F288G, Q473H, A535S and R827C; (l) mutations E20R, S22R, F288G, Q473I, A535S, R827C and M930R; (m) mutations E20R, S22R, F288G, Q473I, A535S, I870L, S927G and M930R; (n) mutations E20R, S22R, F288G, Q473I, A535S, I870L and S927G; (o) mutations D18R, E20R, S22R, F288G, Q473I, A535S, R827C, I870L, V926A and S927G; (p) mutations E20R, S22R, F288G, Q473H, A535S, R827C, I870L and L1128W; (q) mutations D18R, E20R, S22R, F288G, Q473H, A535S, R827C, I870L, S927G and L1128W; (r) mutations E20R, S22R, F288G, Q473I, A535S, R827C, I870L, S927G and L1128W; (s) mutations E20R, S22R, F288G, Q473I, A535S, R827C, I870L, S927G, M930K and L1128W; (t) mutations E20R, S22R, F288G, Q473H, A535S, I870L, S927G and M930K; (u) mutations E20R, F288G, Q473I, A535S, I870L, M930K; (v) mutations E20R, S22R, F288G, Q473H, A535S, S927G, M930K and L1128W; (w) mutations D18R, E20R, S22R, F288G, Q473I, A535S, S927G and L1128W; (x) mutations E20R, S22R, F288G, Q473I, A535S, R827C, I870L and S927G; (y) mutations D18R, E20R, S22R, F288G, Q473I, A535S, R827C, I870L, S927G and L1128W; (z) mutations D18R, E20R, S22R, F288G, Q473I, A535S, S927G, M930R and L1128W; (xx) mutations E20R, S22R, F288G, Q473H, A535S, V926E, S927G and M930R; or (zz) mutations E20R, S22R, F288G, Q473H, A535S, R827C, I870L, V926A and L1128W.
3. A recombinant host cell comprising a polynucleotide sequence encoding a variant carboxylic acid reductase (CAR) polypeptide having at least 85% sequence identity to the wild-type CAR polypeptide of SEQ ID NO: 7 and having at least one mutation at an amino acid position selected from the group consisting of S3R, D18R, D18L, D18T, D18P, E20V, E20S, E20R, S22R, S22N, S22G, L80R, R87G, R87E, V191 S, F288R, F288S, F288G, Q473L, Q473W, Q473Y, Q473I, Q473H, A535S, D750A, R827C, R827A, I870L, R873S, V926A, V926E, S927K, S927G, M930K, M930R and L1128W, wherein the recombinant host cell produces a fatty alcohol composition, a fatty aldehyde composition or a composition that is a mixture of fatty aldehydes and fatty alcohols wherein the fatty alcohols and fatty aldehydes are produced at a higher titer or yield than is produced by a host cell expressing the wild type CAR polypeptide of SEQ ID NO: 7 when cultured in a medium containing a carbon source under conditions effective to express said variant CAR polypeptide.
4. The recombinant host cell of claim 3, further comprising a polynucleotide encoding a thioesterase polypeptide.
5. The recombinant host cell of claim 4, further comprising a polynucleotide encoding (i) a FabB polypeptide and a FadR polypeptide, or (ii) a fatty aldehyde reductase.
6. The recombinant host cell of claim 3, wherein the titer or yield is at least 3 times greater than the titer or the yield of a host cell expressing the corresponding wild type CAR polypeptide when cultured under the same conditions as the recombinant host cell.
7. The recombinant host cell of claim 6, wherein the titer is in a range that is between 30 g/L to 250 g/L, or between 90 g/L to 120 g/L.
8. The recombinant host cell of claim 7, wherein the yield is in a range that is between 10% to 40%.
9. A cell culture comprising the recombinant host cell of claim 3.
10. The cell culture of claim 9 wherein the cell culture has productivity that is at least 3 times greater than the productivity of a cell culture that expresses the corresponding wild type CAR polypeptide.
11. The cell culture of claim 10, wherein said productivity ranges from 0.7 mg/L/hr to 3 g/L/hr.
12. The cell culture of claim 9, wherein the fatty alcohol composition, fatty aldehyde composition or composition that is a mixture of fatty aldehydes and fatty alcohols collects in an organic phase extracellularly.
13. The cell culture of claim 12, wherein the fatty alcohol composition, fatty aldehyde composition or composition that is a mixture of fatty aldehydes and fatty alcohols comprises one or more of a C6, C8, C10, C12, C13, C14, C15, C16, C17, or C18 fatty alcohol, fatty aldehyde or combination thereof.
14. The cell culture of claim 12, wherein the fatty alcohol composition, fatty aldehyde composition or composition that is a mixture of fatty aldehydes and fatty alcohols comprises a C10:1, C12:1, C14:1, C16:1, or a C18:1 unsaturated fatty alcohol or a C10:1, C12:1, C14:1, C16:1, or a C18:1 unsaturated fatty aldehyde or a combination thereof.
15. The cell culture of claim 12, wherein the fatty alcohol composition, fatty aldehyde composition or composition that is a mixture of fatty aldehydes and fatty alcohols comprises C12 and C14 fatty alcohols and/or C12 and C14 fatty aldehydes.
16. The cell culture of claim 15, wherein the fatty alcohol composition, fatty aldehyde composition or composition that is a mixture of fatty aldehydes and fatty alcohols comprises C12 and C14 fatty alcohols and/or C12 and C14 fatty aldehydes at a ratio of about 3:1.
17. The cell culture of claim 12, wherein the fatty alcohol composition comprises unsaturated fatty alcohols, the fatty aldehyde composition comprises unsaturated fatty aldehydes and the composition that is a mixture of fatty aldehydes and fatty alcohols comprises unsaturated fatty alcohols and unsaturated fatty aldehydes.
18. The cell culture of claim 17, wherein the unsaturated fatty alcohols and unsaturated fatty aldehydes have a double bond at position 7 in the carbon chain between C7 and C8 from the reduced end of the fatty alcohol or fatty aldehyde.
19. The cell culture of claim 12, wherein the fatty alcohol composition comprises branched chain fatty alcohols, the fatty aldehyde composition comprises branched chain fatty aldehydes and the composition that is a mixture of fatty aldehydes and fatty alcohols comprises branched chain fatty alcohols and branched chain fatty aldehydes.
20. A method of making a fatty alcohol composition, a fatty aldehyde composition or a composition that is a mixture of fatty aldehydes and fatty alcohols composition at a high titer, yield or productivity, the method comprising: (a) culturing a recombinant host cell that comprises a polynucleotide sequence encoding a variant carboxylic acid reductase (CAR) polypeptide having at least 85% sequence identity to the wild-type CAR polypeptide of SEQ ID NO: 7 and having at least one mutation at an amino acid position selected from the group consisting of S3R, D18R, D18L, D18T, D18P, E20V, E20S, E20R, S22R, S22N, S22G, L80R, R87G, R87E, V191 S, F288R, F288S, F288G, Q473L, Q473W, Q473Y, Q473I, Q473H, A535S, D750A, R827C, R827A, I870L, R873S, V926A, V926E, S927K, S927G, M930K, M930R and L1128W, in a medium comprising a carbon source under conditions effective to express the variant CAR polypeptide; and optionally, isolating the fatty alcohol and/or fatty aldehyde composition from said medium.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The present disclosure is best understood when read in conjunction with the accompanying figures, which serve to illustrate the preferred embodiments. It is understood, however, that the disclosure is not limited to the specific embodiments disclosed in the figures.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
DETAILED DESCRIPTION
(18) General Overview
(19) The present disclosure provides novel variant carboxylic acid reductase (CAR) enzymes as well as their nucleic acid and protein sequences. Further encompassed by the disclosure are recombinant host cells and cell cultures that include the variant CAR enzymes for the production of fatty alcohols. In order for the production of fatty alcohols from fermentable sugars or biomass to be commercially viable, the process must be optimized for efficient conversion and recovery of product. The present disclosure addresses this need by providing compositions and methods for improved production of fatty alcohols using engineered variant enzymes and engineered recombinant host cells. The host cells serve as biocatalysts resulting in high-titer production of fatty alcohols using fermentation processes. As such, the disclosure further provides methods to create photosynthetic and heterotrophic host cells that produce fatty alcohols and alpha-olefins of specific chain lengths directly such that catalytic conversion of purified fatty acids is not necessary. This new method provides product quality and cost advantages.
(20) More specifically, the production of a desired fatty alcohol composition may be enhanced by modifying the expression of one or more genes involved in a biosynthetic pathway for fatty alcohol production, degradation and/or secretion. The disclosure provides recombinant host cells, which have been engineered to provide enhanced fatty alcohol biosynthesis relative to non-engineered or native host cells (e.g., strain improvements). The disclosure also provides polynucleotides useful in the recombinant host cells, methods, and compositions of the disclosure. However it will be recognized that absolute sequence identity to such polynucleotides is not necessary. For example, changes in a particular polynucleotide sequence can be made and the encoded polypeptide evaluated for activity. Such changes typically comprise conservative mutations and silent mutations (e.g., codon optimization). Modified or mutated polynucleotides (i.e., mutants) and encoded variant polypeptides can be screened for a desired function, such as, an improved function compared to the parent polypeptide, including but not limited to increased catalytic activity, increased stability, or decreased inhibition (e.g., decreased feedback inhibition), using methods known in the art.
(21) The disclosure identifies enzymatic activities involved in various steps (i.e., reactions) of the fatty acid biosynthetic pathways described herein according to Enzyme Classification (EC) number, and provides exemplary polypeptides (i.e., enzymes) categorized by such EC numbers, and exemplary polynucleotides encoding such polypeptides. Such exemplary polypeptides and polynucleotides, which are identified herein by Accession Numbers and/or Sequence Identifier Numbers (SEQ ID NOs), are useful for engineering fatty acid pathways in parental host cells to obtain the recombinant host cells described herein. It is to be understood, however, that polypeptides and polynucleotides described herein are exemplary and non-limiting. The sequences of homologues of exemplary polypeptides described herein are available to those of skill in the art using databases (e.g., the Entrez databases provided by the National Center for Biotechnology Information (NCBI), the ExPasy databases provided by the Swiss Institute of Bioinformatics, the BRENDA database provided by the Technical University of Braunschweig, and the KEGG database provided by the Bioinformatics Center of Kyoto University and University of Tokyo, all which are available on the World Wide Web).
(22) A variety of host cells can be modified to contain a fatty alcohol biosynthetic enzymes such as those described herein, resulting in recombinant host cells suitable for the production of fatty alcohol compositions. It is understood that a variety of cells can provide sources of genetic material, including polynucleotide sequences that encode polypeptides suitable for use in a recombinant host cell provided herein.
(23) Definitions
(24) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure pertains. Although other methods and materials similar, or equivalent, to those described herein can be used in the practice of the present disclosure, the preferred materials and methods are described herein. In describing and claiming the present disclosure, the following terminology will be used in accordance with the definitions set out below.
(25) Accession Numbers: Sequence Accession numbers throughout this description were obtained from databases provided by the NCBI (National Center for Biotechnology Information) maintained by the National Institutes of Health, U.S.A. (which are identified herein as NCBI Accession Numbers or alternatively as GenBank Accession Numbers), and from the UniProt Knowledgebase (UniProtKB) and Swiss-Prot databases provided by the Swiss Institute of Bioinformatics (which are identified herein as UniProtKB Accession Numbers).
(26) Enzyme Classification (EC) Numbers: EC numbers are established by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB), description of which is available on the IUBMB Enzyme Nomenclature website on the World Wide Web. EC numbers classify enzymes according to the reaction catalyzed.
(27) As used herein, the term nucleotide refers to a monomeric unit of a polynucleotide that consists of a heterocyclic base, a sugar, and one or more phosphate groups. The naturally occurring bases (guanine, (G), adenine, (A), cytosine, (C), thymine, (T), and uracil (U)) are typically derivatives of purine or pyrimidine, though it should be understood that naturally and non-naturally occurring base analogs are also included. The naturally occurring sugar is the pentose (five-carbon sugar) deoxyribose (which forms DNA) or ribose (which forms RNA), though it should be understood that naturally and non-naturally occurring sugar analogs are also included. Nucleic acids are typically linked via phosphate bonds to form nucleic acids or polynucleotides, though many other linkages are known in the art (e.g., phosphorothioates, boranophosphates, and the like).
(28) As used herein, the term polynucleotide refers to a polymer of ribonucleotides (RNA) or deoxyribonucleotides (DNA), which can be single-stranded or double-stranded and which can contain non-natural or altered nucleotides. The terms polynucleotide, nucleic acid sequence, and nucleotide sequence are used interchangeably herein to refer to a polymeric form of nucleotides of any length, either RNA or DNA. These terms refer to the primary structure of the molecule, and thus include double- and single-stranded DNA, and double- and single-stranded RNA. The terms include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs and modified polynucleotides such as, though not limited to methylated and/or capped polynucleotides. The polynucleotide can be in any form, including but not limited to, plasmid, viral, chromosomal, EST, cDNA, mRNA, and rRNA.
(29) As used herein, the terms polypeptide and protein are used interchangeably to refer to a polymer of amino acid residues. The term recombinant polypeptide refers to a polypeptide that is produced by recombinant techniques, wherein generally DNA or RNA encoding the expressed protein is inserted into a suitable expression vector that is in turn used to transform a host cell to produce the polypeptide.
(30) As used herein, the terms homolog, and homologous refer to a polynucleotide or a polypeptide comprising a sequence that is at least about 50% identical to the corresponding polynucleotide or polypeptide sequence. Preferably homologous polynucleotides or polypeptides have polynucleotide sequences or amino acid sequences that have at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least about 99% homology to the corresponding amino acid sequence or polynucleotide sequence. As used herein the terms sequence homology and sequence identity are used interchangeably.
(31) One of ordinary skill in the art is well aware of methods to determine homology between two or more sequences. Briefly, calculations of homology between two sequences can be performed as follows. The sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a first sequence that is aligned for comparison purposes is at least about 30%, preferably at least about 40%, more preferably at least about 50%, even more preferably at least about 60%, and even more preferably at least about 70%, at least about 80%, at least about 90%, or about 100% of the length of a second sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions of the first and second sequences are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent homology between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps and the length of each gap, that need to be introduced for optimal alignment of the two sequences.
(32) The comparison of sequences and determination of percent homology between two sequences can be accomplished using a mathematical algorithm, such as BLAST (Altschul et al., J. Mol. Biol., 215(3): 403-410 (1990)). The percent homology between two amino acid sequences also can be determined using the Needleman and Wunsch algorithm that has been incorporated into the GAP program in the GCG software package, using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6 (Needleman and Wunsch, J. Mol. Biol., 48: 444-453 (1970)). The percent homology between two nucleotide sequences also can be determined using the GAP program in the GCG software package, using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. One of ordinary skill in the art can perform initial homology calculations and adjust the algorithm parameters accordingly. A preferred set of parameters (and the one that should be used if a practitioner is uncertain about which parameters should be applied to determine if a molecule is within a homology limitation of the claims) are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5. Additional methods of sequence alignment are known in the biotechnology arts (see, e.g., Rosenberg, BMC Bioinformatics, 6: 278 (2005); Altschul, et al., FEBS J., 272(20): 5101-5109 (2005)).
(33) As used herein, the term hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing. Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Aqueous and non-aqueous methods are described in that reference and either method can be used. Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions6 sodium chloride/sodium citrate (SSC) at about 45 C., followed by two washes in 0.2SSC, 0.1% SDS at least at 50 C. (the temperature of the washes can be increased to 55 C. for low stringency conditions); 2) medium stringency hybridization conditions6SSC at about 45 C., followed by one or more washes in 0.2SSC, 0.1% SDS at 60 C.; 3) high stringency hybridization conditions6SSC at about 45 C., followed by one or more washes in 0.2.SSC, 0.1% SDS at 65 C.; and 4) very high stringency hybridization conditions0.5M sodium phosphate, 7% SDS at 65 C., followed by one or more washes at 0.2SSC, 1% SDS at 65 C. Very high stringency conditions (4) are the preferred conditions unless otherwise specified.
(34) An endogenous polypeptide refers to a polypeptide encoded by the genome of the parental microbial cell (also termed host cell) from which the recombinant cell is engineered (or derived).
(35) An exogenous polypeptide refers to a polypeptide, which is not encoded by the genome of the parental microbial cell. A variant (i.e., mutant) polypeptide is an example of an exogenous polypeptide.
(36) The term heterologous generally means derived from a different species or derived from a different organism. As used herein it refers to a nucleotide sequence or a polypeptide sequence that is not naturally present in a particular organism. Heterologous expression means that a protein or polypeptide is experimentally added to a cell that does not normally express that protein. As such, heterologous refers to the fact that a transferred protein was initially derived from a different cell type or a different species then the recipient. For example, a polynucleotide sequence endogenous to a plant cell can be introduced into a bacterial host cell by recombinant methods, and the plant polynucleotide is then a heterologous polynucleotide in a recombinant bacterial host cell.
(37) As used herein, the term fragment of a polypeptide refers to a shorter portion of a full-length polypeptide or protein ranging in size from four amino acid residues to the entire amino acid sequence minus one amino acid residue. In certain embodiments of the disclosure, a fragment refers to the entire amino acid sequence of a domain of a polypeptide or protein (e.g., a substrate binding domain or a catalytic domain).
(38) As used herein, the term mutagenesis refers to a process by which the genetic information of an organism is changed in a stable manner. Mutagenesis of a protein coding nucleic acid sequence produces a mutant protein. Mutagenesis also refers to changes in non-coding nucleic acid sequences that result in modified protein activity.
(39) As used herein, the term gene refers to nucleic acid sequences encoding either an RNA product or a protein product, as well as operably-linked nucleic acid sequences affecting the expression of the RNA or protein (e.g., such sequences include but are not limited to promoter or enhancer sequences) or operably-linked nucleic acid sequences encoding sequences that affect the expression of the RNA or protein (e.g., such sequences include but are not limited to ribosome binding sites or translational control sequences).
(40) Expression control sequences are known in the art and include, for example, promoters, enhancers, polyadenylation signals, transcription terminators, internal ribosome entry sites (IRES), and the like, that provide for the expression of the polynucleotide sequence in a host cell. Expression control sequences interact specifically with cellular proteins involved in transcription (Maniatis et al., Science, 236: 1237-1245 (1987)). Exemplary expression control sequences are described in, for example, Goeddel, Gene Expression Technology: Methods in Enzymology, Vol. 185, Academic Press, San Diego, Calif. (1990).
(41) In the methods of the disclosure, an expression control sequence is operably linked to a polynucleotide sequence. By operably linked is meant that a polynucleotide sequence and an expression control sequence(s) are connected in such a way as to permit gene expression when the appropriate molecules (e.g., transcriptional activator proteins) are bound to the expression control sequence(s). Operably linked promoters are located upstream of the selected polynucleotide sequence in terms of the direction of transcription and translation. Operably linked enhancers can be located upstream, within, or downstream of the selected polynucleotide.
(42) As used herein, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid, i.e., a polynucleotide sequence, to which it has been linked. One type of useful vector is an episome (i.e., a nucleic acid capable of extra-chromosomal replication). Useful vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked. Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as expression vectors. In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids, which refer generally to circular double stranded DNA loops that, in their vector form, are not bound to the chromosome. The terms plasmid and vector are used interchangeably herein, inasmuch as a plasmid is the most commonly used form of vector. However, also included are such other forms of expression vectors that serve equivalent functions and that become known in the art subsequently hereto. In some embodiments, the recombinant vector comprises at least one sequence including (a) an expression control sequence operatively coupled to the polynucleotide sequence; (b) a selection marker operatively coupled to the polynucleotide sequence; (c) a marker sequence operatively coupled to the polynucleotide sequence; (d) a purification moiety operatively coupled to the polynucleotide sequence; (e) a secretion sequence operatively coupled to the polynucleotide sequence; and (f) a targeting sequence operatively coupled to the polynucleotide sequence. The expression vectors described herein include a polynucleotide sequence described herein in a form suitable for expression of the polynucleotide sequence in a host cell. It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of polypeptide desired, etc. The expression vectors described herein can be introduced into host cells to produce polypeptides, including fusion polypeptides, encoded by the polynucleotide sequences as described herein.
(43) Expression of genes encoding polypeptides in prokaryotes, for example, E. coli, is most often carried out with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion polypeptides. Fusion vectors add a number of amino acids to a polypeptide encoded therein, usually to the amino- or carboxy-terminus of the recombinant polypeptide. Such fusion vectors typically serve one or more of the following three purposes: (1) to increase expression of the recombinant polypeptide; (2) to increase the solubility of the recombinant polypeptide; and (3) to aid in the purification of the recombinant polypeptide by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant polypeptide. This enables separation of the recombinant polypeptide from the fusion moiety after purification of the fusion polypeptide. In certain embodiments, a polynucleotide sequence of the disclosure is operably linked to a promoter derived from bacteriophage T5. In certain embodiments, the host cell is a yeast cell, and the expression vector is a yeast expression vector. Examples of vectors for expression in yeast S. cerevisiae include pYepSec1 (Baldari et al., EMBO J., 6: 229-234 (1987)), pMFa (Kurjan et al., Cell, 30: 933-943 (1982)), pJRY88 (Schultz et al., Gene, 54: 113-123 (1987)), pYES2 (Invitrogen Corp., San Diego, Calif.), and picZ (Invitrogen Corp., San Diego, Calif.). In other embodiments, the host cell is an insect cell, and the expression vector is a baculovirus expression vector. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., 519 cells) include, for example, the pAc series (Smith et al., Mol. Cell Biol., 3: 2156-2165 (1983)) and the pVL series (Lucklow et al., Virology, 170: 31-39 (1989)). In yet another embodiment, the polynucleotide sequences described herein can be expressed in mammalian cells using a mammalian expression vector. Other suitable expression systems for both prokaryotic and eukaryotic cells are well known in the art; see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, second edition, Cold Spring Harbor Laboratory, (1989).
(44) As used herein Acyl-CoA refers to an acyl thioester formed between the carbonyl carbon of alkyl chain and the sulfhydryl group of the 4-phosphopantethionyl moiety of coenzyme A (CoA), which has the formula RC(O)S-CoA, where R is any alkyl group having at least 4 carbon atoms.
(45) As used herein acyl-ACP refers to an acyl thioester formed between the carbonyl carbon of alkyl chain and the sulfhydryl group of the phosphopantetheinyl moiety of an acyl carrier protein (ACP). The phosphopantetheinyl moiety is post-translationally attached to a conserved serine residue on the ACP by the action of holo-acyl carrier protein synthase (ACPS), a phosphopantetheinyl transferase. In some embodiments an acyl-ACP is an intermediate in the synthesis of fully saturated acyl-ACPs. In other embodiments an acyl-ACP is an intermediate in the synthesis of unsaturated acyl-ACPs. In some embodiments, the carbon chain will have about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 carbons. Each of these acyl-ACPs are substrates for enzymes that convert them to fatty acid derivatives.
(46) As used herein, the term fatty acid or derivative thereof means a fatty acid or a fatty acid derivative. The term fatty acid means a carboxylic acid having the formula RCOOH. R represents an aliphatic group, preferably an alkyl group. R can comprise between about 4 and about 22 carbon atoms. Fatty acids can be saturated, monounsaturated, or polyunsaturated. In a preferred embodiment, the fatty acid is made from a fatty acid biosynthetic pathway. The term fatty acid derivative means products made in part from the fatty acid biosynthetic pathway of the production host organism. Fatty acid derivative also includes products made in part from acyl-ACP or acyl-ACP derivatives. Exemplary fatty acid derivatives include, for example, acyl-CoA, fatty aldehydes, short and long chain alcohols, hydrocarbons, and esters (e.g., waxes, fatty acid esters, or fatty esters).
(47) As used herein, the term fatty acid biosynthetic pathway means a biosynthetic pathway that produces fatty acid derivatives, for example, fatty alcohols. The fatty acid biosynthetic pathway includes fatty acid synthases that can be engineered to produce fatty acids, and in some embodiments can be expressed with additional enzymes to produce fatty acid derivatives, such as fatty alcohols having desired characteristics.
(48) As used herein, fatty aldehyde means an aldehyde having the formula RCHO characterized by a carbonyl group (CO). In some embodiments, the fatty aldehyde is any aldehyde made from a fatty alcohol. In certain embodiments, the R group is at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19, carbons in length. Alternatively, or in addition, the R group is 20 or less, 19 or less, 18 or less, 17 or less, 16 or less, 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, or 6 or less carbons in length. Thus, the R group can have an R group bounded by any two of the above endpoints. For example, the R group can be 6-16 carbons in length, 10-14 carbons in length, or 12-18 carbons in length. In some embodiments, the fatty aldehyde is a C.sub.6, C.sub.7, C.sub.8, C.sub.9, C.sub.10, C.sub.11, C.sub.12, C.sub.13, C.sub.14, C.sub.15, C.sub.16, C.sub.17, C.sub.18, C.sub.19, C.sub.20, C.sub.21, C.sub.22, C.sub.23, C.sub.24, C.sub.25, or a C.sub.26 fatty aldehyde. In certain embodiments, the fatty aldehyde is a C.sub.6, C.sub.8, C.sub.10, C.sub.12, C.sub.13, C.sub.14, C.sub.15, C.sub.16, C.sub.17, or C.sub.18 fatty aldehyde.
(49) As used herein, fatty alcohol means an alcohol having the formula ROH. In some embodiments, the R group is at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19, carbons in length. Alternatively, or in addition, the R group is 20 or less, 19 or less, 18 or less, 17 or less, 16 or less, 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, or 6 or less carbons in length. Thus, the R group can have an R group bounded by any two of the above endpoints. For example, the R group can be 6-16 carbons in length, 10-14 carbons in length, or 12-18 carbons in length. In some embodiments, the fatty alcohol is a C.sub.6, C.sub.7, C.sub.8, C.sub.9, C.sub.10, C.sub.11, C.sub.12, C.sub.13, C.sub.14, C.sub.15, C.sub.16, C.sub.17, C.sub.18, C.sub.19, C.sub.20, C.sub.21, C.sub.22, C.sub.23, C.sub.24, C.sub.25, or a C.sub.26 fatty alcohol. In certain embodiments, the fatty alcohol is a C.sub.6, C.sub.8, C.sub.10, C.sub.12, C.sub.13, C.sub.14, C.sub.15, C.sub.16, C.sub.17, or C.sub.18 fatty alcohol.
(50) A fatty alcohol composition as referred to herein is produced by a recombinant host cell and typically comprises a mixture of fatty alcohols. In some cases, the mixture includes more than one type of product (e.g., fatty alcohols and fatty acids). In other cases, the fatty acid derivative compositions may comprise, for example, a mixture of fatty alcohols with various chain lengths and saturation or branching characteristics. In still other cases, the fatty alcohol composition comprises a mixture of both more than one type of product and products with various chain lengths and saturation or branching characteristics.
(51) A host cell engineered to produce a fatty aldehyde will typically convert some of the fatty aldehyde to a fatty alcohol. When a host cell, which produces fatty alcohols is engineered to express a polynucleotide encoding an ester synthase, wax esters are produced. In one embodiment, fatty alcohols are made from a fatty acid biosynthetic pathway. As an example, Acyl-ACP can be converted to fatty acids via the action of a thioesterase (e.g., E. coli TesA), which are converted to fatty aldehydes and fatty alcohols via the action of a carboxylic acid reductase (e.g., E. coli CarB). Conversion of fatty aldehydes to fatty alcohols can be further facilitated, for example, via the action of a fatty alcohol biosynthetic polypeptide. In some embodiments, a gene encoding a fatty alcohol biosynthetic polypeptide is expressed or overexpressed in the host cell. In certain embodiments, the fatty alcohol biosynthetic polypeptide has aldehyde reductase or alcohol dehydrogenase activity. Examples of alcohol dehydrogenase polypeptides useful in accordance with the disclosure include, but are not limited to AlrA of Acinetobacter sp. M-1 (SEQ ID NO: 3) or AlrA homologs, such as AlrAadp1 (SEQ ID NO:4) and endogenous E. coli alcohol dehydrogenases such as YjgB, (AAC77226) (SEQ ID NO: 5), DkgA (NP_417485), DkgB (NP_414743), YdjL (AAC74846), YdjJ (NP_416288), AdhP (NP_415995), YhdH (NP_417719), YahK (NP_414859), YphC (AAC75598), YqhD (446856) and YbbO [AAC73595.1]. Additional examples are described in International Patent Application Publication Nos. WO2007/136762, WO2008/119082 and WO2010/062480, each of which is expressly incorporated by reference herein. In certain embodiments, the fatty alcohol biosynthetic polypeptide has aldehyde reductase or alcohol dehydrogenase activity (EC 1.1.1.1).
(52) As used herein, the term alcohol dehydrogenase refers to a polypeptide capable of catalyzing the conversion of a fatty aldehyde to an alcohol (e.g., fatty alcohol). One of ordinary skill in the art will appreciate that certain alcohol dehydrogenases are capable of catalyzing other reactions as well, and these non-specific alcohol dehydrogenases also are encompassed by the term alcohol dehydrogenase. The R group of a fatty acid, fatty aldehyde, or fatty alcohol can be a straight chain or a branched chain. Branched chains may have more than one point of branching and may include cyclic branches. In some embodiments, the branched fatty acid, branched fatty aldehyde, or branched fatty alcohol is a C.sub.6, C.sub.7, C.sub.8, C.sub.9, C.sub.10, C.sub.11, C.sub.12, C.sub.13, C.sub.14, C.sub.15, C.sub.16, C.sub.17, C.sub.18, C.sub.19, C.sub.20, C.sub.21, C.sub.22, C.sub.23, C.sub.24, C.sub.25, or a C.sub.26 branched fatty acid, branched fatty aldehyde, or branched fatty alcohol. In particular embodiments, the branched fatty acid, branched fatty aldehyde, or branched fatty alcohol is a C.sub.6, C.sub.8, C.sub.10, C.sub.12, C.sub.13, C.sub.14, C.sub.15, C.sub.16, C.sub.17, or C.sub.18 branched fatty acid, branched fatty aldehyde, or branched fatty alcohol. In certain embodiments, the hydroxyl group of the branched fatty acid, branched fatty aldehyde, or branched fatty alcohol is in the primary (C.sub.1) position. In certain embodiments, the branched fatty acid, branched fatty aldehyde, or branched fatty alcohol is an iso-fatty acid, iso-fatty aldehyde, or iso-fatty alcohol, or an antesio-fatty acid, an anteiso-fatty aldehyde, or anteiso-fatty alcohol. In exemplary embodiments, the branched fatty acid, branched fatty aldehyde, or branched fatty alcohol is selected from iso-C.sub.7:0, iso-C.sub.8:0, iso-C.sub.9:0, iso-C.sub.10:0, iso-C.sub.11:0, iso-C.sub.12:0, iso-C.sub.13:0, iso-C.sub.14:0, iso-C.sub.15:0, iso-C.sub.16:0, iso-C.sub.17:0, iso-C.sub.18:0, iso-C.sub.19:0, anteiso-C.sub.7:0, anteiso-C.sub.8:0, anteiso-C.sub.9:0, anteiso-C.sub.10:0, anteiso-C.sub.11:0, anteiso-C.sub.12:0, anteiso-C.sub.13:0, anteiso-C.sub.14:0, anteiso-C.sub.15:0, anteiso-C.sub.16:0, anteiso-C.sub.17:0, anteiso-C.sub.18:0, and anteiso-C.sub.19:0 branched fatty acid, branched fatty aldehyde or branched fatty alcohol. The R group of a branched or unbranched fatty acid, branched or unbranched fatty aldehyde, or branched or unbranched fatty alcohol can be saturated or unsaturated. If unsaturated, the R group can have one or more than one point of unsaturation. In some embodiments, the unsaturated fatty acid, unsaturated fatty aldehyde, or unsaturated fatty alcohol is a monounsaturated fatty acid, monounsaturated fatty aldehyde, or monounsaturated fatty alcohol. In certain embodiments, the unsaturated fatty acid, unsaturated fatty aldehyde, or unsaturated fatty alcohol is a C6:1, C7:1, C8:1, C9:1, C10:1, C11:1, C12:1, C13:1, C14:1, C15:1, C16:1, C17:1, C18:1, C19:1, C20:1, C21:1, C22:1, C23:1, C24:1, C25:1, or a C26:1 unsaturated fatty acid, unsaturated fatty aldehyde, or unsaturated fatty alcohol. In certain preferred embodiments, the unsaturated fatty acid, unsaturated fatty aldehyde, or unsaturated fatty alcohol is C10:1, C12:1, C14:1, C16:1, or C18:1. In yet other embodiments, the unsaturated fatty acid, unsaturated fatty aldehyde, or unsaturated fatty alcohol is unsaturated at the omega-7 position. In certain embodiments, the unsaturated fatty acid, unsaturated fatty aldehyde, or unsaturated fatty alcohol comprises a cis double bond.
(53) As used herein, a recombinant or engineered host cell is a host cell, e.g., a microorganism that has been modified such that it produces fatty alcohols. In some embodiments, the recombinant host cell comprises one or more polynucleotides, each polynucleotide encoding a polypeptide having fatty aldehyde and/or fatty alcohol biosynthetic enzyme activity, wherein the recombinant host cell produces a fatty alcohol composition when cultured in the presence of a carbon source under conditions effective to express the polynucleotides.
(54) As used herein, the term clone typically refers to a cell or group of cells descended from and essentially genetically identical to a single common ancestor, for example, the bacteria of a cloned bacterial colony arose from a single bacterial cell.
(55) As used herein, the term culture typical refers to a liquid media comprising viable cells. In one embodiment, a culture comprises cells reproducing in a predetermined culture media under controlled conditions, for example, a culture of recombinant host cells grown in liquid media comprising a selected carbon source and nitrogen. Culturing or cultivation refers to growing a population of microbial cells under suitable conditions in a liquid or solid medium. In particular embodiments, culturing refers to the fermentative bioconversion of a substrate to an end-product. Culturing media are well known and individual components of such culture media are available from commercial sources, e.g., under the Difco and BBL trademarks. In one non-limiting example, the aqueous nutrient medium is a rich medium comprising complex sources of nitrogen, salts, and carbon, such as YP medium, comprising 10 g/L of peptone and 10 g/L yeast extract of such a medium. The host cell can be additionally engineered to assimilate carbon efficiently and use cellulosic materials as carbon sources according to methods described for example in U.S. Pat. Nos. 5,000,000; 5,028,539; 5,424,202; 5,482,846; 5,602,030 and WO2010127318, each of which is expressly incorporated by reference herein. In addition, the host cell can be engineered to express an invertase so that sucrose can be used as a carbon source.
(56) As used herein, the term under conditions effective to express said heterologous nucleotide sequences means any conditions that allow a host cell to produce a desired fatty aldehyde or fatty alcohol. Suitable conditions include, for example, fermentation conditions.
(57) As used herein, modified or an altered level of activity of a protein, for example an enzyme, in a recombinant host cell refers to a difference in one or more characteristics in the activity determined relative to the parent or native host cell. Typically differences in activity are determined between a recombinant host cell, having modified activity, and the corresponding wild-type host cell (e.g., comparison of a culture of a recombinant host cell relative to wild-type host cell). Modified activities can be the result of, for example, modified amounts of protein expressed by a recombinant host cell (e.g., as the result of increased or decreased number of copies of DNA sequences encoding the protein, increased or decreased number of mRNA transcripts encoding the protein, and/or increased or decreased amounts of protein translation of the protein from mRNA); changes in the structure of the protein (e.g., changes to the primary structure, such as, changes to the protein's coding sequence that result in changes in substrate specificity, changes in observed kinetic parameters); and changes in protein stability (e.g., increased or decreased degradation of the protein). In some embodiments, the polypeptide is a mutant or a variant of any of the polypeptides described herein. In certain instances, the coding sequences for the polypeptides described herein are codon optimized for expression in a particular host cell. For example, for expression in E. coli, one or more codons can be optimized as described in, e.g., Grosjean et al., Gene 18:199-209 (1982).
(58) The term regulatory sequences as used herein typically refers to a sequence of bases in DNA, operably-linked to DNA sequences encoding a protein that ultimately controls the expression of the protein. Examples of regulatory sequences include, but are not limited to, RNA promoter sequences, transcription factor binding sequences, transcription termination sequences, modulators of transcription (such as enhancer elements), nucleotide sequences that affect RNA stability, and translational regulatory sequences (such as, ribosome binding sites (e.g., Shine-Dalgarno sequences in prokaryotes or Kozak sequences in eukaryotes), initiation codons, termination codons).
(59) As used herein, the phrase the expression of said nucleotide sequence is modified relative to the wild type nucleotide sequence, means an increase or decrease in the level of expression and/or activity of an endogenous nucleotide sequence or the expression and/or activity of a heterologous or non-native polypeptide-encoding nucleotide sequence. As used herein, the term overexpress means to express or cause to be expressed a polynucleotide or polypeptide in a cell at a greater concentration than is normally expressed in a corresponding wild-type cell under the same conditions.
(60) The terms altered level of expression and modified level of expression are used interchangeably and mean that a polynucleotide, polypeptide, or hydrocarbon is present in a different concentration in an engineered host cell as compared to its concentration in a corresponding wild-type cell under the same conditions.
(61) As used herein, the term titer refers to the quantity of fatty aldehyde or fatty alcohol produced per unit volume of host cell culture. In any aspect of the compositions and methods described herein, a fatty alcohol is produced at a titer of about 25 mg/L, about 50 mg/L, about 75 mg/L, about 100 mg/L, about 125 mg/L, about 150 mg/L, about 175 mg/L, about 200 mg/L, about 225 mg/L, about 250 mg/L, about 275 mg/L, about 300 mg/L, about 325 mg/L, about 350 mg/L, about 375 mg/L, about 400 mg/L, about 425 mg/L, about 450 mg/L, about 475 mg/L, about 500 mg/L, about 525 mg/L, about 550 mg/L, about 575 mg/L, about 600 mg/L, about 625 mg/L, about 650 mg/L, about 675 mg/L, about 700 mg/L, about 725 mg/L, about 750 mg/L, about 775 mg/L, about 800 mg/L, about 825 mg/L, about 850 mg/L, about 875 mg/L, about 900 mg/L, about 925 mg/L, about 950 mg/L, about 975 mg/L, about 1000 mg/L, about 1050 mg/L, about 1075 mg/L, about 1100 mg/L, about 1125 mg/L, about 1150 mg/L, about 1175 mg/L, about 1200 mg/L, about 1225 mg/L, about 1250 mg/L, about 1275 mg/L, about 1300 mg/L, about 1325 mg/L, about 1350 mg/L, about 1375 mg/L, about 1400 mg/L, about 1425 mg/L, about 1450 mg/L, about 1475 mg/L, about 1500 mg/L, about 1525 mg/L, about 1550 mg/L, about 1575 mg/L, about 1600 mg/L, about 1625 mg/L, about 1650 mg/L, about 1675 mg/L, about 1700 mg/L, about 1725 mg/L, about 1750 mg/L, about 1775 mg/L, about 1800 mg/L, about 1825 mg/L, about 1850 mg/L, about 1875 mg/L, about 1900 mg/L, about 1925 mg/L, about 1950 mg/L, about 1975 mg/L, about 2000 mg/L (2 g/L), 3 g/L, 5 g/L, 10 g/L, 20 g/L, 30 g/L, 40 g/L, 50 g/L, 60 g/L, 70 g/L, 80 g/L, 90 g/L, 100 g/L or a range bounded by any two of the foregoing values. In other embodiments, a fatty aldehyde or fatty alcohol is produced at a titer of more than 100 g/L, more than 200 g/L, more than 300 g/L, or higher, such as 500 g/L, 700 g/L, 1000 g/L, 1200 g/L, 1500 g/L, or 2000 g/L. The preferred titer of fatty aldehyde or fatty alcohol produced by a recombinant host cell according to the methods of the disclosure is from 5 g/L to 200 g/L, 10 g/L to 150 g/L, 20 g/L to 120 g/L and 30 g/L to 100 g/L.
(62) As used herein, the term yield of the fatty aldehyde or fatty alcohol produced by a host cell refers to the efficiency by which an input carbon source is converted to product (i.e., fatty alcohol or fatty aldehyde) in a host cell. Host cells engineered to produce fatty alcohols and/or fatty aldehydes according to the methods of the disclosure have a yield of at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, at least 11%, at least 12%, at least 13%, at least 14%, at least 15%, at least 16%, at least 17%, at least 18%, at least 19%, at least 20%, at least 21%, at least 22%, at least 23%, at least 24%, at least 25%, at least 26%, at least 27%, at least 28%, at least 29%, or at least 30% or a range bounded by any two of the foregoing values. In other embodiments, a fatty aldehyde or fatty alcohol is produced at a yield of more than 30%, 40%, 50%, 60%, 70%, 80%, 90% or more. Alternatively, or in addition, the yield is about 30% or less, about 27% or less, about 25% or less, or about 22% or less. Thus, the yield can be bounded by any two of the above endpoints. For example, the yield of the fatty alcohol or fatty aldehyde produced by the recombinant host cell according to the methods of the disclosure can be 5% to 15%, 10% to 25%, 10% to 22%, 15% to 27%, 18% to 22%, 20% to 28%, or 20% to 30%. The preferred yield of fatty alcohol produced by the recombinant host cell according to the methods of the disclosure is from 10% to 30%.
(63) As used herein, the term productivity refers to the quantity of fatty aldehyde or fatty alcohol produced per unit volume of host cell culture per unit time. In any aspect of the compositions and methods described herein, the productivity of fatty aldehyde or fatty alcohol produced by a recombinant host cell is at least 100 mg/L/hour, at least 200 mg/L/hour.sub.0, at least 300 mg/L/hour, at least 400 mg/L/hour, at least 500 mg/L/hour, at least 600 mg/L/hour, at least 700 mg/L/hour, at least 800 mg/L/hour, at least 900 mg/L/hour, at least 1000 mg/L/hour, at least 1100 mg/L/hour, at least 1200 mg/L/hour, at least 1300 mg/L/hour, at least 1400 mg/L/hour, at least 1500 mg/L/hour, at least 1600 mg/L/hour, at least 1700 mg/L/hour, at least 1800 mg/L/hour, at least 1900 mg/L/hour, at least 2000 mg/L/hour, at least 2100 mg/L/hour, at least 2200 mg/L/hour, at least 2300 mg/L/hour, at least 2400 mg/L/hour, or at least 2500 mg/L/hour. Alternatively, or in addition, the productivity is 2500 mg/L/hour or less, 2000 mg/L/OD.sub.600 or less, 1500 mg/L/OD.sub.600 or less, 120 mg/L/hour, or less, 1000 mg/L/hour or less, 800 mg/L/hour, or less, or 600 mg/L/hour or less. Thus, the productivity can be bounded by any two of the above endpoints. For example, the productivity can be 3 to 30 mg/L/hour.sub.0, 6 to 20 mg/L/hour, or 15 to 30 mg/L/hour. The preferred productivity of a fatty aldehyde or fatty alcohol produced by a recombinant host cell according to the methods of the disclosure is selected from 500 mg/L/hour to 2500 mg/L/hour, or from 700 mg/L/hour to 2000 mg/L/hour.
(64) The terms total fatty species and total fatty acid product may be used interchangeably herein with reference to the total amount of fatty alcohols, fatty aldehydes, free fatty acids, and fatty esters present in a sample as evaluated by GC-FID as described in International Patent Application Publication WO 2008/119082. Samples may contain one, two, three, or four of these compounds depending on the context.
(65) As used herein, the term glucose utilization rate means the amount of glucose used by the culture per unit time, reported as grams/liter/hour (g/L/hr).
(66) As used herein, the term carbon source refers to a substrate or compound suitable to be used as a source of carbon for prokaryotic or simple eukaryotic cell growth. Carbon sources can be in various forms, including, but not limited to polymers, carbohydrates, acids, alcohols, aldehydes, ketones, amino acids, peptides, and gases (e.g., CO and CO.sub.2). Exemplary carbon sources include, but are not limited to, monosaccharides, such as glucose, fructose, mannose, galactose, xylose, and arabinose; oligosaccharides, such as fructo-oligosaccharide and galacto-oligosaccharide; polysaccharides such as starch, cellulose, pectin, and xylan; disaccharides, such as sucrose, maltose, cellobiose, and turanose; cellulosic material and variants such as hemicelluloses, methyl cellulose and sodium carboxymethyl cellulose; saturated or unsaturated fatty acids, succinate, lactate, and acetate; alcohols, such as ethanol, methanol, and glycerol, or mixtures thereof. The carbon source can also be a product of photosynthesis, such as glucose. In certain preferred embodiments, the carbon source is biomass. In other preferred embodiments, the carbon source is glucose. In other preferred embodiments the carbon source is sucrose.
(67) As used herein, the term biomass refers to any biological material from which a carbon source is derived. In some embodiments, a biomass is processed into a carbon source, which is suitable for bioconversion. In other embodiments, the biomass does not require further processing into a carbon source. The carbon source can be converted into a biofuel. An exemplary source of biomass is plant matter or vegetation, such as corn, sugar cane, or switchgrass. Another exemplary source of biomass is metabolic waste products, such as animal matter (e.g., cow manure). Further exemplary sources of biomass include algae and other marine plants. Biomass also includes waste products from industry, agriculture, forestry, and households, including, but not limited to, fermentation waste, ensilage, straw, lumber, sewage, garbage, cellulosic urban waste, and food leftovers. The term biomass also can refer to sources of carbon, such as carbohydrates (e.g., monosaccharides, disaccharides, or polysaccharides).
(68) As used herein, the term isolated, with respect to products (such as fatty acids and derivatives thereof) refers to products that are separated from cellular components, cell culture media, or chemical or synthetic precursors. The fatty acids and derivatives thereof produced by the methods described herein can be relatively immiscible in the fermentation broth, as well as in the cytoplasm. Therefore, the fatty acids and derivatives thereof can collect in an organic phase either intracellularly or extracellularly.
(69) As used herein, the terms purify, purified, or purification mean the removal or isolation of a molecule from its environment by, for example, isolation or separation. Substantially purified molecules are at least about 60% free (e.g., at least about 70% free, at least about 75% free, at least about 85% free, at least about 90% free, at least about 95% free, at least about 97% free, at least about 99% free) from other components with which they are associated. As used herein, these terms also refer to the removal of contaminants from a sample. For example, the removal of contaminants can result in an increase in the percentage of a fatty aldehyde or a fatty alcohol in a sample. For example, when a fatty aldehyde or a fatty alcohol is produced in a recombinant host cell, the fatty aldehyde or fatty alcohol can be purified by the removal of recombinant host cell proteins. After purification, the percentage of a fatty aldehyde or a fatty alcohol in the sample is increased. The terms purify, purified, and purification are relative terms which do not require absolute purity. Thus, for example, when a fatty aldehyde or a fatty alcohol is produced in recombinant host cells, a purified fatty aldehyde or a purified fatty alcohol is a fatty aldehyde or a fatty alcohol that is substantially separated from other cellular components (e.g., nucleic acids, polypeptides, lipids, carbohydrates, or other hydrocarbons).
(70) Strain Improvements
(71) In order to meet very high targets for titer, yield, and/or productivity of fatty alcohols, a number of modifications were made to the production host cells. FadR is a key regulatory factor involved in fatty acid degradation and fatty acid biosynthesis pathways (Cronan et al., Mol. Microbiol., 29(4): 937-943 (1998)). The E. coli ACS enzyme FadD and the fatty acid transport protein FadL are essential components of a fatty acid uptake system. FadL mediates transport of fatty acids into the bacterial cell, and FadD mediates formation of acyl-CoA esters. When no other carbon source is available, exogenous fatty acids are taken up by bacteria and converted to acyl-CoA esters, which can bind to the transcription factor FadR and derepress the expression of the fad genes that encode proteins responsible for fatty acid transport (FadL), activation (FadD), and -oxidation (FadA, FadB, FadE, and FadH). When alternative sources of carbon are available, bacteria synthesize fatty acids as acyl-ACPs, which are used for phospholipid synthesis, but are not substrates for -oxidation. Thus, acyl-CoA and acyl-ACP are both independent sources of fatty acids that can result in different end-products (Caviglia et al., J. Biol. Chem., 279(12): 1163-1169 (2004)). U.S. Provisional Application No. 61/470,989 describes improved methods of producing fatty acid derivatives in a host cell which is genetically engineered to have an altered level of expression of a FadR polypeptide as compared to the level of expression of the FadR polypeptide in a corresponding wild-type host cell.
(72) There are conflicting speculations in the art as to the limiting factors of fatty acid biosynthesis in host cells, such as E. coli. One approach to increasing the flux through fatty acid biosynthesis is to manipulate various enzymes in the pathway (
(73) Carboxylic Acid Reductase (CAR)
(74) Recombinant host cells have been engineered to produce fatty alcohols by expressing a thioesterase, which catalyzes the conversion of acyl-ACPs into free fatty acids (FFAs) and a carboxylic acid reductase (CAR), which converts free fatty acids into fatty aldehydes. Native (endogenous) aldehyde reductases present in the host cell (e.g., E. coli) can convert fatty aldehydes into fatty alcohols. Exemplary thioesterases are described for example in US Patent Publication No. 20100154293, expressly incorporated by reference herein. CarB, is an exemplary carboxylic acid reductase, a key enzyme in the fatty alcohol production pathway. WO2010/062480 describes a BLAST search using the NRRL 5646 CAR amino acid sequence (Genpept accession AAR91681) (SEQ ID NO: 6) as the query sequence, and use thereof in identification of approximately 20 homologous sequences.
(75) The terms carboxylic acid reductase, CAR, and fatty aldehyde biosynthetic polypeptide are used interchangeably herein. In practicing the disclosure, a gene encoding a carboxylic acid reductase polypeptide is expressed or overexpressed in the host cell. In some embodiments, the CarB polypeptide has the amino acid sequence of SEQ ID NO: 7. In other embodiments, the CarB polypeptide is a variant or mutant of SEQ ID NO: 7. In certain embodiments, the CarB polypeptide is from a mammalian cell, plant cell, insect cell, yeast cell, fungus cell, filamentous fungi cell, a bacterial cell, or any other organism. In some embodiments, the bacterial cell is a mycobacterium selected from the group consisting of Mycobacterium smegmatis, Mycobacterium abscessus, Mycobacterium avium, Mycobacterium bovis, Mycobacterium tuberculosis, Mycobacterium leprae, Mycobacterium marinum, and Mycobacterium ulcerans. In other embodiments, the bacterial cell is from a Nocardia species, for example, Nocardia NRRL 5646, Nocardia farcinica, Streptomyces griseus, Salinispora arenicola, or Clavibacter michiganenesis. In other embodiments, the CarB polypeptide is a homologue of CarB having an amino acid sequence that is at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the amino acid sequence of SEQ ID NO: 7. The identity of a CarB polypeptide having at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to the amino acid sequence of SEQ ID NO: 7 is not particularly limited, and one of ordinary skill in the art can readily identify homologues of E. coli MG1655 derived-CarB and determine its function using the methods described herein. In other embodiments, the CarB polypeptide contains a mutation at amino acid number 3, 12, 20, 28, 46, 74, 103, 191, 288, 473, 827, 926, 927, 930 or 1128 of SEQ ID NO: 7. Exemplary mutations are detailed in Table 10. Preferred fragments or mutants of a polypeptide retain some or all of the biological function (e.g., enzymatic activity) of the corresponding wild-type polypeptide. In some embodiments, the fragment or mutant retains at least about 75%, at least about 80%, at least about 90%, at least about 95%, or at least about 98% or more of the biological function of the corresponding wild-type polypeptide. In other embodiments, the fragment or mutant retains about 100% of the biological function of the corresponding wild-type polypeptide. Guidance in determining which amino acid residues may be substituted, inserted, or deleted without affecting biological activity may be found using computer programs well known in the art, for example, LASERGENE software (DNASTAR, Inc., Madison, Wis.).
(76) In yet other embodiments, a fragment or mutant exhibits increased biological function as compared to a corresponding wild-type polypeptide. For example, a fragment or mutant may display at least about a 10%, at least about a 25%, at least about a 50%, at least about a 75%, or at least about a 90% improvement in enzymatic activity as compared to the corresponding wild-type polypeptide. In other embodiments, the fragment or mutant displays at least about 100% (e.g., at least about 200%, or at least about 500%) improvement in enzymatic activity as compared to the corresponding wild-type polypeptide. It is understood that the polypeptides described herein may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on the polypeptide function. Whether or not a particular substitution will be tolerated (i.e., will not adversely affect desired biological function, such as DNA binding or enzyme activity) can be determined as described in Bowie et al. (Science, 247: 1306-1310 (1990)).
(77) As a result of the methods and variant enzymes of the present disclosure, one or more of the titer, yield, and/or productivity of the fatty acid or derivative thereof produced by the engineered host cell having an altered level of expression of a CarB polypeptide is increased relative to that of the corresponding wild-type host cell. To allow for maximum conversion of C12 and C14 fatty acids into fatty alcohols, CarB must be expressed at sufficient activity. An improved recombinant host cell would have a CAR enzyme that is expressed from, for example, the E. coli chromosome. As shown in Example 6, cells expressing the CarB enzyme from the chromosome have more carboxylic acid reductase activity relative to the original CarB and are able to convert more C12 and C14 fatty acids into fatty alcohols. CarB is a large gene (3.5 kb) and increases plasmid size considerably, making it difficult to use a pCL plasmid to test new genes during strain development. Approaches to increasing the activity of CarB, include increasing its solubility, stability, expression and/or functionality. In one exemplary approach, a fusion protein that contains 6 histidines and a thrombin cleavage site at the N-terminus of CarB is produced. This enzyme differs from CarB by an additional 60 nucleotides at the N-terminus, and is named CarB60. When CarB or CarB60 are expressed from the E. coli chromosome under control of the pTRC promoter, cells containing CarB60 have increased total cellular carboxylic acid reductase activity and convert more C12 and C14 free fatty acids (FFAs) into fatty alcohols. One of skill in the art will appreciate that this is one example of molecular engineering in order to achieve a greater conversion of C12 and C14 free fatty acids (FFAs) into fatty alcohols as illustrated in Example 6 (supra). Similar approaches are encompassed herein (see Example 7).
(78) Phosphopantetheine transferases (PPTases) (EC 2.7.8.7) catalyze the transfer of 4-phosphopantetheine from CoA to a substrate. Nocardia Car, CarB and several homologues thereof contain a putative attachment site for 4-phosphopantetheine (PPT) (He et al., Appl. Environ. Microbiol., 70(3): 1874-1881 (2004)). In some embodiments of the disclosure, a PPTase is expressed or overexpressed in an engineered host cell. In certain embodiments, the PPTase is EntD from E. coli MG1655 (SEQ ID NO:8). In some embodiments, a thioesterase and a carboxylic acid reductase are expressed or overexpressed in an engineered host cell. In certain embodiments, the thioesterase is tesA and the carboxylic acid reductase is carB. In other embodiments, a thioesterase, a carboxylic acid reductase and an alcohol dehydrogenase are expressed or overexpressed in an engineered host cell. In certain embodiments, the thioesterase is tesA, the carboxylic acid reductase is carB and the alcohol dehydrogenase is alrAadp1 (GenPept accession number CAG70248.1) from Acinetobacter baylyi ADP1 (SEQ ID NO: 4). In still other embodiments, a thioesterase, a carboxylic acid reductase, a PPTase, and an alcohol dehydrogenase are expressed or overexpressed in the engineered host cell. In certain embodiments, the thioesterase is tesA, the carboxylic acid reductase is carB, the PPTase is entD, and the alcohol dehydrogenase is alrAadp1. In still further embodiments, a modified host cell which expresses one or more of a thioesterase, a CAR, a PPTase, and an alcohol dehydrogenase also has one or more strain improvements. Exemplary strain improvements include, but are not limited to expression or overexpression of an acetyl-CoA carboxylase polypeptide, overexpression of a FadR polypeptide, expression or overexpression of a heterologous iFAB operon, or transposon insertion in the yijP gene or another gene, or similar approaches. The disclosure also provides a fatty alcohol composition produced by any of the methods described herein. A fatty alcohol composition produced by any of the methods described herein can be used directly as a starting materials for production of other chemical compounds (e.g., polymers, surfactants, plastics, textiles, solvents, adhesives, etc.), or personal care additives. These compounds can also be used as feedstock for subsequent reactions, for example, hydrogenation, catalytic cracking (e.g., via hydrogenation, pyrolisis, or both) to make other products.
(79) Mutants or Variants
(80) In some embodiments, the polypeptide expressed in a recombinant host cell is a mutant or a variant of any of the polypeptides described herein. The terms mutant and variant as used herein refer to a polypeptide having an amino acid sequence that differs from a wild-type polypeptide by at least one amino acid. For example, the mutant can comprise one or more of the following conservative amino acid substitutions: replacement of an aliphatic amino acid, such as alanine, valine, leucine, and isoleucine, with another aliphatic amino acid; replacement of a serine with a threonine; replacement of a threonine with a serine; replacement of an acidic residue, such as aspartic acid and glutamic acid, with another acidic residue; replacement of a residue bearing an amide group, such as asparagine and glutamine, with another residue bearing an amide group; exchange of a basic residue, such as lysine and arginine, with another basic residue; and replacement of an aromatic residue, such as phenylalanine and tyrosine, with another aromatic residue. In some embodiments, the mutant polypeptide has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, or more amino acid substitutions, additions, insertions, or deletions. Preferred fragments or mutants of a polypeptide retain some or all of the biological function (e.g., enzymatic activity) of the corresponding wild-type polypeptide. In some embodiments, the fragment or mutant retains at least about 75%, at least about 80%, at least about 90%, at least about 95%, or at least about 98% or more of the biological function of the corresponding wild-type polypeptide. In other embodiments, the fragment or mutant retains about 100% of the biological function of the corresponding wild-type polypeptide. Guidance in determining which amino acid residues may be substituted, inserted, or deleted without affecting biological activity may be found using computer programs well known in the art, for example, LASERGENE software (DNASTAR, Inc., Madison, Wis.).
(81) In yet other embodiments, a fragment or mutant exhibits increased biological function as compared to a corresponding wild-type polypeptide. For example, a fragment or mutant may display at least a 10%, at least a 25%, at least a 50%, at least a 75%, or at least a 90% improvement in enzymatic activity as compared to the corresponding wild-type polypeptide. In other embodiments, the fragment or mutant displays at least 100% (e.g., at least 200%, or at least 500%) improvement in enzymatic activity as compared to the corresponding wild-type polypeptide. It is understood that the polypeptides described herein may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on the polypeptide function. Whether or not a particular substitution will be tolerated (i.e., will not adversely affect desired biological function, such as carboxylic acid reductase activity) can be determined as described in Bowie et al. (Science, 247: 1306-1310 (1990)). A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Variants can be naturally occurring or created in vitro. In particular, such variants can be created using genetic engineering techniques, such as site directed mutagenesis, random chemical mutagenesis, Exonuclease III deletion procedures, or standard cloning techniques. Alternatively, such variants, fragments, analogs, or derivatives can be created using chemical synthesis or modification procedures.
(82) Methods of making variants are well known in the art. These include procedures in which nucleic acid sequences obtained from natural isolates are modified to generate nucleic acids that encode polypeptides having characteristics that enhance their value in industrial or laboratory applications. In such procedures, a large number of variant sequences having one or more nucleotide differences with respect to the sequence obtained from the natural isolate are generated and characterized. Typically, these nucleotide differences result in amino acid changes with respect to the polypeptides encoded by the nucleic acids from the natural isolates. For example, variants can be prepared by using random and site-directed mutagenesis. Random and site-directed mutagenesis are described in, for example, Arnold, Curr. Opin. Biotech., 4: 450-455 (1993). Random mutagenesis can be achieved using error prone PCR (see, e.g., Leung et al., Technique, 1: 11-15 (1989); and Caldwell et al., PCR Methods Applic., 2: 28-33 (1992)). In error prone PCR, PCR is performed under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product. Briefly, in such procedures, nucleic acids to be mutagenized (e.g., a polynucleotide sequence encoding a carboxylic reductase enzyme) are mixed with PCR primers, reaction buffer, MgCl.sub.2, MnCl.sub.2, Taq polymerase, and an appropriate concentration of dNTPs for achieving a high rate of point mutation along the entire length of the PCR product. For example, the reaction can be performed using 20 fmoles of nucleic acid to be mutagenized, 30 pmole of each PCR primer, a reaction buffer comprising 50 mM KCl, 10 mM Tris HCl (pH 8.3), 0.01% gelatin, 7 mM MgCl.sub.2, 0.5 mM MnCl.sub.2, 5 units of Taq polymerase, 0.2 mM dGTP, 0.2 mM dATP, 1 mM dCTP, and 1 mM dTTP. PCR can be performed for 30 cycles of 94 C. for 1 min, 45 C. for 1 min, and 72 C. for 1 min. However, it will be appreciated that these parameters can be varied as appropriate. The mutagenized nucleic acids are then cloned into an appropriate vector, and the activities of the polypeptides encoded by the mutagenized nucleic acids are evaluated (see Example 7). Site-directed mutagenesis can be achieved using oligonucleotide-directed mutagenesis to generate site-specific mutations in any cloned DNA of interest. Oligonucleotide mutagenesis is described in, for example, Reidhaar-Olson et al., Science, 241: 53-57 (1988). Briefly, in such procedures a plurality of double stranded oligonucleotides bearing one or more mutations to be introduced into the cloned DNA are synthesized and inserted into the cloned DNA to be mutagenized (e.g., a polynucleotide sequence encoding a CAR polypeptide). Clones containing the mutagenized DNA are recovered, and the activities of the polypeptides they encode are assessed. Another method for generating variants is assembly PCR. Assembly PCR involves the assembly of a PCR product from a mixture of small DNA fragments. A large number of different PCR reactions occur in parallel in the same vial, with the products of one reaction priming the products of another reaction. Assembly PCR is described in, for example, U.S. Pat. No. 5,965,408. Still another method of generating variants is sexual PCR mutagenesis. In sexual PCR mutagenesis, forced homologous recombination occurs between DNA molecules of different, but highly related, DNA sequences in vitro as a result of random fragmentation of the DNA molecule based on sequence homology. This is followed by fixation of the crossover by primer extension in a PCR reaction. Sexual PCR mutagenesis is described in, for example, Stemmer, Proc. Natl. Acad. Sci., U.S.A., 91: 10747-10751 (1994).
(83) Variants can also be created by in vivo mutagenesis. In some embodiments, random mutations in a nucleic acid sequence are generated by propagating the sequence in a bacterial strain, such as an E. coli strain, which carries mutations in one or more of the DNA repair pathways. Such mutator strains have a higher random mutation rate than that of a wild-type strain. Propagating a DNA sequence (e.g., a polynucleotide sequence encoding a CAR polypeptide) in one of these strains will eventually generate random mutations within the DNA. Mutator strains suitable for use for in vivo mutagenesis are described in, for example, International Patent Application Publication No. WO1991/016427. Variants can also be generated using cassette mutagenesis. In cassette mutagenesis, a small region of a double-stranded DNA molecule is replaced with a synthetic oligonucleotide cassette that differs from the native sequence. The oligonucleotide often contains a completely and/or partially randomized native sequence. Recursive ensemble mutagenesis can also be used to generate variants. Recursive ensemble mutagenesis is an algorithm for protein engineering (i.e., protein mutagenesis) developed to produce diverse populations of phenotypically related mutants whose members differ in amino acid sequence. This method uses a feedback mechanism to control successive rounds of combinatorial cassette mutagenesis. Recursive ensemble mutagenesis is described in, for example, Arkin et al., Proc. Natl. Acad. Sci., U.S.A., 89: 7811-7815 (1992). In some embodiments, variants are created using exponential ensemble mutagenesis. Exponential ensemble mutagenesis is a process for generating combinatorial libraries with a high percentage of unique and functional mutants, wherein small groups of residues are randomized in parallel to identify, at each altered position, amino acids which lead to functional proteins. Exponential ensemble mutagenesis is described in, for example, Delegrave et al., Biotech. Res, 11: 1548-1552 (1993). In some embodiments, variants are created using shuffling procedures wherein portions of a plurality of nucleic acids that encode distinct polypeptides are fused together to create chimeric nucleic acid sequences that encode chimeric polypeptides as described in, for example, U.S. Pat. Nos. 5,965,408 and 5,939,250.
(84) Insertional mutagenesis is mutagenesis of DNA by the insertion of one or more bases. Insertional mutations can occur naturally, mediated by virus or transposon, or can be artificially created for research purposes in the lab, e.g., by transposon mutagenesis. When exogenous DNA is integrated into that of the host, the severity of any ensuing mutation depends entirely on the location within the host's genome wherein the DNA is inserted. For example, significant effects may be evident if a transposon inserts in the middle of an essential gene, in a promoter region, or into a repressor or an enhancer region. Transposon mutagenesis and high-throughput screening was done to find beneficial mutations that increase the titer or yield of fatty alcohol. The disclosure provides recombinant host cells comprising (a) a polynucleotide sequence encoding a carboxylic acid reductase comprising an amino acid sequence having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 7 and (b) a polynucleotide encoding a polypeptide having carboxylic acid reductase activity, wherein the recombinant host cell is capable of producing a fatty aldehyde or a fatty alcohol.
(85) Engineering Host Cells
(86) In some embodiments, a polynucleotide (or gene) sequence is provided to a host cell by way of a recombinant vector, which comprises a promoter operably linked to the polynucleotide sequence. In certain embodiments, the promoter is a developmentally-regulated, an organelle-specific, a tissue-specific, an inducible, a constitutive, or a cell-specific promoter. In some embodiments, the recombinant vector includes (a) an expression control sequence operatively coupled to the polynucleotide sequence; (b) a selection marker operatively coupled to the polynucleotide sequence; (c) a marker sequence operatively coupled to the polynucleotide sequence; (d) a purification moiety operatively coupled to the polynucleotide sequence; (e) a secretion sequence operatively coupled to the polynucleotide sequence; and (f) a targeting sequence operatively coupled to the polynucleotide sequence. The expression vectors described herein include a polynucleotide sequence described herein in a form suitable for expression of the polynucleotide sequence in a host cell. It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of polypeptide desired, etc. The expression vectors described herein can be introduced into host cells to produce polypeptides, including fusion polypeptides, encoded by the polynucleotide sequences described herein. Expression of genes encoding polypeptides in prokaryotes, for example, E. coli, is most often carried out with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion polypeptides. Fusion vectors add a number of amino acids to a polypeptide encoded therein, usually to the amino- or carboxy-terminus of the recombinant polypeptide. Such fusion vectors typically serve one or more of the following three purposes: (1) to increase expression of the recombinant polypeptide; (2) to increase the solubility of the recombinant polypeptide; and (3) to aid in the purification of the recombinant polypeptide by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant polypeptide. This enables separation of the recombinant polypeptide from the fusion moiety after purification of the fusion polypeptide. Examples of such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin, and enterokinase. Exemplary fusion expression vectors include pGEX (Pharmacia Biotech, Inc., Piscataway, N.J.; Smith et al., Gene, 67: 31-40 (1988)), pMAL (New England Biolabs, Beverly, Mass.), and pRITS (Pharmacia Biotech, Inc., Piscataway, N.J.), which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant polypeptide.
(87) Examples of inducible, non-fusion E. coli expression vectors include pTrc (Amann et al., Gene (1988) 69:301-315) and pET 11d (Studier et al., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89). Target gene expression from the pTrc vector relies on host RNA polymerase transcription from a hybrid trp-lac fusion promoter. Target gene expression from the pET 11d vector relies on transcription from a T7 gn10-lac fusion promoter mediated by a coexpressed viral RNA polymerase (T7 gn1). This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident prophage harboring a T7 gn1 gene under the transcriptional control of the lacUV 5 promoter. Suitable expression systems for both prokaryotic and eukaryotic cells are well known in the art; see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, second edition, Cold Spring Harbor Laboratory, (1989). Examples of inducible, non-fusion E. coli expression vectors include pTrc (Amann et al., Gene, 69: 301-315 (1988)) and PET 11d (Studier et al., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif., pp. 60-89 (1990)). In certain embodiments, a polynucleotide sequence of the disclosure is operably linked to a promoter derived from bacteriophage T5. In one embodiment, the host cell is a yeast cell. In this embodiment, the expression vector is a yeast expression vector. Vectors can be introduced into prokaryotic or eukaryotic cells via a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell. Suitable methods for transforming or transfecting host cells can be found in, for example, Sambrook et al. (supra). For stable transformation of bacterial cells, it is known that, depending upon the expression vector and transformation technique used, only a small fraction of cells will take-up and replicate the expression vector. In some embodiments, in order to identify and select these transformants, a gene that encodes a selectable marker (e.g., resistance to an antibiotic) is introduced into the host cells along with the gene of interest. Selectable markers include those that confer resistance to drugs such as, but not limited to, ampicillin, kanamycin, chloramphenicol, or tetracycline. Nucleic acids encoding a selectable marker can be introduced into a host cell on the same vector as that encoding a polypeptide described herein or can be introduced on a separate vector. Cells stably transformed with the introduced nucleic acid can be identified by growth in the presence of an appropriate selection drug.
(88) Production of Fatty Alcohol Compositions by Recombinant Host Cells
(89) Strategies to increase production of fatty alcohols by recombinant host cells include increased flux through the fatty acid biosynthetic pathway by overexpression of native fatty acid biosynthesis genes and expression of exogenous fatty acid biosynthesis genes from different organisms in an engineered production host. Enhanced activity of relevant enzymes in the fatty alcohol biosynthetic pathway, e.g., CAR, as well as other strategies to optimize the growth and productivity of the host cell may also be employed to maximize production. In some embodiments, the recombinant host cell comprises a polynucleotide encoding a polypeptide (an enzyme) having fatty alcohol biosynthetic activity (i.e., a fatty alcohol biosynthetic polypeptide or a fatty alcohol biosynthetic enzyme), and a fatty alcohol is produced by the recombinant host cell. A composition comprising fatty alcohols (a fatty alcohol composition) may be produced by culturing the recombinant host cell in the presence of a carbon source under conditions effective to express a fatty alcohol biosynthetic enzyme. In some embodiments, the fatty alcohol composition comprises fatty alcohols, however, a fatty alcohol composition may comprise other fatty acid derivatives. Typically, the fatty alcohol composition is recovered from the extracellular environment of the recombinant host cell, i.e., the cell culture medium. In one approach, recombinant host cells have been engineered to produce fatty alcohols by expressing a thioesterase, which catalyzes the conversion of acyl-ACPs into free fatty acids (FFAs) and a carboxylic acid reductase (CAR), which converts free fatty acids into fatty aldehydes. Native (endogenous) aldehyde reductases present in the host cell (e.g., E. coli) can convert the fatty aldehydes into fatty alcohols. In some embodiments, the fatty alcohol is produced by expressing or overexpressing in the recombinant host cell a polynucleotide encoding a polypeptide having fatty alcohol biosynthetic activity which converts a fatty aldehyde to a fatty alcohol. For example, an alcohol dehydrogenase (also referred to herein as an aldehyde reductase, e.g., EC 1.1.1.1), may be used in practicing the disclosure. As used herein, the term alcohol dehydrogenase refers to a polypeptide capable of catalyzing the conversion of a fatty aldehyde to an alcohol (e.g., a fatty alcohol). One of ordinary skill in the art will appreciate that certain alcohol dehydrogenases are capable of catalyzing other reactions as well, and these non-specific alcohol dehydrogenases also are encompassed by the term alcohol dehydrogenase. Examples of alcohol dehydrogenase polypeptides useful in accordance with the disclosure include, but are not limited to AlrAadp1 (SEQ ID NO: 4) or AlrA homologs and endogenous E. coli alcohol dehydrogenases such as YjgB, (AAC77226) (SEQ ID NO: 5), DkgA (NP_417485), DkgB (NP_414743), YdjL (AAC74846), YdjJ (NP_416288), AdhP (NP_415995), YhdH (NP_417719), YahK (NP_414859), YphC (AAC75598), YqhD (446856) and YbbO [AAC73595.1]. Additional examples are described in International Patent Application Publication Nos. WO2007/136762, WO2008/119082 and WO 2010/062480, each of which is expressly incorporated by reference herein. In certain embodiments, the fatty alcohol biosynthetic polypeptide has aldehyde reductase or alcohol dehydrogenase activity (EC 1.1.1.1). In another approach, recombinant host cells have been engineered to produce fatty alcohols by expressing fatty alcohol forming acyl-CoA reductases or fatty acyl reductases (FARs) which convert fatty acyl-thioester substrates (e.g., fatty acyl-CoA or fatty acyl-ACP) to fatty alcohols. In some embodiments, the fatty alcohol is produced by expressing or overexpressing a polynucleotide encoding a polypeptide having fatty alcohol forming acyl-CoA reductase (FAR) activity in a recombinant host cell. Examples of FAR polypeptides useful in accordance with this embodiment are described in PCT Publication No. WO2010/062480, which is expressly incorporated by reference herein.
(90) Fatty alcohol may be produced via an acyl-CoA dependent pathway utilizing fatty acyl-ACP and fatty acyl-CoA intermediates and an acyl-CoA independent pathway utilizing fatty acyl-ACP intermediates but not a fatty acyl-CoA intermediate. In particular embodiments, the enzyme encoded by the over expressed gene is selected from a fatty acid synthase, an acyl-ACP thioesterase, a fatty acyl-CoA synthase and an acetyl-CoA carboxylase. In some embodiments, the protein encoded by the over expressed gene is endogenous to the host cell. In other embodiments, the protein encoded by the overexpressed gene is heterologous to the host cell. Fatty alcohols are also made in nature by enzymes that are able to reduce various acyl-ACP or acyl-CoA molecules to the corresponding primary alcohols. See also, U.S. Patent Publication Nos. 20100105963, and 20110206630 and U.S. Pat. No. 8,097,439, expressly incorporated by reference herein. As used herein, a recombinant host cell or an engineered host cell refers to a host cell whose genetic makeup has been altered relative to the corresponding wild-type host cell, for example, by deliberate introduction of new genetic elements and/or deliberate modification of genetic elements naturally present in the host cell. The offspring of such recombinant host cells also contain these new and/or modified genetic elements. In any of the aspects of the disclosure described herein, the host cell can be selected from the group consisting of a plant cell, insect cell, fungus cell (e.g., a filamentous fungus, such as Candida sp., or a budding yeast, such as Saccharomyces sp.), an algal cell and a bacterial cell. In one preferred embodiment, recombinant host cells are recombinant microbial cells. Examples of host cells that are microbial cells, include but are not limited to cells from the genus Escherichia, Bacillus, Lactobacillus, Zymomonas, Rhodococcus, Pseudomonas, Aspergillus, Trichoderma, Neurospora, Fusarium, Humicola, Rhizomucor, Kluyveromyces, Pichia, Mucor, Myceliophtora, Penicillium, Phanerochaete, Pleurotus, Trametes, Chrysosporium, Saccharomyces, Stenotrophamonas, Schizosaccharomyces, Yarrowia, or Streptomyces. In some embodiments, the host cell is a Gram-positive bacterial cell. In other embodiments, the host cell is a Gram-negative bacterial cell. In some embodiments, the host cell is an E. coli cell. In other embodiments, the host cell is a Bacillus lentus cell, a Bacillus brevis cell, a Bacillus stearothermophilus cell, a Bacillus lichenoformis cell, a Bacillus alkalophilus cell, a Bacillus coagulans cell, a Bacillus circulans cell, a Bacillus pumilis cell, a Bacillus thuringiensis cell, a Bacillus clausii cell, a Bacillus megaterium cell, a Bacillus subtilis cell, or a Bacillus amyloliquefaciens cell. In other embodiments, the host cell is a Trichoderma koningii cell, a Trichoderma viride cell, a Trichoderma reesei cell, a Trichoderma longibrachiatum cell, an Aspergillus awamori cell, an Aspergillus fumigates cell, an Aspergillus foetidus cell, an Aspergillus nidulans cell, an Aspergillus niger cell, an Aspergillus oryzae cell, a Humicola insolens cell, a Humicola lanuginose cell, a Rhodococcus opacus cell, a Rhizomucor miehei cell, or a Mucor michei cell.
(91) In yet other embodiments, the host cell is a Streptomyces lividans cell or a Streptomyces murinus cell. In yet other embodiments, the host cell is an Actinomycetes cell. In some embodiments, the host cell is a Saccharomyces cerevisiae cell. In some embodiments, the host cell is a Saccharomyces cerevisiae cell. In other embodiments, the host cell is a cell from a eukaryotic plant, algae, cyanobacterium, green-sulfur bacterium, green non-sulfur bacterium, purple sulfur bacterium, purple non-sulfur bacterium, extremophile, yeast, fungus, an engineered organism thereof, or a synthetic organism. In some embodiments, the host cell is light-dependent or fixes carbon. In some embodiments, the host cell is light-dependent or fixes carbon. In some embodiments, the host cell has autotrophic activity. In some embodiments, the host cell has photoautotrophic activity, such as in the presence of light. In some embodiments, the host cell is heterotrophic or mixotrophic in the absence of light. In certain embodiments, the host cell is a cell from Avabidopsis thaliana, Panicum virgatum, Miscanthus giganteus, Zea mays, Botryococcuse braunii, Chlamydomonas reinhardtii, Dunaliela salina, Synechococcus Sp. PCC 7002, Synechococcus Sp. PCC 7942, Synechocystis Sp. PCC 6803, Thermosynechococcus elongates BP-1, Chlorobium tepidum, Chlorojlexus auranticus, Chromatiumm vinosum, Rhodospirillum rubrum, Rhodobacter capsulatus, Rhodopseudomonas palusris, Clostridium ljungdahlii, Clostridiuthermocellum, Penicillium chrysogenum, Pichia pastoris, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pseudomonasjluorescens, or Zymomonas mobilis.
(92) Culture and Fermentation of Engineered Host Cells
(93) As used herein, fermentation broadly refers to the conversion of organic materials into target substances by host cells, for example, the conversion of a carbon source by recombinant host cells into fatty acids or derivatives thereof by propagating a culture of the recombinant host cells in a media comprising the carbon source. As used herein, conditions permissive for the production means any conditions that allow a host cell to produce a desired product, such as a fatty acid or a fatty acid derivative. Similarly, conditions in which the polynucleotide sequence of a vector is expressed means any conditions that allow a host cell to synthesize a polypeptide. Suitable conditions include, for example, fermentation conditions. Fermentation conditions can comprise many parameters, including but not limited to temperature ranges, levels of aeration, feed rates and media composition. Each of these conditions, individually and in combination, allows the host cell to grow. Fermentation can be aerobic, anaerobic, or variations thereof (such as micro-aerobic). Exemplary culture media include broths or gels. Generally, the medium includes a carbon source that can be metabolized by a host cell directly. In addition, enzymes can be used in the medium to facilitate the mobilization (e.g., the depolymerization of starch or cellulose to fermentable sugars) and subsequent metabolism of the carbon source. For small scale production, the engineered host cells can be grown in batches of, for example, about 100 mL, 500 mL, 1 L, 2 L, 5 L, or 10 L; fermented; and induced to express a desired polynucleotide sequence, such as a polynucleotide sequence encoding a CAR polypeptide. For large scale production, the engineered host cells can be grown in batches of about 10 L, 100 L, 1000 L, 10,000 L, 100,000 L, 1,000,000 L or larger; fermented; and induced to express a desired polynucleotide sequence. Alternatively, large scale fed-batch fermentation may be carried out.
(94) Fatty Alcohol Compositions
(95) The fatty alcohol compositions described herein are found in the extracellular environment of the recombinant host cell culture and can be readily isolated from the culture medium. A fatty alcohol composition may be secreted by the recombinant host cell, transported into the extracellular environment or passively transferred into the extracellular environment of the recombinant host cell culture. The fatty alcohol composition is isolated from a recombinant host cell culture using routine methods known in the art. The disclosure provides compositions produced by engineered or recombinant host cells (bioproducts) which include one or more fatty aldehydes and/or fatty alcohols. Although a fatty alcohol component with a particular chain length and degree of saturation may constitute the majority of the bioproduct produced by a cultured engineered or recombinant host cell, the composition typically includes a mixture of fatty aldehydes and/or fatty alcohols that vary with respect to chain length and/or degree of saturation. As used herein, fraction of modern carbon or f.sub.M has the same meaning as defined by National Institute of Standards and Technology (NIST) Standard Reference Materials (SRMs 4990B and 4990C, known as oxalic acids standards HOxI and HOxII, respectively. The fundamental definition relates to 0.95 times the .sup.14C/.sup.12C isotope ratio HOxI (referenced to AD 1950). This is roughly equivalent to decay-corrected pre-Industrial Revolution wood. For the current living biosphere (plant material), f.sub.M is approximately 1.1.
(96) Bioproducts (e.g., the fatty aldehydes and alcohols produced in accordance with the present disclosure) comprising biologically produced organic compounds, and in particular, the fatty aldehydes and alcohols biologically produced using the fatty acid biosynthetic pathway herein, have not been produced from renewable sources and, as such, are new compositions of matter. These new bioproducts can be distinguished from organic compounds derived from petrochemical carbon on the basis of dual carbon-isotopic fingerprinting or .sup.14C dating. Additionally, the specific source of biosourced carbon (e.g., glucose vs. glycerol) can be determined by dual carbon-isotopic fingerprinting (see, e.g., U.S. Pat. No. 7,169,588, which is herein incorporated by reference). The ability to distinguish bioproducts from petroleum based organic compounds is beneficial in tracking these materials in commerce. For example, organic compounds or chemicals comprising both biologically based and petroleum based carbon isotope profiles may be distinguished from organic compounds and chemicals made only of petroleum based materials. Hence, the bioproducts herein can be followed or tracked in commerce on the basis of their unique carbon isotope profile. Bioproducts can be distinguished from petroleum based organic compounds by comparing the stable carbon isotope ratio (.sup.13C/.sup.12C) in each fuel. The .sup.13C/.sup.12C ratio in a given bioproduct is a consequence of the .sup.13C/.sup.12C ratio in atmospheric carbon dioxide at the time the carbon dioxide is fixed. It also reflects the precise metabolic pathway. Regional variations also occur. Petroleum, C.sub.3 plants (the broadleaf), C.sub.4 plants (the grasses), and marine carbonates all show significant differences in .sup.13C/.sup.12C and the corresponding .sup.13C values. Furthermore, lipid matter of C.sub.3 and C.sub.4 plants analyze differently than materials derived from the carbohydrate components of the same plants as a consequence of the metabolic pathway. Within the precision of measurement, .sup.13C shows large variations due to isotopic fractionation effects, the most significant of which for bioproducts is the photosynthetic mechanism. The major cause of differences in the carbon isotope ratio in plants is closely associated with differences in the pathway of photosynthetic carbon metabolism in the plants, particularly the reaction occurring during the primary carboxylation (i.e., the initial fixation of atmospheric CO.sub.2). Two large classes of vegetation are those that incorporate the C.sub.3 (or Calvin-Benson) photosynthetic cycle and those that incorporate the C.sub.4 (or Hatch-Slack) photosynthetic cycle. In C.sub.3 plants, the primary CO.sub.2 fixation or carboxylation reaction involves the enzyme ribulose-1,5-diphosphate carboxylase, and the first stable product is a 3-carbon compound. C.sub.3 plants, such as hardwoods and conifers, are dominant in the temperate climate zones. In C.sub.4 plants, an additional carboxylation reaction involving another enzyme, phosphoenol-pyruvate carboxylase, is the primary carboxylation reaction. The first stable carbon compound is a 4-carbon acid that is subsequently decarboxylated. The CO.sub.2 thus released is refixed by the C.sub.3 cycle. Examples of C.sub.4 plants are tropical grasses, corn, and sugar cane. Both C.sub.4 and C.sub.3 plants exhibit a range of .sup.13C/.sup.12C isotopic ratios, but typical values are about 7 to about 13 per mil for C.sub.4 plants and about 19 to about 27 per mil for C.sub.3 plants (see, e.g., Stuiver et al., Radiocarbon 19:355 (1977)). Coal and petroleum fall generally in this latter range. The .sup.13C measurement scale was originally defined by a zero set by Pee Dee Belemnite (PDB) limestone, where values are given in parts per thousand deviations from this material. The .sup.13C values are expressed in parts per thousand (per mil), abbreviated, , and are calculated as follows:
.sup.13C()=[(.sup.13C/.sup.12C).sub.sample(.sup.13C/.sup.12C).sub.standard]/(.sup.13C/.sup.12C).sub.standard1000
Since the PDB reference material (RM) has been exhausted, a series of alternative RMs have been developed in cooperation with the IAEA, USGS, NIST, and other selected international isotope laboratories. Notations for the per mil deviations from PDB is .sup.13C. Measurements are made on CO.sub.2 by high precision stable ratio mass spectrometry (IRMS) on molecular ions of masses 44, 45, and 46. The compositions described herein include bioproducts produced by any of the methods described herein, including, for example, fatty aldehyde and alcohol products. Specifically, the bioproduct can have a .sup.13C of about 28 or greater, about 27 or greater, 20 or greater, 18 or greater, 15 or greater, 13 or greater, 10 or greater, or 8 or greater. For example, the bioproduct can have a .sup.13C of about 30 to about 15, about 27 to about 19, about 25 to about 21, about 15 to about 5, about 13 to about 7, or about 13 to about 10. In other instances, the bioproduct can have a .sup.13C of about 10, 11, 12, or 12.3. Bioproducts, including the bioproducts produced in accordance with the disclosure herein, can also be distinguished from petroleum based organic compounds by comparing the amount of .sup.14C in each compound. Because .sup.14C has a nuclear half-life of 5730 years, petroleum based fuels containing older carbon can be distinguished from bioproducts which contain newer carbon (see, e.g., Currie, Source Apportionment of Atmospheric Particles, Characterization of Environmental Particles, J. Buffle and H. P. van Leeuwen, Eds., 1 of Vol. I of the IUPAC Environmental Analytical Chemistry Series (Lewis Publishers, Inc.) 3-74, (1992)).
(97) The basic assumption in radiocarbon dating is that the constancy of .sup.14C concentration in the atmosphere leads to the constancy of .sup.14C in living organisms. However, because of atmospheric nuclear testing since 1950 and the burning of fossil fuel since 1850, .sup.14C has acquired a second, geochemical time characteristic. Its concentration in atmospheric CO.sub.2, and hence in the living biosphere, approximately doubled at the peak of nuclear testing, in the mid-1960s. It has since been gradually returning to the steady-state cosmogenic (atmospheric) baseline isotope rate (.sup.14C/.sup.12C) of about 1.210.sup.12, with an approximate relaxation half-life of 7-10 years. (This latter half-life must not be taken literally; rather, one must use the detailed atmospheric nuclear input/decay function to trace the variation of atmospheric and biospheric .sup.14C since the onset of the nuclear age.) It is this latter biospheric .sup.14C time characteristic that holds out the promise of annual dating of recent biospheric carbon. .sup.14C can be measured by accelerator mass spectrometry (AMS), with results given in units of fraction of modern carbon (f.sub.M). f.sub.M is defined by National Institute of Standards and Technology (NIST) Standard Reference Materials (SRMs) 4990B and 4990C. As used herein, fraction of modern carbon (f.sub.M) has the same meaning as defined by National Institute of Standards and Technology (NIST) Standard Reference Materials (SRMs) 4990B and 4990C, known as oxalic acids standards HOxI and HOxII, respectively. The fundamental definition relates to 0.95 times the .sup.14C/.sup.12C isotope ratio HOxI (referenced to AD 1950). This is roughly equivalent to decay-corrected pre-Industrial Revolution wood. For the current living biosphere (plant material), f.sub.M is approximately 1.1. This is roughly equivalent to decay-corrected pre-Industrial Revolution wood. For the current living biosphere (plant material), f.sub.M is approximately 1.1.
(98) The compositions described herein include bioproducts that can have an f.sub.M .sup.14C of at least about 1. For example, the bioproduct of the disclosure can have an f.sub.M .sup.14C of at least about 1.01, an f.sub.M .sup.14C of about 1 to about 1.5, an f.sub.M .sup.14C of about 1.04 to about 1.18, or an f.sub.M .sup.14C of about 1.111 to about 1.124. Another measurement of .sup.14C is known as the percent of modern carbon (pMC). For an archaeologist or geologist using .sup.14C dates, AD 1950 equals zero years old. This also represents 100 pMC. Bomb carbon in the atmosphere reached almost twice the normal level in 1963 at the peak of thermo-nuclear weapons. Its distribution within the atmosphere has been approximated since its appearance, showing values that are greater than 100 pMC for plants and animals living since AD 1950. It has gradually decreased over time with today's value being near 107.5 pMC. This means that a fresh biomass material, such as corn, would give a .sup.14C signature near 107.5 pMC. Petroleum based compounds will have a pMC value of zero. Combining fossil carbon with present day carbon will result in a dilution of the present day pMC content. By presuming 107.5 pMC represents the .sup.14C content of present day biomass materials and 0 pMC represents the .sup.14C content of petroleum based products, the measured pMC value for that material will reflect the proportions of the two component types. For example, a material derived 100% from present day soybeans would give a radiocarbon signature near 107.5 pMC. If that material was diluted 50% with petroleum based products, it would give a radiocarbon signature of approximately 54 pMC. A biologically based carbon content is derived by assigning 100% equal to 107.5 pMC and 0% equal to 0 pMC. For example, a sample measuring 99 pMC will give an equivalent biologically based carbon content of 93%. This value is referred to as the mean biologically based carbon result and assumes all the components within the analyzed material originated either from present day biological material or petroleum based material. A bioproduct comprising one or more fatty aldehydes or alcohols as described herein can have a pMC of at least about 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100. In other instances, a bioproduct described herein can have a pMC of between about 50 and about 100; about 60 and about 100; about 70 and about 100; about 80 and about 100; about 85 and about 100; about 87 and about 98; or about 90 and about 95. In yet other instances, a bioproduct described herein can have a pMC of about 90, 91, 92, 93, 94, or 94.2.
(99) Screening Fatty Alcohol Compositions Produced by Recombinant Host Cell
(100) To determine if conditions are sufficient to allow expression, a recombinant host cell comprising a heterologous gene or a modified native gene is cultured, for example, for about 4, 8, 12, 24, 36, or 48 hours. During and/or after culturing, samples can be obtained and analyzed to determine if the fatty alcohol production level (titer, yield or productivity) is different than that of the corresponding wild type parental cell which has not been modified. For example, the medium in which the host cells were grown can be tested for the presence of a desired product. When testing for the presence of a product, assays, such as, but not limited to, TLC, HPLC, GC/FID, GC/MS, LC/MS, MS, can be used. Recombinant host cell strains can be cultured in small volumes (0.001 L to 1 L) of media in plates or shake flasks in order to screen for altered fatty alcohol or fatty species production level. Once candidate strains or hits are identified at small scale, these strains are cultured in larger volumes (1 L to 1000 L) of media in bioreactors, tanks, and pilot plants to determine the precise fatty alcohol or fatty species production level. These large volume culture conditions are used by those skilled in the art to optimize the culture conditions to obtain desired fatty alcohol or fatty species production.
(101) Utility of Fatty Aldehyde and Fatty Alcohol Compositions
(102) Aldehydes are used to produce many specialty chemicals. For example, aldehydes are used to produce polymers, resins (e.g., Bakelite), dyes, flavorings, plasticizers, perfumes, pharmaceuticals, and other chemicals, some of which may be used as solvents, preservatives, or disinfectants. In addition, certain natural and synthetic compounds, such as vitamins and hormones, are aldehydes, and many sugars contain aldehyde groups. Fatty aldehydes can be converted to fatty alcohols by chemical or enzymatic reduction. Fatty alcohols have many commercial uses. Worldwide annual sales of fatty alcohols and their derivatives are in excess of U.S. $1 billion. The shorter chain fatty alcohols are used in the cosmetic and food industries as emulsifiers, emollients, and thickeners. Due to their amphiphilic nature, fatty alcohols behave as nonionic surfactants, which are useful in personal care and household products, such as, for example, detergents. In addition, fatty alcohols are used in waxes, gums, resins, pharmaceutical salves and lotions, lubricating oil additives, textile antistatic and finishing agents, plasticizers, cosmetics, industrial solvents, and solvents for fats. The disclosure also provides a surfactant composition or a detergent composition comprising a fatty alcohol produced by any of the methods described herein. One of ordinary skill in the art will appreciate that, depending upon the intended purpose of the surfactant or detergent composition, different fatty alcohols can be produced and used. For example, when the fatty alcohols described herein are used as a feedstock for surfactant or detergent production, one of ordinary skill in the art will appreciate that the characteristics of the fatty alcohol feedstock will affect the characteristics of the surfactant or detergent composition produced. Hence, the characteristics of the surfactant or detergent composition can be selected for by producing particular fatty alcohols for use as a feedstock. A fatty alcohol-based surfactant and/or detergent composition described herein can be mixed with other surfactants and/or detergents well known in the art. In some embodiments, the mixture can include at least about 10%, at least about 15%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, or a range bounded by any two of the foregoing values, by weight of the fatty alcohol. In other examples, a surfactant or detergent composition can be made that includes at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or a range bounded by any two of the foregoing values, by weight of a fatty alcohol that includes a carbon chain that is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 carbons in length. Such surfactant or detergent compositions also can include at least one additive, such as a microemulsion or a surfactant or detergent from nonmicrobial sources such as plant oils or petroleum, which can be present in the amount of at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or a range bounded by any two of the foregoing values, by weight of the fatty alcohol. The disclosure is further illustrated by the following examples. The examples are provided for illustrative purposes only. They are not to be construed as limiting the scope or content of the disclosure in any way.
EXAMPLES
Example 1
(103) Production Host ModificationsAttenuation of Acyl-CoA Dehydrogenase
(104) This example describes the construction of a genetically engineered host cell wherein the expression of a fatty acid degradation enzyme is attenuated. The fadE gene of Escherichia coli MG1655 (an E. coli K strain) was deleted using the Lambda Red (also known as the Red-Driven Integration) system described by Datsenko et al., Proc. Natl. Acad. Sci. USA 97: 6640-6645 (2000), with the following modifications:
(105) The following two primers were used to create the deletion of fadE:
(106) TABLE-US-00001 Del-fadE- (SEQIDNO:9) F5-AAAAACAGCAACAATGTGAGCTTTGTTGTAATTATATTGTAAACAT ATTGATTCCGGGGATCCGTCGACC; and Del-fadE- (SEQIDNO:10) R5-AAACGGAGCCTTTCGGCTCCGTTATTCATTTACGCGGCTTCAACTT TCCTGTAGGCTGGAGCTGCTTC
(107) The Del-fadE-F and Del-fadE-R primers were used to amplify the kanamycin resistance (KmR) cassette from plasmid pKD13 (described by Datsenko et al., supra) by PCR. The PCR product was then used to transform electrocompetent E. coli MG1655 cells containing pKD46 (described in Datsenko et al., supra) that had been previously induced with arabinose for 3-4 hours. Following a 3-hour outgrowth in a super optimal broth with catabolite repression (SOC) medium at 37 C., the cells were plated on Luria agar plates containing 50 g/mL of Kanamycin. Resistant colonies were identified and isolated after an overnight incubation at 37 C. Disruption of the fadE gene was confirmed by PCR amplification using primers fadE-L2 and fadE-R1, which were designed to flank the E. coli fadE gene.
(108) The fadE deletion confirmation primers were:
(109) TABLE-US-00002 (SEQIDNO:11) fadE-L25-CGGGCAGGTGCTATGACCAGGAC; and (SEQIDNO:12) fadE-R15-CGCGGCGTTGACCGGCAGCCTGG
(110) After the fadE deletion was confirmed, a single colony was used to remove the KmR marker using the pCP20 plasmid as described by Datsenko et al., supra. The resulting MG1655 E. coli strain with the fadE gene deleted and the KmR marker removed was named E. coli MG1655 fadE, or E. coli MG 1655 D1. Fatty acid derivative (Total Fatty Species) production by the MG1655 E. coli strain with the fadE gene deleted was compared to fatty acid derivative production by E. coli MG1655. Cells were transformed with production plasmid pDG109 (pCL1920_P.sub.TRC.sub._carBopt_12H08_alrAadp1_fabB[A329G]_fadR) and fermented in glucose minimal media. The data presented in
Example 2
(111) Increased Flux Through the Fatty Acid Synthesis PathwayAcetyl CoA Carboxylase Mediated
(112) The main precursors for fatty acid biosynthesis are malonyl-CoA and acetyl-CoA (
Example 3
(113) Increased Flux Through the Fatty Acid Synthesis PathwayiFABs
(114) Fatty Acid Derivative Production:
(115) Strategies to increase the flux through the fatty acid synthesis pathway in recombinant host cells include both overexpression of native E. coli fatty acid biosynthesis genes and expression of exogenous fatty acid biosynthesis genes from different organisms in E. coli. In this study, fatty acid biosynthesis genes from different organisms were combined in the genome of E. coli DV2. Sixteen strains containing iFABs 130-145 were evaluated. The detailed structure of iFABs 130-145 is presented in iFABs Table 1, below.
(116) TABLE-US-00003 TABLE 1 Components found in iFABs 130-145. Abbreviation Full Description St_fabD Salmonella typhimurium fabD gene nSt_fabH Salmonella typhimurium fabH gene with native RBS sSt_fabH Salmonella typhimurium fabH gene with synthetic RBS Cac_fabF Clostridium acetobutylicum (ATCC824) fabF gene St_fabG Salmonella typhimurium fabG gene St_fabA Salmonella typhimurium fabA gene St_fabZ Salmonella typhimurium fabZ gene BS_fabI Bacillus subtilis fabI gene BS_FabL Bacillus subtilis fabL gene Vc_FabV Vibrio cholerae fabV gene Ec_FabI Escherichia coli fabI gene
(117) Each iFAB included various fab genes in the following order: 1) an enoyl-ACP reductase (BS_fabI, BS_FabL, Vc_FabV, or Ec_FabI); 2) a b-ketoacyl-ACP synthetase III (St_fabH); 3) a malonyl-CoA-ACP transacylase (St_fabD); 4) a b-ketoacyl-ACP reductase (St_fabG); 5) a 3-hydroxy-acyl-ACP dehydratase (St_fabA or St_fabZ); 6) a b-ketoacyl-ACP synthetase II (Cac_fabF). Note that St_fabA also has trans-2, cis-3-decenoyl-ACP isomerase activity (ref) and that Cac_fabF has b-ketoacyl-ACP synthetase II and b-ketoacyl-ACP synthetase I activities (Zhu et al., BMC Microbiology 9:119 (2009)). See Table 2, below for the specific composition of iFABs 130-145. See
(118) TABLE-US-00004 TABLE 2 Composition of iFABs 130-145. ifab BS_fabI BS_fabL Vc_fabV Ec_fabI nSt_fabH sSt_fabH St_fabD St_fabG St_fabA St_fabZ Cac_fabF ifab130 1 0 0 0 1 0 1 1 1 0 1 ifab131 1 0 0 0 1 0 1 1 0 1 1 ifab132 1 0 0 0 0 1 1 1 1 0 1 ifab133 1 0 0 0 0 1 1 1 0 1 1 ifab134 0 1 0 0 1 0 1 1 1 0 1 ifab135 0 1 0 0 1 0 1 1 0 1 1 ifab136 0 1 0 0 0 1 1 1 1 0 1 ifab137 0 1 0 0 0 1 1 1 0 1 1 ifab138 0 0 1 0 1 0 1 1 1 0 1 ifab139 0 0 1 0 1 0 1 1 0 1 1 ifab140 0 0 1 0 0 1 1 1 1 0 1 ifab141 0 0 1 0 0 1 1 1 0 1 1 ifab142 0 0 0 1 1 0 1 1 1 0 1 ifab143 0 0 0 1 1 0 1 1 0 1 1 ifab144 0 0 0 1 0 1 1 1 1 0 1 ifab145 0 0 0 1 0 1 1 1 0 1 1
(119) The plasmid pCL_P.sub.trc.sub._tesA was transformed into each of the strains and a fermentation was run in FA2 media with 20 hours from induction to harvest at both 32 C. and 37 C. Data for production of Total Fatty Species from duplicate plate screens is shown in
(120) TABLE-US-00005 TABLE 3 Genetic Characterization of E. coli strains Strain Genetic Characterization DV2 MG1655 F-, -, ilvG-, rfb-50, rph-1, fhuA::FRT, fadE::FRT DV2.1 DV2 fabB::fabB[A329V] D178 DV2.1 entD::FRT_P.sub.T5_entD EG149 D178 insH-11::P.sub.LACUV5-iFAB138 V642 EG149 rph+ SL313 V642 lacIZ::P.sub.A1_tesA/pDG109 V668 V642 ilvG.sup.+ LC397 V668 lacIZ::P.sub.TRC_tesA(var)_kan SL571 V668 lacIZ::P.sub.TRC_tesA(var)_FRT LC942 SL571 attTn7::P.sub.TRC_tesA(var) DG16 LC942/pLC56 V940 LC397/pV171.1 D851 SL571 yijP::Tn5-cat/pV171.1
Plasmids: pDG109, pLC56 and pV171.1 are pCL_P.sub.trc.sub._carB_tesA_alrA_fabB_fadR operon with variable expression of carB and tesA. iFAB138 is SEQ ID NO: 13.
Example 4
(121) Increasing the Amount of Free Fatty Acid (FFA) Product by Repairing the Rph and ilvG Mutations
(122) The ilvG and rph mutations were corrected in this strain resulting in higher production of FFA. Strains D178, EG149 and V668 (Table 3) were transformed with pCL_P.sub.trc.sub._tesA. Fermentation was run at 32 C. in FA2 media for 40 hours to compare the FFA production of strains D178, EG149, and V668 with pCL_P.sub.trc.sub._tesA. Correcting the rph and ilvG mutations resulted in a 116% increase in the FFA production of the base strain with pCL_P.sub.trc.sub._tesA. As seen in
(123) A frozen cell bank vial of the selected E. coli strain was used to inoculate 20 mL of LB broth in a 125 mL baffled shake flask containing spectinomycin antibiotic at a concentration of 115 g/mL. This shake flask was incubated in an orbital shaker at 32 C. for approximately six hours, then 1.25 mL of the broth was transferred into 125 mL of low P FA2 seed media (2 g/L NH.sub.4Cl, 0.5 g/L NaCl, 3 g/L KH.sub.2PO.sub.4, 0.25 g/L MgSO.sub.4-7H2O, 0.015 g/L mM CaCl.sub.2-2H2O, 30 g/L glucose, 1 mL/L of a trace minerals solution (2 g/L of ZnCl.sub.2.4H.sub.2O, 2 g/L of CaCl.sub.2.6H.sub.2O, 2 g/L of Na.sub.2MoO.sub.4.2H.sub.2O, 1.9 g/L of CuSO.sub.4.5H.sub.2O, 0.5 g/L of H.sub.3BO.sub.3, and 10 mL/L of concentrated HCl), 10 mg/L of ferric citrate, 100 mM of Bis-Tris buffer (pH 7.0), and 115 g/mL of spectinomycin), in a 500 mL baffled Erlenmeyer shake flask, and incubated on a shaker overnight at 32 C. 100 mL of this low P FA2 seed culture was used to inoculate a 5 L Biostat Aplus bioreactor (Sartorius BBI), initially containing 1.9 L of sterilized F1 bioreactor fermentation medium. This medium is initially composed of 3.5 g/L of KH.sub.2PO.sub.4, 0.5 g/L of (NH.sub.4).sub.2SO.sub.4, 0.5 g/L of MgSO.sub.4 heptahydrate, 10 g/L of sterile filtered glucose, 80 mg/L ferric citrate, 5 g/L Casamino acids, 10 mL/L of the sterile filtered trace minerals solution, 1.25 mL/L of a sterile filtered vitamin solution (0.42 g/L of riboflavin, 5.4 g/L of pantothenic acid, 6 g/L of niacin, 1.4 g/L of pyridoxine, 0.06 g/L of biotin, and 0.04 g/L of folic acid), and the spectinomycin at the same concentration as utilized in the seed media. The pH of the culture was maintained at 6.9 using 28% w/v ammonia water, the temperature at 33 C., the aeration rate at 11 lpm (0.5 v/v/m), and the dissolved oxygen tension at 30% of saturation, utilizing the agitation loop cascaded to the DO controller and oxygen supplementation. Foaming was controlled by the automated addition of a silicone emulsion based antifoam (Dow Corning 1410).
(124) A nutrient feed composed of 3.9 g/L MgSO.sub.4 heptahydrate and 600 g/L glucose was started when the glucose in the initial medium was almost depleted (approximately 4-6 hours following inoculation) under an exponential feed rate of 0.3 hr.sup.1 to a constant maximal glucose feed rate of 10-12 g/L/hr, based on the nominal fermentation volume of 2 L. Production of fatty alcohol in the bioreactor was induced when the culture attained an OD of 5 AU (approximately 3-4 hours following inoculation) by the addition of a 1M IPTG stock solution to a final concentration of 1 mM. The bioreactor was sampled twice per day thereafter, and harvested approximately 72 hours following inoculation. A 0.5 mL sample of the well-mixed fermentation broth was transferred into a 15 mL conical tube (VWR), and thoroughly mixed with 5 mL of butyl acetate. The tube was inverted several times to mix, then vortexed vigorously for approximately two minutes. The tube was then centrifuged for five minutes to separate the organic and aqueous layers, and a portion of the organic layer transferred into a glass vial for gas chromatographic analysis.
Example 5
(125) Increased Production of Fatty Alcohol by Transposon MutagenesisyijP
(126) To improve the titer, yield, productivity of fatty alcohol production by E. coli, transposon mutagenesis and high-throughput screening was carried out and beneficial mutations were sequenced. A transposon insertion in the yijP strain was shown to improve the strain's fatty alcohol yield in both shake flask and fed-batch fermentations. The SL313 strain produces fatty alcohols. The genotype of this strain is provided in Table 3. Transposon clones were then subjected to high-throughput screening to measure production of fatty alcohols. Briefly, colonies were picked into deep-well plates containing LB, grown overnight, inoculated into fresh LB and grown for 3 hours, inoculated into fresh FA2.1 media, grown for 16 hours, then extracted using butyl acetate. The crude extract was derivatized with BSTFA (N,O-bis[Trimethylsilyl]trifluoroacetamide) and analyzed using GC/FID. Spectinomycin (100 mg/L) was included in all media to maintain selection of the pDG109 plasmid. Hits were selected by choosing clones that produced a similar total fatty species as the control strain SL313, but that had a higher percent of fatty alcohol species and a lower percent of free fatty acids than the control. Strain 68F11 was identified as a hit and was validated in a shake flask fermentation using FA2.1 media. A comparison of transposon hit 68F11 to control strain SL313 indicated that 68F11 produces a higher percentage of fatty alcohol species than the control, while both strains produce similar titers of total fatty species. A single colony of hit 68F11, named LC535, was sequenced to identify the location of the transposon insertion. Briefly, genomic DNA was purified from a 10 mL overnight LB culture using the kit ZR Fungal/Bacterial DNA MiniPrep (Zymo Research Corporation, Irvine, Calif.) according to the manufacturer's instructions. The purified genomic DNA was sequenced outward from the transposon using primers internal to the transposon:
(127) TABLE-US-00006 DG150 (SEQIDNO:14) 5-GCAGTTATTGGTGCCCTTAAACGCCTGGTTGCTACGCCTG-3 DG131 (SEQIDNO:15) 5-GAGCCAATATGCGAGAACACCCGAGAA-3
(128) Strain LC535 was determined to have a transposon insertion in the yijP gene (
(129) TABLE-US-00007 LC277 (SEQIDNO:16) 5-CGCTGAACGTATTGCAGGCCGAGTTGCTGCACCGCTCCCGCCAGGCA G-3 LC278 (SEQIDNO:17) 5-GGAATTGCCACGGTGCGGCAGGCTCCATACGCGAGGCCAGGTTATCC AACG-3
(130) This linear DNA was electroporated into strain SL571 and integrated into the chromosome using the lambda red recombination system. Colonies were screened using primers outside the transposon region:
(131) TABLE-US-00008 (SEQIDNO:18) DG4075-AATCACCAGCACTAAAGTGCGCGGTTCGTTACCCG-3 (SEQIDNO:19) DG4085-ATCTGCCGTGGATTGCAGAGTCTATTCAGCTACG-3
(132) A colony with the correct yijP transposon cassette (
(133) TABLE-US-00009 TABLE 4 Effect of yijp transposon insertion on titer and yield of FAS and FALC Strain FAS Titer FAS Yield Percent FALC FALC Yield V940 68 g/L 18.70% 95.00% 17.80% D851 70 g/L 19.40% 96.10% 18.60% V940 64 g/L 18.40% 91.90% 16.90% D851 67 g/L 19.00% 94.00% 17.80%
(134) Tank Fermentation Method:
(135) To assess production of fatty acid esters in tank a glycerol vial of desired strain was used to inoculate 20 mL LB+spectinomycin in shake flask and incubated at 32 C. for approximately six hours. 4 mL of LB culture was used to inoculate 125 mL Low PFA Seed Media (below), which was then incubated at 32 C. shaker overnight. 50 mL of the overnight culture was used to inoculate 1 L of Tank Media. Tanks were run at pH 7.2 and 30.5 C. under pH stat conditions with a maximum feed rate of 16 g/L/hr (glucose or methanol).
(136) TABLE-US-00010 TABLE 5 Low P FA Seed Media Component Concentration NH4Cl 2 g/L NaCl 0.5 g/L KH2PO4 1 g/L MgSO47H2O 0.25 g/L CaCl22H2O 0.015 g/L Glucose 20 g/L TM2 Trace Minerals solution 1 mL/L Ferric citrate 10 mg/L Bis Tris buffer (pH 7.0) 100 mM Spectinomycin 115 mg/L
(137) TABLE-US-00011 TABLE 6 Tank Media Component Concentration (NH4)2SO4 0.5 g/L KH2PO4 3.0 g/L Ferric Citrate 0.034 g/L TM2 Trace Minerals Solution 10 mL/L Casamino acids 5 g/L Post sterile additions MgSO47H2O 2.2 g/L Trace Vitamins Solution 1.25 mL/L Glucose 5 g/L Inoculum 50 mL/L
Example 6
(138) Addition of an N-Terminal 60 bp Fusion Tag to CarB (CarB60)
(139) There are many ways to increase the solubility, stability, expression or functionality of a protein. In one approach to increasing the solubility of CarB, a fusion tag could be cloned before the gene. In another approach increase the expression of CarB, the promoter or ribosome binding site (RBS) of the gene could be altered. In this study, carB (SEQ ID NO: 7) was modified by addition of an N-terminal 60 bp fusion tag. To generate the modified protein (referred to herein as CarB60), carB was first cloned into the pET15b vector using primers:
(140) TABLE-US-00012 (SEQIDNO:20) 5-GCAATTCCATATGACGAGCGATGTTCACGA-3; and (SEQIDNO:21) 5-CCGCTCGAGTAAATCAGACCGAACTCGCG.
(141) The pET15b-carB construct contained 60 nucleotides directly upstream of the carB gene:
(142) TABLE-US-00013 (SEQIDNO:22) 5-ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCC GCGCGGCAGCCAT
(143) The fusion tag version of carB was renamed carB60. The pET15b_carB60 was then digested using restriction enzymes NcoI and HindIII and subcloned into the pCL1920-derived vector OP80 which was cut with the same enzymes. This plasmid was transformed into strain V324 (MG1655 fadE::FRT fhuA::FRT fabB::A329V entD::T5-entD lacIZ::P.sub.TRC-TesA) to evaluate FALC production. Strains were fermented according to a standard procedure (summarized below) and the total fatty species titer and total fatty alcohol titer were quantified.
(144) To assess production of fatty alcohols in production strains, transformants were grown in 2 ml of LB broth supplemented with antibiotics (100 mg/L) at 37 C. After overnight growth, 40 ul of culture was transferred into 2 ml of fresh LB supplemented with antibiotics. After 3 hours of growth, 2 ml of culture were transferred into a 125 mL flask containing 20 ml of M9 medium with 3% glucose supplemented with 20 l trace mineral solution, 10 g/L iron citrate, 1 g/L thiamine, and antibiotics (FA2 media). When the OD.sub.600 of the culture reached 1.0, 1 mM of IPTG was added to each flask. After 20 hours of growth at 37 C., 400 L samples from each flask were removed and fatty alcohols extracted with 400 L butyl acetate. To further understand the mechanism of the improved CarB activity, CarB60 was purified from strain D178 which does not contain TesA (MG1655 fadE::FRT fhuA::FRT fabB::A329V entD::P.sub.T5-entD). Briefly, pCL1920_carB60 was transformed into strain D178, which has been engineered for fatty alcohol production, and fermentation was carried out at 37 C. in FA-2 medium supplemented with spectinomycin (100 g/ml). When the culture OD.sub.600 reached 1.6, cells were induced with 1 mM isopropyl--D-thiogalactopyranoside (IPTG) and incubated for an additional 23 h at 37 C. For purification of CarB60, the cells were harvested by centrifugation for 20 min at 4 C. at 4,500 rpm. Cell paste (10 g) was suspended in 12 ml of BugBuster MasterMix (Novagen) and protease inhibitor cocktail solution. The cells were disrupted by French Press and the resulting homogenate was centrifuged at 10,000 rpm to remove cellular debris. Ni-NTA was added to the resulting mixture, and the suspension was swirled at 4 C. at 100 rpm for 1 hour on a rotary shaker. The slurry was poured into a column, and the flow-through was collected. The Ni-NTA resin was washed with 10 mM imidazole in 50 mM sodium phosphate buffer pH 8.0 containing 300 mM NaCl, and further washed with 20 mM imidazole in 50 mM sodium phosphate buffer pH 8.0 containing 300 mM NaCl. The CarB60 protein was eluted with 250 mM imidazole in 50 mM sodium phosphate buffer pH 8.0 containing 300 mM NaCl, and analyzed by SDS-PAGE. The protein was dialyzed against 20% (v/v) glycerol in 50 sodium phosphate buffer pH 7.5 yielding approximately 10 mg of CarB60 per liter of culture. The protein was flash frozen and stored at 80 C. until needed.
(145) The CarB60 protein was abundantly expressed from a multicopy plasmid. Additional SDS-PAGE analysis showed that expression of CarB60 was higher than CarB. The higher expression level of CarB60 suggested that the carB60 gene integrated into the E. coli chromosome would produce more protein than the carB gene in the same location. To test this hypothesis, the carB60 gene was integrated into the E. coli chromosome. Briefly, the carB60 gene was first amplified from pCL_carB60 using forward primer:
(146) TABLE-US-00014 (SEQIDNO:23) 5-ACGGATCCCCGGAATGCGCAACGCAATTAATGTaAGTTAGCGC-3; and reverseprimer: (SEQIDNO:24) 5-TGCGTCATCGCCATTGAATTCCTAAATCAGACCGAACTCGCGCAGG- 3.
(147) A second PCR product was amplified from vector pAH56 using forward primer:
(148) TABLE-US-00015 (SEQIDNO:25) 5-ATTCCGGGGATCCGTCGACC-3; and reverseprimer: (SEQIDNO:26) 5-AATGGCGATGACGCATCCTCACG-3
(149) This fragment contains a kanamycin resistance cassette, attP site, and R6k origin of replication. The two PCR products were joined using the InFusion kit (Clontech) to create plasmid pSL116-126. A fatty alcohol production strain containing an integrated form of TesA12H08 and a helper plasmid pINT was transformed with either pSL116-126 containing the carB60 gene or plasmid F27 containing the carB gene. These strains were fermented in FA2 media according to standard procedures for shake-flask fermentations, as described above. To characterize and quantify the fatty alcohols and fatty acid esters, gas chromatography (GC) coupled with flame ionization (FID) detection was used. The crude extract was derivatized with BSTFA (N,O-bis[Trimethylsilyl]trifluoroacetamide) and analyzed using a GC/FID. Quantification was carried out by injecting various concentrations of the appropriate authentic references using the GC method described above as well as assays including, but not limited to, gas chromatography (GC), mass spectroscopy (MS), thin layer chromatography (TLC), high-performance liquid chromatography (HPLC), liquid chromatography (LC), GC coupled with a flame ionization detector (GC-FID), GC-MS, and LC-MS, can be used. When testing for the expression of a polypeptide, techniques such as Western blotting and dot blotting may be used.
(150) The results of the fermentation after 20 hours are shown in
Example 7
(151) Generation of CarB Mutants
(152) The CarB enzyme is a rate-limiting step in the production of fatty alcohols under certain process conditions. To produce fatty alcohols economically, efforts were made to increase the activity of the CarB enzyme.
(153) Error Prone PCR Library Screen:
(154) Random mutagenesis using error prone PCR was performed under conditions where the copying fidelity of the DNA polymerase is low. The mutagenized nucleic acids were cloned into a vector, and error-prone PCR followed by high-throughput screening was done to find beneficial mutations that increase conversion of free fatty acids to fatty alcohols (as detailed below). Important residues were further mutated to other amino acids. A number of single amino acid mutations and combinations of mutations increased the fraction of fatty species that are converted to fatty alcohols. Briefly, random mutations were generated in the carB60opt gene by error-prone PCR using the Genemorph II kit (Stratagene). Mutations were generated in only one of two domains of carB60opt separately, to facilitate cloning. Library 1 contained the first 759 residues of carB60opt and was generated by error-prone PCR using primers:
(155) TABLE-US-00016 HZ117 (SEQIDNO:27) 5-ACGGAAAGGAGCTAGCACATGGGCAGCAGCCATCATCAT-3; and DG264 (SEQIDNO:28) 5-GTAAAGGATGGACGGCGGTCACCCGCC-3.
The vector for Library 1 was plasmid pDG115 digested with enzymes NheI and PshAI. Library 2 contained the last 435 residues of carB60opt and was generated by error-prone PCR using primers:
(156) TABLE-US-00017 DG263 (SEQIDNO:29) 5-CACGGCGGGTGACCGCCGTCCATCC-3; and HZ118 (SEQIDNO:30) 5-TTAATTCCGGGGATCCCTAAATCAGACCGAACTCGCGCAGGTC-3.
(157) The vector for Library 2 was plasmid pDG115 digested with enzymes PshAI and BamHI. The error-prone inserts were cloned into the vectors using InFusion Advantage (Clontech) and passaged through cloning strain NEB Turbo (New England Biolabs). The libraries were then transformed into strain EG442 (EG149 Tn7::P.sub.TRC-ABR lacIZ::P.sub.T5O-ABR). Error-prone carB60opt clones were then subjected to high-throughput screening to measure production of fatty alcohols. Briefly, colonies were picked into deep-well plates containing LB, grown overnight, inoculated into fresh LB and grown for 3 hours, inoculated into fresh FA-2.1 media, grown for 16 hours, then extracted using butyl acetate. The crude extract was derivatized with BSTFA (N,O-bis[Trimethylsilyl]trifluoroacetamide) and analyzed using a standard GC/FID method. Spectinomycin (100 mg/L) was included in all media to maintain selection of the pDG115 plasmid. Hits were selected by choosing clones that produced a smaller total free fatty acid titer and a larger total fatty alcohol titer compared to the control strain. To compare hits from different fermentation screens, the conversion of free fatty acids to fatty alcohols was normalized by calculating a normalized free fatty acid percentage NORM FFA=Mutant Percent FFA/Control Percent FFA where Percent FFA is the total free fatty acid species titer divided by the total fatty species titer. Hits were subjected to further verification using shake-flask fermentations, as described below.
(158) Hits were sequenced to identify the beneficial mutations. Sequencing was performed by colony PCR of the entire carB60opt gene using primers
(159) TABLE-US-00018 SL59 (SEQIDNO:31) 5-CAGCCGTTTATTGCCGACTGGATG-3; and EG479 (SEQIDNO:32) 5-CTGTTTTATCAGACCGCTTCTGCGTTC-3,
and sequenced using primers internal to the carB60opt enzyme.
The beneficial mutations that improved the CarB60opt enzyme are shown in Table 7. The normalized free fatty acid (NORM FFA) column indicates the improvement in the enzyme, with lower values indicating the best improvement. Well # indicates the primary screening well that this mutation was found in. All residue numbers refer to the CarB protein sequence, which does not include the 60 bp tag. Mutations indicated with the prefix Tag: indication mutations in the 60 bp/20 residue N-terminal tag.
(160) TABLE-US-00019 TABLE7 BeneficialMutationsintheCarBEnzymeIdentifiedDuringError- ProneScreening(TAGMutationsRemoved) Well# NormFFA MissenseMutations SilentMutations 131B08 70.50% L799MV810FS927RM1062L CCG1116CCT A1158VF1170I 20C07 71.80% A535S 65B02 74.70% M930R ACC867ACA 54B10 76.30% L80QT231MF288LA418T V530MA541VG677DP712A 67E01 78.20% D750GR827CD986GG1026D GCA1031GCTGTC1076GTT P1149S 65C03 78.90% V926A ATT941ATA 12C10 80.30% V46I 66E08 80.10% V926A 70F02 80.90% D750GR827CD986GG1026D GCA101GCTGTC1073GTT P1149S 07D01 82.40% E20KV191A 66G09 82.40% R827CL1128S ACG780ACACTG923TTG 25H02 83.50% F288S 06C01 85.10% V46I 06C01 05D02 85.20% T396S CCG477CCT 124E03 86.00% R827CL1128S ACG780ACACTG923TTG 17A04 86.20% A574T GCA237GCTACC676ACT GCC529GCT 132C08 87.00% M1062TR1080H TTG830TTATAC834TAT 72C09 87.30% P809LM1062V 10F02 87.70% E636K 71H03 88.10% R827CL1128S ACG780ACACTG923TTG 38G04 88.90% D143EA612T GCA181GCG 42F08 90.20% T90M CTG186CTT 66C04 90.30% L1128S 18CC03 90.40% Q473L 12E02 90.60% D19NS22NR87HL416S CCG167CCA 28B09 91.10% E28KH212NQ473L CCG122CCAACG178ACA CTG83TTGCTG340CTA ACC401ACTGCA681GCG 103E09 92.20% E936KP113R CGT829CGGCTG1007CTA 03E09 93.20% M259I 74G11 93.80% I870VS927IS985II1164F GTG1000GTC 46C01 95.60% D18VD292N
(161) Saturation Mutagenesis (Combo 1 and 2 Library Generated):
(162) Amino acid positions deemed beneficial for fatty alcohol production following error-prone PCR were subjected to further mutagenesis. Primers containing the degenerate nucleotides NNK or NNS were used to mutate these positions to other amino acids. The resulting saturation mutagenesis libraries were screened as described above for the error prone libraries, and hits were identified that further improved fatty alcohol conversion (a smaller total free fatty acid titer and a larger total fatty alcohol titer compared to the parent control strain). Single amino acid/codon changes in nine different positions that improve the production of fatty alcohols are shown in Table 8. Hits were subjected to further verification using shake-flask fermentations, as described herein.
(163) TABLE-US-00020 TABLE 8 Beneficial Mutations in the CarB Enzyme Identified During Amino Acid Saturation Mutagenesis WT Mutant Mutant Amino Acid WT Codon Amino Acid Codon Norm FFA E20 GAG F TTC 92.20% L CTG 94.50% L TTG 96.20% R CGC 86.50% S TCG 87.40% V GTG 86.00% V GTC 85.30% Y TAC 88.80% V191 GTC A GCC 88.70% S AGT 98.00% F288 TTT G GGG 70.30% R AGG 77.20% S TCT 85.60% S AGC 79.60% Q473 CAA A GCG 89.50% F TTC 89.10% H CAC 84.10% I ATC 77.20% K AAG 90.30% L CTA 90.10% M ATG 89.00% R AGG 88.00% V GTG 89.20% W TGG 84.50% Y TAC 86.00% A535 GCC A TCC 71.80% R827 CGC A GCC 93.20% C TGT 87.90% C TGC 83.20% V926 GTT A GCT 78.10% A GCG 66.30% A GCC 69.50% E GAG 65.80% G GGC 78.60% S927 AGC G GGG 77.60% G GGT 79.30% I ATC 90.80% K AAG 70.70% V GTG 87.90% M930 ATG K AAG 82.30% R CGG 73.80% R AGG 69.80% L1128 TTG A GCG 92.70% G GGG 89.70% K AAG 94.80% M ATG 95.80% P CCG 98.40% R AGG 90.90% R CGG 88.50% S TCG 88.90% T ACG 96.30% V GTG 93.90% W TGG 78.80% Y TAC 87.90%
(164) Amino acid substitutions deemed beneficial to fatty alcohol production were next combined. PCR was used to amplify parts of the carBopt gene containing various desired mutations, and the parts were joined together using a PCR-based method (Horton, R. M., Hunt, H. D., Ho, S. N., Pullen, J. K. and Pease, L. R. 1989). The carBopt gene was screened without the 60 bp N-terminal tag. The mutations combined in this combination library are shown in Table 9.
(165) TABLE-US-00021 TABLE9 CarBMutationsfromtheFirstCombinationLibrary Mutation Codon E20V GTG E20S TCG E20R CGC V191S AGT F288R AGG F288S AGC F288G GGG Q473L CTG Q473W TGG Q473Y TAC Q473I ATC Q473H CAC A535S TCC
(166) To facilitate screening, the resulting CarB combination library was then integrated into the chromosome of strain V668 at the lacZ locus. The sequence of the carBopt gene at this locus is presented as SEQ ID NO:7. The genotype of strain V668 is MG1655 (fadE::FRT fhuA::FRT fabB::A329V entD::T5-entD insH-11::P.sub.lacUV5fab138 rph+ilvG+) (as shown in Table 3 and
(167) The integrated CarB combination mutants were amplified from the integrated carB hits by PCR using the primers:
(168) TABLE-US-00022 EG58 (SEQIDNO:33) 5-GCACTCGACCGGAATTATCG; and EG626 (SEQIDNO:34) 5-GCACTACGCGTACTGTGAGCCAGAG.
(169) These inserts were re-amplified using primers:
(170) TABLE-US-00023 DG243 (SEQIDNO:35) 5-GAGGAATAAACCATGACGAGCGATGTTCACGACGCGACCGACGGC; and DG210 (SEQIDNO:36) 5-CTAAATCAGACCGAACTCGCGCAGG.
(171) Using InFusion cloning, the pooled carB mutants were cloned into a production plasmid, pV869, which was PCR amplified using primers:
(172) TABLE-US-00024 DG228 (SEQIDNO:37) 5-CATGGTTTATTCCTCCTTATTTAATCGATAC; and DG318 (SEQIDNO:38) 5-TGACCTGCGCGAGTTCGGTCTGATTTAG.
(173) The carB mutant that performed the best in the shake-flask fermentation plasmid screen (carB2; Table 11) was designated VA101 and the control strain carrying carBopt [A535S] was designated VA82. See
(174) Amino acid substitutions in the reduction domain of carB deemed beneficial to fatty alcohol production were combined with one of the best carB-L combination library hits, carB3 (Table 11). PCR was used to amplify parts of the carBopt gene containing various desired mutations in Reduction domain, and the parts were joined together using SOE PCR. The mutations combined in this combination library are shown in Table 10.
(175) TABLE-US-00025 TABLE10 CarBMutationsfromtheSecondCombinationLibrary Mutation Codon R827C TGC R827A GCA V926A GCG V926E GAG S927K AAG S927G GGG M930K AAG M930R AGG L1128W TGG
(176) The combination library was screened as described above for the error prone library. V668 with integrated carB3 in the lacZ region and containing pVA3 was used as a control. Hits were selected that exhibited increased production of fatty alcohols and were subjected to further verification using shake-flask fermentations, as described above. The results of a shake flask fermentation showing an improved percentage of fatty alcohol production using a further CarB combination mutation (carB4) is shown in Table 11. A graphic depiction of the relative conversion efficiency of low copy CarB variants is presented in
(177) TABLE-US-00026 TABLE 11 CAR Variants Name Mutation(s) Strain Tank data Notes carB None = WT (E20 protein is SEQ ID NO: 7 V191 F288 Q473) carB60 None + tag V324 carB1 A535S V940 83% FALC; C12/C14 = 3.4 has one copy of 12H08 chromosomal TE carB2 E20R, F288G, Q473I, A535S LH375 97% FALC; C12/C14 = 3.6 has two copies of 12H08 chromosomal TE carB2 E20R, F288G, Q473I, A535S LH346 96% FALC; C12/C14 = 3.7 has one copy of 12H08 chromosomal TE carB3 E20R, F288G, Q473H, A535S L combo library No examples run in bioreactors to date carB4 E20R, F288G, Q473H, R combo library (VA-219) 97% FALC; C12/C14 = 3.9 has two copies of 12H08 chromosomal TE A535S, R827A, S927G carA None See, US Patent protein is SEQ ID NO: 39 Pub. No. 20100105963 FadD9 None See, US Patent protein is SEQ ID NO: 40 Pub. No. 20100105963
The DNA sequences of CarA, FadD9, CarB, and CarB60 are presented herein as SEQ ID NO: 41, 42, 43 and 44, respectively.
(178) Identification of additional beneficial mutations in CarB enzyme by saturation mutagenesis:
(179) A dual-plasmid screening system was later developed and validated to identify improved CarB variants over CarB4 for FALC production. The dual-plasmid system met the following criteria: 1) Mutant clones produce high FA titer to provide fatty acid flux in excess of CarB activity. This is accomplished by transforming a base strain (V668 with two copies of chromosomal TE) with a plasmid (pLYC4, pCL1920_P.sub.TRC.sub._carDead_tesA_alrAadp1_fabB[A329G]_fadR) that carries the FALC operon with a catalytically inactive CarB enzyme CarB[S693A] to enhance the production of free fatty acids; 2) The screening plasmid with carB mutant template, preferably smaller than 9-kb, is amenable to saturation mutagenesis procedures and is compatible for expression with pLYC4; 3) The dynamic range of CarB activity is tunable. This is achieved by combining a weaker promoter (P.sub.TRC1) and alternative start codons (GTG or TTG) to tune CarB4 expression levels. 3) Good plasmid stability, a toxin/antitoxin module (ccdBA operon) was introduced to maintain plasmid stability.
(180) Briefly, the screening plasmid pBZ1 (pACYCDuet-1_P.sub.TRC1-carB4GTG_rrnBter_ccdAB) was constructed from four parts using In-Fusion HD cloning method (Clontech) by mixing equal molar ratios of four parts (P.sub.TRC1, carB4 with ATG/TTG/GTG start codons, rrnB T1T2 terminators with ccdAB, and pACYCDuet-1 vector). The parts (1 to 4) were PCR amplified by the following primer pairs:
(181) TABLE-US-00027 (1)P.sub.TRC1-Forwardprimer (SEQIDNO:45) 5 CGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCAAATCCG GCTCGTATAATGTGTG-3 and reverseprimer (SEQIDNO:46) 5- GGTTTATTCCTCCTTATTTAATCGATACAT-3 usingpVA232(pCL1920_P.sub.TRC_carB4_tesA_alrAadp1_ fabB[A329G]_fadR)plasmidastemplate. (1)carB4withATG/TTG/GTGstartcodons-Forward primercarB4ATG (SEQIDNO:47) 5ATGTATCGATTAAATAAGGAGGAATAAACCATGGGCACGAGCGATGTT CACGACGCGAC-3; carB4GTG (SEQIDNO:48) 5ATGTATCGATTAAATAAGGAGGAATAAACCGTGGGCACGAGCGATGTT CACGACGCGAC-3; and carB4TTG (SEQIDNO:49) 5- ATGTATCGATTAAATAAGGAGGAATAAACCTTGGGCACGAGCGATGTTCA CGACGCGAC-3; and reverseprimercarB4rev (SEQIDNO:50) 5- TTCTAAATCAGACCGAACTCGCGCAG-3, usingpVA232plasmidastemplate. (3)TherrnBT1T2terminatorswithccdAB-Forward primerrrnBT1T2term (SEQIDNO:51) 5- CTGCGCGAGTTCGGTCTGATTTAGAATTCCTCGAGGATGGTAGTGT GG-3 and reverseprimerccdABrev (SEQIDNO:52) 5-CAGTCGACATACGAAACGGGAATGCGG-3,usingplasmid pAH008(pV171_ccdBAoperon). (4)ThepACYCDuet-1vectorbackbone-Forwardprimer pACYCvectorfor (SEQIDNO:53) 5 CCGCATTCCCGTTTCGTATGTCGACTGAAACCTCAGGCATTGAGAAGCAC ACGGTC-3 and reverseprimerpACYCvectorrev (SEQIDNO:54) 5- CTCATTTCAGAATATTTGCCAGAACCGTTAATTTCCTAATGCAGGAGTCG CATAAG-3.
(182) The pBZ1 plasmid was co-expressed with pLYC4 in the strain described above and validated by shake flask and deep-well plate fermentation. The fermentation conditions were optimized such that CarB4_GTG template reproducibly have 65% FALC conversion in both fermentation platforms as described in Example 5. Results for shake flask fermentation are shown in
(183) Additional sites (18, 19, 22, 28, 80, 87, 90, 143, 212, 231, 259, 292, 396, 416, 418, 530, 541, 574, 612, 636, 677, 712, 750, 799, 809, 810, 870, 936, 985, 986, 1026, 1062, 1080, 1134, 1149, 1158, 1161, 1170) containing mutations in the improved CarB variants (Table 7) were subjected to full saturation mutagenesis. Primers containing the degenerate nucleotides NNK or NNS were used to mutate these positions to other amino acids by a PCR-based method (Sawano and Miyawaki 2000, Nucl. Acids Res. 28: e78). Saturation library was constructed using the pBZ1 (pACYCDuet-1_P.sub.TRC1-carB4GTG_rrnBter_ccdAB) plasmid template. Mutant clones were transformed into NEB Turbo (New England Biolab) cloning strains and plasmids were isolated and pooled. The pooled plasmids were then transformed into a V668 based strain carrying plasmid pLYC4 and the transformants were selected on LB agar plates supplemented with antibiotics (100 mg/L spectinomycin and 34 mg/L chloramphenicol).
(184) CarB variants from the saturation library were then screened for the production of fatty alcohols. Single colonies were picked directly into 96-well plates according to a modified deep-well plate fermentation protocol as described in Example 5. Hits were selected by choosing clones that produced a smaller total free fatty acid titer and a larger total fatty alcohol titer compared to the control strain. To compare hits from different fermentation batches, the conversion of free fatty acids to fatty alcohols was normalized by calculating a normalized free fatty acid percentage. The NORM FFA (%) was also used in hits validation as described in Example 5. NORM FFA (%)=Mutant Percent FFA/Control Percent FFA; where Percent FFA is the total free fatty acid species titer divided by the total fatty species titer. Hits were subjected to further validation using shake-flask fermentations as described in Example 5. The normalized free fatty acid (NORM FFA) column indicates the improvement in the enzyme, with lower values indicating the best improvement. Hit ID indicates the primary screening plate well position where the lower NORM FFA phenotype was found. Hits mutations were identified by sequencing PCR products amplified from Hit containing pBZ1 plasmids using mutant carB gene-specific primers (BZ1 for 5-GGATCTCGACGCTCTCCCTT-3 (SEQ ID NO:55) and BZ12_ccdAB unique primer 5-TCAAAAACGCCATTAACCTGATGTTCTG-3 (SEQ ID NO:56). The NORM FFA values and mutations identified in validated hits are summarized in Table 12.
(185) TABLE-US-00028 TABLE 12 Beneficial Mutations in CarB4 Enzyme identified During Amino Acid Saturation Mutagenesis Hit WT ID(Amino Mutant Amino Acid WT Codon Acid) Codon NORM FFA(%) D18 GAT P10H5(R) AGG 75.5 P6B4(L) CTG 89.6 P4H11(T) ACG 80.8 P8D11(P) CCG 81.8 S22 AGC P1F9(R) AGG 57.7 P2G9(R) AGG 55.7 P2A7(N) AAC 90 P8D7(G) GGG 82.1 L80 CTG P8H11(R) AGG 87.4 R87 CGT P7D7(G) GGG 85.2 P5D12(E) GAG 89.4 D750 GAT P8F11(A) GCG 87.6 I870 ATT P3A12(L) CTG 76.6
(186) Identification of Novel Variants of CarB Enzyme by Full Combinatorial Mutagenesis:
(187) A full combinatorial library was constructed to include the following amino acid residues: 18D, 18R, 22S, 22R, 473H, 473I, 827R, 827C, 870I, 870L, 926V, 926A, 926E, 927S, 927K, 927G, 930M, 930K, 930R, 1128L, and 1128W. Primers containing native and mutant codons at all positions were designed for library construction by a PCR-based method (Horton, R. M., Hunt, H. D., Ho, S. N., Pullen, J. K. and Pease, L. R. 1989). Beneficial mutations conserved in CarB2, CarB3, and CarB4 (20R, 288G, and 535S) were not changed, therefore, carB2GTG cloned into pBZ1 (modified pBZ1_P.sub.TRC1.sub._carB2GTG_ccdAB) was used as PCR template. Library construction was completed by assembling PCR fragments into CarB ORFs containing the above combinatorial mutations. The mutant CarB ORFs were then cloned into the pBZ1 backbone by In-Fusion method (Clontech). The In-Fusion product was precipitated and electroporated directly into the screening strain carrying plasmid pLYC4. Library screening, deep-well plate and shake flask fermentation were carried out as described in Example 5. The activities (NORM FFA normalized by CarB2, 100%) of CarB mutants with specific combinatorial mutations are summarized in Table 13. CarB2, CarB4, and CarB5 (CarB4-S22R) are included as controls. The NORM FFA column indicates the improvement in CarB enzyme, with lower values indicating the best improvement. The fold improvement (X-FIOC) of control (CarB2) is also shown. All mutations listed are relative to the polypeptide sequence of CarB wt (SEQ ID NO:7). For example, CarB1 has A535S mutation, and the CarBDead (a catalytically inactive CarB enzyme) carries S693A mutation which destroys the phosphopantetheine attachment site.
(188) Novel CarB Variants for Improved Fatty Alcohol Production in Bioreactors:
(189) The purpose of identifying novel CarB variants listed in Table 13 is to use them for improved fatty alcohol production. The top CarB variant (P06B6-S3R, E20R, S22R, F288G, Q473H, A535S, R873S, S927G, M930R, L1128W) from Table 13 carries a spontaneous mutation (wild type AGC to AGA) at position 3. Both P06B6 CarB variants, namely CarB7 (amino acid R by AGA at position 3-S3R, E20R, S22R, F288G, Q473H, A535S, R873S, S927G, M930R, L1128W), and CarB8 (wild type amino acid S by AGC at position 3E20R, S22R, F288G, Q473H, A535S, R873S, S927G, M930R, L1128W) were made and cloned into the low copy number fatty alcohol production plasmid backbone pCL1920 to generate the following fatty alcohol operons differing only in CarB. The translation initiation codon (GTG) for all CarB variants (CarB2, CarB7, and carB8) was reverted to ATG to maximize expression. pCL1920_P.sub.TRC.sub._carB2_tesA_alrAadp1_fabB[A329G]_fadR pCL1920_P.sub.TRC.sub._carB7_tesA_alrAadp1_fabB[A329G]_fadR pCL1920_P.sub.TRC.sub._carB8_tesA_alrAadp1_fabB[A329G]_fadR
(190) The above described plasmids were transformed into a V668 based strain with one copy of chromosomal TE, and the resulted strains were screened in bioreactors as described in EXAMPLE 4. The improvement (measured by % fatty alcohols in the bioreactor fermentation product) of CarB7 and CarB8 over CarB2 was shown in
(191) TABLE-US-00029 TABLE 13 Summary of CarB Variants Identified from Combinatorial Library in Dual-Plasmid system. Mutants NORM FFA (%) X-FIOC Mutations P06B6 16.5 6.06 S3R, E20R, S22R, F288G, Q473H, A535S, R873S, S927G, M930R, L1128W P13A3 23.9 4.18 D18R, E20R, S22R, F288G, Q473I, A535S, S927G, M930K, L1128W P02A2 26.5 3.77 E20R, S22R, F288G, Q473I, A535S, R827C, V926E, S927K, M930R P05H3 26.7 3.75 D18R, E20R, 288G, Q473I, A535S, R827C, V926E, M930K, L1128W P10F10 31.9 3.13 E20R, S22R, F288G, Q473H, A535S, R827C, V926A, S927K, M930R P01C12 34.2 2.92 E20R, S22R, F288G, Q473H, A535S, R827C P03B1 36.9 2.71 E20R, S22R, F288G, Q473I, A535S, R827C, M930R P06E4 36.9 2.71 E20R, S22R, F288G, Q473I, A535S, I870L, S927G, M930R P14C6 37.4 2.67 E20R, S22R, F288G, Q473I, A535S, I870L, S927G P05F10 40.4 2.48 D18R, E20R, S22R, F288G, Q473I, A535S, R827C, I870L, V926A, S927G P06C8 40.8 2.45 E20R, S22R, F288G, Q473H, A535S, R827C, I870L, L1128W P15E4 40.8 2.45 D18R, E20R, S22R, F288G, Q473H, A535S, R827C, I870L, S927G, L1128W P05H7 40.9 2.44 E20R, S22R, F288G, Q473I, A535S, R827C, I870L, S927G, L1128W P15A6 41 2.44 E20R, S22R, F288G, Q473I, A535S, R827C, I870L, S927G, M930K, L1128W P08F5 41.2 2.43 E20R, S22R, F288G, Q473H, A535S, I870L, S927G, M930K P14C7 41.3 2.42 E20R, F288G, Q473I, A535S, I870L, M930K P16H10 42.1 2.38 E20R, S22R, F288G, Q473H, A535S, S927G, M930K, L1128W P16A1 44.1 2.27 D18R, E20R, S22R, F288G, Q473I, A535S, S927G, L1128W P14H4 44.2 2.26 E20R, S22R, F288G, Q473I, A535S, , R827C, I870L, S927G P15C1 46.5 2.15 D18R, E20R, S22R, F288G, Q473I, A535S, R827C, I870L, S927G, L1128W P16E5 47.2 2.12 D18R, E20R, S22R, F288G, Q473I, A535S, S927G, M930R, L1128W P15A3 47.2 2.12 E20R, S22R, F288G, Q473H, A535S, V926E, S927G, M930R P05A2 52.4 1.91 E20R, S22R, F288G, Q473H, A535S, R827C, I870L, V926A, L1128W CarB2 100 1 E20R, F288G, Q473I, A535S CarB4 77.8 1.29 E20R, F288G, Q473H, A535S, R827A, S927G CarB5 48.9 2.04 E20R, S22R, F288G, Q473H, A535S, R827A, S927G CarB1 ND A535S CarB wt ND SEQ ID NO: 7 CarBDead ND S693A
(192) All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to better illuminate the disclosure and does not pose a limitation on the scope of the disclosure unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the disclosure. It is to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting. Preferred embodiments of this disclosure are described herein. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the disclosure to be practiced otherwise than as specifically described herein. Accordingly, this disclosure includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the disclosure unless otherwise indicated herein or otherwise clearly contradicted by context.
(193) TABLE-US-00030 TABLE14 Sequences SEQ ID NO Description Sequence 1 cat-loxP-T5 TTGTCCATCTTTATATAATTTGGGGGTAGGGTGTTCTTTATGTAAAAAAAAC (infrontof gtttTAGGATGCATATGGCGGCCGCataacttcgtataGCATACATtatacgaagttaTCTAGA iFAB138) GTTGCATGCCTGCAGGtccgcttattatcacttattcaggcgtagcAaccaggcgtttaagggcaccaataactg ccttaaaaaaattacgccccgccctgccactcatcgcagtactgttgtaattcattaagcattctgccgacatggaagccatcaca aacggcatgatgaacctgaatcgccagcggcatcagcaccttgtcgccttgcgtataatatttgcccatggtgaaaacggggg cgaagaagttgtccatattggccacgtttaaatcaaaactggtgaaactcacccagggattggctgagacgaaaaacatattctc aataaaccctttagggaaataggccaggttttcaccgtaacacgccacatcttgcgaatatatgtgtagaaactgccggaaatcg tcgtggtattcactccagagcgatgaaaacgtttcagtttgctcatggaaaacggtgtaacaagggtgaacactatcccatatca ccagctcaccgtctttcattgccatacggaattccggatgagcattcatcaggcgggcaagaatgtgaataaaggccggataa aacttgtgcttatttttctttacggtctttaaaaaggccgtaatatccagctgaacggtctggttataggtacattgagcaactgactg aaatgcctcaaaatgttctttacgatgccattgggatatatcaacggtggtatatccagtgatttttttctccattttagcttccttagct cctgaaaatctcgataactcaaaaaatacgcccggtagtgatcttatttcattatggtgaaagttggaacctcttacgtgccgatca acgtctcattttcgccaaaagttggcccagggcttcccggtatcaacagggacaccaggatttatttattctgcgaagtgatcttc cgtcacaggtatttattcGACTCTAGataacttcgtataGCATACATTATACGAAGTTATGGATC CAGCTTATCGATACCGTCaaacAAATCATAAAAAATTTATTTGC1TTcaggaaaatttt tctgTATAATAGATTCAATTGCGATGACGACGAACACGCACCTGCAGGAGGAG ACCAATGATCATCAAACCTAAAATTCGTGGATTTATC 2 T5(infront TTGTCCATCTTTATATAATTTGGGGGTAGGGTGTTCTTTATGTAAAAAAAAC ofiFAB138) gtaTAGGATGCATATGGCGGCCGCataacttcgtataGCATACATTATACGAAGTTAT GGATCCAGCTTATCGATACCGTCaaacAAATCATAAAAAATTTATTTGCTTTca ggaaaatttttctgTATAATAGATTCAATTGCGATGACGACGAACACGCACCTGCAG GAGGAGACCAATGATCATCAAACCTAAAATTCGTGGATTTATC 3 AlrA MSNHQIRAYAAMQAGEQVVPYQFDAGELKAHQVEVKVEYCGLCHSDLSVINN Acinetobacter EWQSSVYPAVAGHEIIGTIIALGSEAKGLKLGQRVGIGWTAETCQACDPCIGGN sp.M-1 QVLCTGEKKATIIGHAGGFADKVRAGWQWVIPLPDDLDPESAGPLLCGGITVL DPLLKHKIQATHHVGVIGIGGLGHIAIKLLKAWGCEITAFSSNPDKTEELKANGA DQVVNSRDAQAIKGTRWKLIILSTANGTLNVKAYLNTLAPKGSLHFLGVTLEPI PVSVGAIMGGAKSVTSSPTGSPLALRQLLQFAARKNIAPQVELFPMSQLNEAIER LHSGQARYRIVLKADFD 4 AlrAadp1 MATTNVIHAYAAMQAGEALVPYSFDAGELQPHQVEVKVEYCGLCHSDVSVLN NEWHSSVYPVVAGHEVIGTITQLGSEAKGLKIGQRVGIGWTAESCQACDQCISG QQVLCTGENTATIIGHAGGFADKVRAGWQWVIPLPDELDPTSAGPLLCGGITVF DPILKHQIQAIHHVAVIGIGGLGHMAIKLLKAWGCEITAFSSNPNKTDELKAMG ADHVVNSRDDAEIKSQQGKFDLLLSTVNVPLNWNAYLNTLAPNGTFHFLGVV MEPIPVPVGALLGGAKSLTASPTGSPAALRKLLEFAARKNIAPQIEMY 5 yjgB atgTCGATGATAAAAAGCTATGCCGCAAAAGAAGCGGGCGGCGAACTGGAA GTTTATGAGTACGATCCCGGTGAGCTGAGGCCACAAGATGTTGAAGTGCAG GTGGATTACTGCGGGATCTGCCATTCCGATCTGTCGATGATCGATAACGAAT GGGGATITTCACAATATCCGCTGGTTGCCGGGCATGAGGTGATTGGGCGCG TGGTGGCACTCGGGAGCGCCGCGCAGGATAAAGGTTTGCAGGTCGGTCAGC GTGTCGGGATTGGCTGGACGGCGCGTAGCTGTGGTCACTGCGACGCCTGTA TTAGCGGTAATCAGATCAACTGCGAGCAAGGTGCGGTGCCGACGATTATGA ATCGCGGTGGCTTTGCCGAGAAGTTGCGTGCGGACTGGCAATGGGTGATTC CACTGCCAGAAAATATTGATATCGAGTCCGCCGGGCCGCTGTTGTGCGGCG GTATCACGGTCTTTAAACCACTGTTGATGCACCATATCACTGCTACCAGCCG CGTTGGGGTAATTGGTATTGGCGGGCTGGGGCATATCGCTATAAAACTTCTG CACGCAATGGGATGCGAGGTGACAGCCITTAGTTCTAATCCGGCGAAAGAG CAGGAAGTGCTGGCGATGGGTGCCGATAAAGTGGTGAATAGCCGCGATCCG CAGGCACTGAAAGCACTGGCGGGGCAGTTTGATCTCATTATCAACACCGTC AACGTCAGCCTCGACTGGCAGCCCTATTTTGAGGCGCTGACCTATGGCGGTA ATTTCCATACGGTCGGTGCGGTTCTCACGCCGCTGTCTGTTCCGGCCTTTAC GTTAATTGCGGGCGATCGCAGCGTCTCTGGTTCTGCTACCGGCACGCCTTAT GAGCTGCGTAAGCTGATGCGTTTTGCCGCCCGCAGCAAGGTTGCGCCGACC ACCGAACTGTTCCCGATGTCGAAAATTAACGACGCCATCCAGCATGTGCGC GACGGTAAGGCGCGTTACCGCGTGGTGTTGAAAGCCGATTTTtga 6 NRRL5646 MAVDSPDERLQRRIAQLFAEDEQVKAARPLEAVSAAVSAPGMRLAQIAATVM CAR AGYADRPAAGQRAFELNTDDATGRTSLRLLPRFETITYRELWQRVGEVAAAW FIHDPENPLRAGDFVALLGFTSIDYATLDLADIHLGAVTVPLQASAAVSQLIAILT ETSPRLLASTPEHLDAAVECLLAGTTPERLVVFDYHPEDDDQRAAFESARRRLA DAGSLVIVETLDAVRARGRDLPAAPLFVPDTDDDPLALLIYTSGSTGTPKGAMY TNRLAATMWQGNSMLQGNSQRVGINLNYMPMSHIAGRISLFGVLARGGTAYF AAKSDMSTLFEDIGLVRPTEIFFVPRVCDMVFQRYQSELDRRSVAGADLDTLDR EVKADLRQNYLGGRFLVAVVGSAPLAAEMKTFMESVLDLPLHDGYGSTEAGA SVLLDNQIQRPPVLDYKLVDVPELGYFRTDRPHPRGELLLKAETTIPGYYKRPE VTAEIFDEDGFYKTGDIVAELEHDRLVYVDRRNNVLKLSQGEFVTVAHLEAVF ASSPLIRQIFIYGSSERSYLLAVIVPTDDALRGRDTATLKSALAESIQRIAKDANL QPYEIPRDFLIETEPFTIANGLLSGIAKLLRPNLKERYGAQLEQMYTDLATGQAD ELLALRREAADLPVLETVSRAAKAMLGVASADMRPDAHFTDLGGDSLSALSFS NLLHEIFGVEVPVGVVVSPANELRDLANYIEAERNSGAKRPTFTSVHGGGSEIR AADLTLDKFIDARTLAAADSIPHAPVPAQTVLLTGANGYLGRFLCLEWLERLD KTGGTLICVVRGSDAAAARKRLDSAFDSGDPGLLEHYQQLAARTLEVLAGDIG DPNLGLDDATWQRLAETVDLIVHPAALVNHVLPYTQLFGPNVVGTAEIVRLAI TARRKPVTYLSTVGVADQVDPAEYQEDSDVREMSAVRVVRESYANGYGNSK WAGEVLLREAHDLCGLPVAVFRSDMILAHSRYAGQLNVQDVFTRLILSLVATG IAPYSFYRTDADGNRQRAHYDGLPADFTAAAITALGIQATEGFRTYDVLNPYD DGISLDEFVDWLVESGHPIQRITDYSDWFHRFETAIRALPEKQRQASVLPLLDAY RNPCPAVRGAILPAKEFQAAVQTAKIGPEQDIPHLSAPLIDKYVSDLELLQLL* 7 carB MTSDVHDATDGVTETALDDEQSTRRIAELYATDPEFAAAAPLPAVVDAAHKPG LRLAEILQTLFTGYGDRPALGYRARELATDEGGRTVTRLLPRFDTLTYAQVWS RVQAVAAALRHNFAQPIYPGDAVATIGFASPDYLTLDLVCAYLGLVSVPLQHN APVSRLAPILAEVEPRILTVSAEYLDLAVESVRDVNSVSQLVVFMHPEVDDHR DALARAREQLAGKGIAVTTLDAIADEGAGLPAEPIYTADHDQRLAMILYTSGST GAPKGAMYTEAMVARLWTMSFITGDPTPVINVNFMPLNHLGGRIPISTAVQNG GTSYFVPESDMSTLFEDLALVRPTELGLVPRVADMLYQHHLATVDRLVTQGAD ELTAEKQAGAELREQVLGGRVITGFVSTAPLAAEMRAFLDITLGAHIVDGYGLT ETGAVTRDGVIVRPPVIDYKLIDVPELGYFSTDKPYPRGELLVRSQTLTPGYYKR PEVTASVFDRDGYYHTGDVMAETAPDHLVYVDRRNNVLKLAQGEFVAVANL EAVFSGAALVRQIFVYGNSERSFLLAVVVPTPEALEQYDPAALKAALADSLQRT ARDAELQSYEVPADFIVETEPFSAANGLLSGVGKLLRPNLKDRYGQRLEQMYA DIAATQANQLRELRRAAATQPVIDTLTQAAATILGTGSEVASDAHFTDLGGDSL SALTLSNLLSDFFGFEVPVGTIVNPATNLAQLAQHIEAQRTAGDRRPSFTTVHGA DATEIRASELTLDKFIDAETLRAAPGLPKVTTEPRTVLLSGANGWLGRFLTLQW LERLAPVGGTLITIVRGRDDAAARARLTQAYDTDPELSRRFAELADRHLRVVA GDIGDPNLGLTPEIWHRLAAEVDLVVHPAALVNHVLPYRQLFGPNVVGTAEVI KLALTERIKPVTYLSTVSVAMGIPDFEEDGDIRTVSPVRPLDGGYANGYGNSKW AGEVLLREAHDLCGLPVATFRSDMILAHPRYRGQVNVPDMFTRLLLSLLITGVA PRSFYIGDGERPRAHYPGLTVDFVAEAVTTLGAQQREGYVSYDVMNPHDDGIS LDVFVDWLIRAGHPIDRVDDYDDWVRRFETALTALPEKRRAQTVLPLLHAFRA PQAPLRGAPEPTEVFHAAVRTAKVGPGDIPHLDEALIDKYIRDLREFGLI* 8 PPTaseis MVDMKTTHTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHAGRKRKTE EntDfromE. HLAGRIAAVYALREYGYKCVPAIGELRQPVWPAEVYGSISHCGTTALAVVSRQ coliMG1655 PIGIDIEEIFSVQTARELTDNIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEI QTDAGFLDYQIISWNKQQVIIHRENEMFAVHWQIKEKIVITLCQHD* 9 Del-/ac/F-F AAAAACAGCAACAATGTGAGCTTTGTTGTAATTATATTGTAAACATATTGAT TCCGGGGATCCGTCGACC 10 Del-fadE-R AAACGGAGCCTTTCGGCTCCGTTATTCATTTACGCGGCTTCAACTTTCCTGT AGGCTGGAGCTGCTTC 11 fadE-L2 CGGGCAGGTGCTATGACCAGGAC 12 fadE-R1 CGCGGCGTTGACCGGCAGCCTGG 13 iFAB138 TGTAGGCTGGAGCTGCTTCGAAGTTCCTATACTTTCTAGAGAATAGGAACTT (DNA) CGGAATAGGAACTTCGAACTGCAGGTCGACGGATCCCCGGAATATTTAAAT CATTTGTACTTTTTGAACAGCAGAGTCGCATTATGGCCACCGAAGCCCAGGC TGTTGGACAGAACGTAGTTGACTTCTGCATTACGGCCCTCGTTAGGAACGTA ATCCAGGTCGCATTCCGGATCCGCCTCTTTGTAGCCGATGGTCGGCGGAATG AAACCCTCTTCAATAGCTTTGGCACAGATAATCGCTTCGACTGCACCGCCAG CGCCCAGCAGGTGGCCGGTCATGCTCTTGGTGCTAGACACCGGCACTTTGTA GGCGTATTCACCCAGGACCGTCTTGATCGCTTGGGTTTCGAAGCTGTCATTG TACGCCGTGCTCGTACCGTGCGCGTTGATATAGGAAATGTCCTCTGGGCGGA CATTATCTTCTTCCATTGCCAGTTTCATTGCACGTGCACCACCTTCACCATTC GGCGCTGGGCTCGTGATATGATATGCGTCGCAGGTCGCACCATAGCCAACG ATCTCGGCATAGATTTTGGCACCACGCTTCAGCGCGTGCTCCAACTCTTCCA AGATAACGATACCGCTGCCCTCGCCCATCACAAAACCGCTGCGATCCTTATC GAACGGGATGCTGGCGCGCTTCGGGTCCTCAGATTTGGTCACGGCCTTCATC GAGGCAAAACCCGCCAGGCTCAACGGGGTGATACCTGCTTCGCTACCACCA GAGATCATAACGTCGCTATAACCAAACTTAATGTTACGGAAGGACTCACCA ATGCTGTTGTTCGCGCTCGCACATGCGGTGACAATGGTCGTGCAAATACCTT TAGCGCCATAACGAATCGCCAGATTACCGCTTGCCATATTCGCAATGATCAT CGGAATAGTCATAGGGCTCACACGACCCGGACCTTTGGTAATCAGCTTTTCA TCCTGCTTCTCAATGGTGCCGATGCCGCCAATGCCGCTACCAACAATGACGC CGAAACGATTCTTATCAATCGACTCCAGGTCCAGTTTGCTGTCCTTGATTGC CTCATCCGCCGCAACGATCGCAAACTGGCTAAAACGGTCCATACGGTTCGC CTCACGCTTGTCGATAAAGTCCTCCGGGGTGAAGTCCTTCACTTCGGCAGCC AGCTTAACTTTGAAATCGGTTGCGTCAAACGCTTTGATCTTGTCAATGCCAC ATTTACCCTCTTTGATGCTGCACCAGAAGCTATCAGCGTTGTTACCCACCGG CGTCACTGCACCAATACCCGTAATGACAACGCGGCGATTCATtttgttgcctccttTT Agaacgcggaagtatcctggaacaaaccgactacaaatcgtgtgcggtatagatcaggcgaccatccaccagaacctcacc gtccgccaggcccatgatcaggcgacggtttacgatacgtagaaatgaatacgataggtgactttcctggctgtcggcagaac ctggccggtaaatttcacttcgcccacgcccagagcgcggcctagccttcgccgcccaaccagcccaggtagaatcccacc aattgccacatagcatccagacccagacaaccgggcatcaccggatcgccgataaagtggcatccgaagaaccatagatcc ggattgatatccagctcggcttcgacatagcctttgtcgaaattgccgcccgtttcggtcatcttaacgacgcggtccatcatcag catgttcggtgcagggagttgcggccctttagcgccaaacagttcaccacgaccagaggcaagaaggtcttcttttgtatagga ttcgcgtttatctaccatgttttatgtaaaccttaaaaTTAAACCATGTACATTCCGCCGTTGACGTGC AGAGTCTCACCAGTGATGTAACTCGCTTCGTCAGAGGCTAAAAATGCAACC GCACTGGCGATTTCCTGAGCGCCGCCGAGGCGACCCGCAGGCACCTGCGCC AGGATACCCGCACGCTGATCGTCAGACAGCGCACGCGTCATGTCCGTTTCA ATAAAACCCGGAGCCACAACATTGACAGTAATACCACGGGACGCAACTTCA CGCGCCAGTGATTTACTGAAACCGATCAGGCCCGCTTTCGCCGCAGCGTAGT TTGCCTGACCTGCATTTCCCATGGTACCAACCACAGAACCAATAGTGATAAT GCGACCACAACGCTTTTTCATCATAGCGCGCATTACCGCTTTTGACAGGCGG AAAACGGATGATAAGTTGGTTTCGATAATATCGTTCCACTCATCATCTTTCA TTCGCATCAACAGATTATCACGAGTGATACCGGCATTATTAACCAGGATATC CACTTCACCAAATTCTGCGCGAATATTTTCCAGAACAGATTCAATAGATGCA GGATCGGTCACATTCAACATCAAACCTTTCCCGTTAGCACCTAAATAGTCGC TAATGTTCTTCGCACCATTTTCACTGGTCGCAGTCCCGATAACTTTCGCGCC GCGGGCAACGAGAGTCTCTGCAATTGCGCGGCCTATGCCACGGCTTGCACC AGTCACCAGCGCAATCTTTCCTTCAAAGCTCATGGTTTTCCTCTTTTATTGCG TAAGTGCCGCAGACAGCGCCGCCGGCTCGTTCAGCGCCGACGCTGTCAGGG TGTCGACAATACGTTTCGTCAGACCAGTGAGGACTTTACCTGGACCCACTTC ATAAAGATGTTCAACGCCCTGCGCCGCGATAAATTCCACGCTCTTCGTCCAC TGTACCGGATTGTACAACTGGCGAACCAGCGCATCGCGGATAGCGGCGGCA TCGGTTTCACATTTCACGTCAACGTTGTTCACTACCGGCACCGTTGGCGCGC TAAAGGTAATTTTGGCTAATTCAACCGCCAGCTTATCTGCCGCTGGTTTCAT CAGCGCGCAGTGCGACGGTACGCTCACCGGCAGCGGCAGCGCGCGTTTCGC GCCAGCGGCTTTACAGGCTGCGCCCGCACGTTCTACCGCCTCTTTATGCCCG GCGATAACCACCTGTCCCGGCGAGTTAAAGTTAACCGGCGAAACAACCTGC CCTTCGGCAGATTCTTCACAGGCTTTAGCAATAGAGGCATCATCCAGCCCGA TGATCGCAGACATGCCGCCAGTGCCTTCCGGAACCGCTTCCTGCATGAATTT ACCGCGCATTTCCACCAGACGAACGGCATCAGCAAAGTTGATGACGCCAGC GCAAACCAGCGCGGAATATTCGCCCAGGCTGTGACCTGCCATTAACGCAGG CATTTTACCGCCCTGCTGCTGCCAAACGCGCCAAAGCGCGACGGAAGCGGT TAATAACGCCGGCTGCGTCTGCCAGGTTTTATTCAGTTCTTCCGCTGGACCT TGCTGGGTGAGCGCCCACAGATCATATCCCAGAGCCGCAGAAGCTTCAGCA AACGTTTCTTCTACGATAGGGTAATTTGCCGCCATCTCGGCCAACATCCCAA CGCTCTGAGAACCCTGACCGGGGAACACAAATGCAAATTGCGTCATGTTTA AATCCTTATACTAGAAACGAATCAGCGCGGAGCCCCAGGTGAATCCACCCC CGAAGGCTTCAAGCAATACCAGCTGACCGGCTTTAATTCGCCCGTCACGCA CGGCTTCATCCAGCGCGCACGGCACAGAAGCCGCGGAGGTATTGCCGTGCC TGTCCAGCGTGACGACGACATTGTCCATCGACATGCCGAGTTTTTTCGCTGT CGCGCTAATGATACGCAGGTTAGCCTGATGCGGCACCAGCCAATCGAGTTC TGAGCGATCCAGGTTATTAGCCGCCAGCGTCTCATCGACAATATGCGCCAGT TCAGTGACCGCCACTTTAAAGACTTCATTGCCCGCCATTGTCAGGTAAATCG GGTTATCCGGATTTACGCGATCGGCATTCGGCAGGGTCAGTAATTCACCGTA ACGGCCATCGGCATGAAGATGAGTGGAGATAATACCCGGTTCTTCAGAAGC GCTCAGTACGGCCGCGCCTGCGCCATCGCCGAAAATAATGATCGTACCGCG ATCGCCAGGATCGCAAGTGCGGGCTAATACATCGGAACCGACCACCAGCGC GTGTTTAACCGCGCCGGATTTAACGTACTGGTCGGCGATGCTTAACGCGTAG GTGAAACCTGCGCACGCTGCCGCGACATCAAACGCCGGGCAACCTTTAATA CCGAGCATACTTTGAATCTGACATGCCGCGCTTGGAAATGCATGCGTTGCTG ATGTGGTAGCCACCACAATCAAGCCAATTTGGTCTTTATCGATCCCCGCCAT CTCAATCGCGCGATTCGCAGCGGTAAAGCCCATCGTCGCGACAGTTTCATTC GGCGCGGCGATATGGCGTTTACGAATACCTGTACGAGTGACAATCCACTCG TCAGAGGTCTCAACCATTTTTTCCAGATCGGCGTTAGTCCGCACTTGTTCGG GCAGATAGCTGCCAGTACCAATAATCTTCGTATACATGTACGCTCAGTCACT aaaTTACTCGATATCAATCACATCAAATTCGACTTCTGGATTGACGTCAGCAT CGTAATCAATGCCTTCAATGCCAAAGCCAAACAGCTTGATGAACTCTTCTTT GTACATGTCGTAATCGGTCAGCTCACGCAGGTTCTCTGTGGTGATTTGTGGC CACAGATCACGGCAGTGCTGCTGAATGTCATCACGCAGTTCCCAGTCATCCA AACGCAGACGATTGTGATCATCCACTTCCGGCGCTGAACCATCT 14 DG150 GCAGTTATTGGTGCCCTTAAACGCCTGGTTGCTACGCCTG 15 DG131 GAGCCAATATGCGAGAACACCCGAGAA 16 LC277 CGCTGAACGTATTGCAGGCCGAGTTGCTGCACCGCTCCCGCCAGGCAG 17 LC278 GGAATTGCCACGGTGCGGCAGGCTCCATACGCGAGGCCAGGTTATCCAACG 18 DG407 AATCACCAGCACTAAAGTGCGCGGTTCGTTACCCG 19 DG408 ATCTGCCGTGGATTGCAGAGTCTATTCAGCTACG 20 Primer1for GCAATTCCATATGACGAGCGATGTTCACGA prepof CarB60 21 Primer2for CCGCTCGAGTAAATCAGACCGAACTCGCG prepof CarB60 22 pET15b- ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGC carB GGCAGCCAT construct(60 ntdirectly upstreamof thecarB gene) 23 carB60 ACGGATCCCCGGAATGCGCAACGCAATTAATGTaAGTTAGCGC amplified from pCL_carB60 forward primer 24 carB60 TGCGTCATCGCCATTGAATTCCTAAATCAGACCGAACTCGCGCAGG amplified from pCL_carB60 reverse primer 25 carB60 ATTCCGGGGATCCGTCGACC amplified frompAH56 forward primer 26 carB60 AATGGCGATGACGCATCCTCACG amplified frompAH56 reverse primer 27 HZ117 ACGGAAAGGAGCTAGCACATGGGCAGCAGCCATCATCAT primer 28 DG264 GTAAAGGATGGACGGCGGTCACCCGCC primer 29 DG263 CACGGCGGGTGACCGCCGTCCATCC primer 30 HZ118 TTAATTCCGGGGATCCCTAAATCAGACCGAACTCGCGCAGGTC primer 31 SL59primer CAGCCGTTTATTGCCGACTGGATG 32 EG479 CTGTTTTATCAGACCGCTTCTGCGTTC primer 33 PrimerEG58 GCACTCGACCGGAATTATCG 34 Primer GCACTACGCGTACTGTGAGCCAGAG EG626 35 Primer GAGGAATAAACCATGACGAGCGATGTTCACGACGCGACCGACGGC DG243 36 Primer CTAAATCAGACCGAACTCGCGCAGG DG210 37 Primer CATGGTTTATTCCTCCTTATTTAATCGATAC DG228 38 Primer TGACCTGCGCGAGTTCGGTCTGATTTAG DG318 39 carA MTIETREDRFNRRIDHLFETDPQFAAARPDEAISAAAADPELRLPAAVKQILAGY (protein) ADRPALGKRAVEFVTDEEGRTTAKLLPRFDTITYRQLAGRIQAVTNAWHNHPV NAGDRVAILGFTSVDYTTIDIALLELGAVSVPLQTSAPVAQLQPIVAETEPKVIAS SVDFLADAVALVESGPAPSRLVVFDYSHEVDDQREAFEAAKGKLAGTGVVVE TITDALDRGRSLADAPLYVPDEADPLTLLIYTSGSTGTPKGAMYPESKTATMWQ AGSKARWDETLGVMPSITLNFMPMSHVMGRGILCSTLASGGTAYFAARSDLST FLEDLALVRPTQLNFVPRIWDMLFQEYQSRLDNRRAEGSEDRAEAAVLEEVRT QLLGGRFVSALTGSAPISAEMKSWVEDLLDMHLLEGYGSTEAGAVFIDGQIQRP PVIDYKLVDVPDLGYFATDRPYPRGELLVKSEQMFPGYYKRPEITAEMFDEDG YYRTGDIVAELGPDHLEYLDRRNNVLKLSQGEFVTVSKLEAVFGDSPLVRQIYV YGNSARSYLLAVVVPTEEALSRWDGDELKSRISDSLQDAARAAGLQSYEIPRDF LVETTPFTLENGLLTGIRKLARPKLKAHYGERLEQLYTDLAEGQANELRELRRN GADRPVVETVSRAAVALLGASVTDLRSDAHFTDLGGDSLSALSFSNLLHEIFDV DVPVGVIVSPATDLAGVAAYIEGELRGSKRPTYASVHGRDATEVRARDLALGK FIDAKTLSAAPGLPRSGTEIRTVLLTGATGFLGRYLALEWLERMDLVDGKVICL VRARSDDEARARLDATFDTGDATLLEHYRALAADHLEVIAGDKGEADLGLDH DTWQRLADTVDLIVDPAALVNHVLPYSQMFGPNALGTAELIRIALTTTIKPYVY VSTIGVGQGISPEAFVEDADIREISATRRVDDSYANGYGNSKWAGEVLLREAHD WCGLPVSVFRCDMILADTTYSGQLNLPDMFTRLMLSLVATGIAPGSFYELDAD GNRQRAHYDGLPVEFIAEAISTIGSQVTDGFETFHVMNPYDDGIGLDEYVDWLI EAGYPVHRVDDYATWLSRFETALRALPERQRQASLLPLLHNYQQPSPPVCGAM APTDRFRAAVQDAKIGPDKDIPHVTADVIVKYISNLQMLGLL* 40 FadD9 MSINDQRLTRRVEDLYASDAQFAAASPNEAITQAIDQPGVALPQLIRMVMEGY (protein) ADRPALGQRALRFVTDPDSGRTMVELLPRFETITYRELWARAGTLATALSAEPA IRPGDRVCVLGFNSVDYTTIDIALIRLGAVSVPLQTSAPVTGLRPIVTETEPTMIA TSIDNLGDAVEVLAGHAPARLVVFDYHGKVDTHREAVEAARARLAGSVTIDTL AELIERGRALPATPIADSADDALALLIYTSGSTGAPKGAMYRESQVMSFWRKSS GWFEPSGYPSITLNFMPMSHVGGRQVLYGTLSNGGTAYFVAKSDLSTLFEDLA LVRPTELCFVPRIWDMVFAEFHSEVDRRLVDGADRAALEAQVKAELRENVLG GRFVMALTGSAPISAEMTAWVESLLADVHLVEGYGSTEAGMVLNDGMVRRPA VIDYKLVDVPELGYFGTDQPYPRGELLVKTQTMFPGYYQRPDVTAEVFDPDGF YRTGDIMAKVGPDQFVYLDRRNNVLKLSQGEFIAVSKLEAVFGDSPLVRQIFIY GNSARAYPLAVVVPSGDALSRHGIENLKPVISESLQEVARAAGLQSYEIPRDFIIE TTPFTLENGLLTGIRKLARPQLKKFYGERLERLYTELADSQSNELRELRQSGPDA PVLPTLCRAAAALLGSTAADVRPDAHFADLGGDSLSALSLANLLHEIFGVDVPV GVIVSPASDLRALADHIEAARTGVRRPSFASIHGRSATEVHASDLTLDKFIDAAT LAAAPNLPAPSAQVRTVLLTGATGFLGRYLALEWLDRMDLVNGKLICLVRARS DEEAQARLDATFDSGDPYLVRHYRELGAGRLEVLAGDKGEADLGLDRVTWQR LADTVDLIVDPAALVNHVLPYSQLFGPNAAGTAELLRLALTGKRKPYIYTSTIA VGEQIPPEAFTEDADIRAISPTRRIDDSYANGYANSKWAGEVLLREAHEQCGLP VTVFRCDMILADTSYTGQLNLPDMFTRLMLSLAATGIAPGSFYELDAHGNRQR AHYDGLPVEFVAEAICTLGTHSPDRFVTYHVMNPYDDGIGLDEFVDWLNSPTS GSGCTIQRIADYGEWLQRFETSLRALPDRQRHASLLPLLHNYREPAKPICGSIAP TDQFRAAVQEAKIGPDKDIPHLTAAIIAKYISNLRLLGLL* 41 carA(DNA) atgacgatcgaaacgcgcgaagaccgcttcaaccggcgcattgaccacttgttcgaaaccgacccgcagttcgccgccgcc cgtcccgacgaggcgatcagcgcggctgccgccgatccggagttgcgccttcctgccgcggtcaaacagattctggccggc tatgcggaccgccctgcgctgggcaagcgcgccgtcgagttcgtcaccgacgaagaaggccgcaccaccgcgaagctcct gccccgcttcgacaccatcacctaccgtcagctcgcaggccggatccaggccgtgaccaatgcctggcacaaccatccggt gaatgccggtgaccgcgtggccatcctgggtacaccagtgtcgactacacgacgatcgacatcgccctgctcgaactcggc gccgtgtccgtaccgctgcagaccagtgcgccggtggcccaactgcagccgatcgtcgccgagaccgagcccaaggtgat cgcgtcgagcgtcgacttcctcgccgacgcagtcgctctcgtcgagtccgggcccgcgccgtcgcgactggtggtgttcgac tacagccacgaggtcgacgatcagcgtgaggcgttcgaggcggccaagggcaagctcgcaggcaccggcgtcgtcgtcg agacgatcaccgacgcactggaccgcgggcggtcactcgccgacgcaccgctctacgtgcccgacgaggccgacccgct gacccttctcatctacacctccggcagcaccggcactcccaagggcgcgatgtaccccgagtccaagaccgccacgatgtg gcaggccgggtccaaggcccggtgggacgagaccctcggcgtgatgccgtcgatcaccctgaacttcatgcccatgagtca cgtcatggggcgcggcatcctgtgcagcacactcgccagcggcggaaccgcgtacttcgccgcacgcagcgacctgtcca ccttcctggaggacctcgccctcgtgcggcccacgcagctcaacttcgttcctcgcatctgggacatgctgttccaggagtacc agagccgcctcgacaaccgccgcgccgagggatccgaggaccgagccgaagccgcagtcctcgaagaggtccgcaccc aactgctcggcgggcgattcgtttcggccctgaccggatcggctcccatctcggcggagatgaagagctgggtcgaggacct gctcgacatgcatctgctggagggctacggctccaccgaggccggcgcggtgttcatcgacgggcagatccagcgcccgc cggtcatcgactacaagctggtcgacgtgcccgatctcggctacttcgccacggaccggccctacccgcgcggcgaacttct ggtcaagtccgagcagatgttccccggctactacaagcgtccggagatcaccgccgagatgttcgacgaggacgggtacta ccgcaccggcgacatcgtcgccgagctcgggcccgaccatctcgaatacctcgaccgccgcaacaacgtgctgaaactgtc gcagggcgaattcgtcacggtctccaagctggaggcggtgttcggcgacagccccctggtacgccagatctacgtctacggc aacagcgcgcggtcctatctgctggcggtcgtggtcccgaccgaagaggcactgtcacgttgggacggtgacgaactcaag tcgcgcatcagcgactcactgcaggacgcggcacgagccgccggattgcagtcgtatgagatcccgcgtgacttcctcgtcg agacaacacctacacgctggagaacggcctgctgaccggtatccgcaagctggcccggccgaaactgaaggcgcactacg gcgaacgcctcgaacagctctacaccgacctggccgaggggcaggccaacgagttgcgcgagttgcgccgcaacggagc cgaccggcccgtggtcgagaccgtcagccgcgccgcggtcgcactgctcggtgcctccgtcacggatctgcggtccgatgc gcacttcaccgatctgggtggagattcgttgtcggccttgagcttctcgaacctgttgcacgagatcttcgatgtcgacgtgccg gtcggcgtcatcgtcagcccggccaccgacctggcaggcgtcgcggcctacatcgagggcgaactgcgcggctccaagcg ccccacatacgcgtcggtgcacgggcgcgacgccaccgaggtgcgcgcgcgtgatctcgccctgggcaagttcatcgacg ccaagaccctgtccgccgcgccgggtctgccgcgttcgggcaccgagatccgcaccgtgctgctgaccggcgccaccggg ttcctgggccgctatctggcgctggaatggctggagcgcatggacctggtggacggcaaggtgatctgcctggtgcgcgccc gcagcgacgacgaggcccgggcgcgtctggacgccacgttcgacaccggggacgcgacactgctcgagcactaccgcg cgctggcagccgatcacctcgaggtgatcgccggtgacaagggcgaggccgatctgggtctcgaccacgacacgtggcag cgactggccgacaccgtcgatctgatcgtcgatccggccgccctggtcaatcacgtcctgccgtacagccagatgttcggacc caatgcgctcggcaccgccgaactcatccggatcgcgctgaccaccacgatcaagccgtacgtgtacgtctcgacgatcggt gtgggacagggcatctcccccgaggcgttcgtcgaggacgccgacatccgcgagatcagcgcgacgcgccgggtcgacg actcgtacgccaacggctacggcaacagcaagtgggccggcgaggtcctgctgcgggaggcgcacgactggtgtggtctg ccggtctcggtgttccgctgcgacatgatcctggccgacacgacctactcgggtcagctgaacctgccggacatgttcacccg cctgatgctgagcctcgtggcgaccggcatcgcgcccggttcgttctacgaactcgatgcggacggcaaccggcagcgcgc ccactacgacgggctgcccgtggagttcatcgccgaggcgatctccaccatcggctcgcaggtcaccgacggattcgagac gttccacgtgatgaacccgtacgacgacggcatcggcctcgacgagtacgtggactggctgatcgaggccggctaccccgt gcaccgcgtcgacgactacgccacctggctgagccggttcgaaaccgcactgcgggccctgccggaacggcaacgtcag gcctcgctgctgccgctgctgcacaactatcagcagccctcaccgcccgtgtgcggtgccatggcacccaccgaccggttcc gtgccgcggtgcaggacgcgaagatcggccccgacaaggacattccgcacgtcacggccgacgtgatcgtcaagtacatc agcaacctgcagatgctcggattgctgtaa 42 FadD9 atgtcgatcaacgatcagcgactgacacgccgcgtcgaggacctatacgccagcgacgcccagttcgccgccgccagtccc (DNA) aacgaggcgatcacccaggcgatcgaccagcccggggtcgcgcttccacagctcatccgtatggtcatggagggctacgcc gatcggccggcactcggccagcgtgcgctccgcttcgtcaccgaccccgacagcggccgcaccatggtcgagctactgcc gcggttcgagaccatcacctaccgcgaactgtgggcccgcgccggcacattggccaccgcgttgagcgctgagcccgcgat ccggccgggcgaccgggtttgcgtgctgggcttcaacagcgtcgactacacaaccatcgacatcgcgctgatccggttgggc gccgtgtcggttccactgcagaccagtgcgccggtcaccgggttgcgcccgatcgtcaccgagaccgagccgacgatgatc gccaccagcatcgacaatcttggcgacgccgtcgaagtgctggccggtcacgccccggcccggctggtcgtattcgattacc acggcaaggttgacacccaccgcgaggccgtcgaagccgcccgagctcggttggccggctcggtgaccatcgacacactt gccgaactgatcgaacgcggcagggcgctgccggccacacccattgccgacagcgccgacgacgcgctggcgctgctga tttacacctcgggtagtaccggcgcacccaaaggcgccatgtatcgcgagagccaggtgatgagcttctggcgcaagtcgag tggctggttcgagccgagcggttacccctcgatcacgctgaacttcatgccgatgagccacgtcgggggccgtcaggtgctct acgggacgctttccaacggcggtaccgcctacttcgtcgccaagagcgacctgtcgacgctgttcgaggacctcgccctggt gcggcccacagaattgtgcttcgtgccgcgcatctgggacatggtgttcgcagagttccacagcgaggtcgaccgccgcttg gtggacggcgccgatcgagcggcgctggaagcgcaggtgaaggccgagctgcgggagaacgtgctcggcggacggttt gtcatggcgctgaccggttccgcgccgatctccgctgagatgacggcgtgggtcgagtccctgctggccgacgtgcatttggt ggagggttacggctccaccgaggccgggatggtcctgaacgacggcatggtgcggcgccccgcggtgatcgactacaagc tggtcgacgtgcccgagctgggctacttcggcaccgatcagccctacccccggggcgagctgctggtcaagacgcaaacca tgttccccggctactaccagcgcccggatgtcaccgccgaggtgttcgaccccgacggcttctaccggaccggggacatcat ggccaaagtaggccccgaccagttcgtctacctcgaccgccgcaacaacgtgctaaagctctcccagggcgagttcatcgcc gtgtcgaagctcgaggcggtgttcggcgacagcccgctggtccgacagatcttcatctacggcaacagtgcccgggcctacc cgctggcggtggttgtcccgtccggggacgcgctttctcgccatggcatcgagaatctcaagcccgtgatcagcgagtccctg caggaggtagcgagggcggccggcctgcaatcctacgagattccacgcgacttcatcatcgaaaccacgccgttcaccctg gagaacggcctgctcaccggcatccgcaagctggcacgcccgcagttgaagaagttctatggcgaacgtctcgagcggctc tataccgagctggccgatagccaatccaacgagctgcgcgagctgcggcaaagcggtcccgatgcgccggtgcttccgacg ctgtgccgtgccgcggctgcgttgctgggctctaccgctgcggatgtgcggccggacgcgcacttcgccgacctgggtggtg actcgctctcggcgctgtcgttggccaacctgctgcacgagatcttcggcgtcgacgtgccggtgggtgtcattgtcagcccg gcaagcgacctgcgggccctggccgaccacatcgaagcagcgcgcaccggcgtcaggcgacccagcttcgcctcgatac acggtcgctccgcgacggaagtgcacgccagcgacctcacgctggacaagttcatcgacgctgccaccctggccgcagcc ccgaacctgccggcaccgagcgcccaagtgcgcaccgtactgctgaccggcgccaccggctttttgggtcgctacctggcg ctggaatggctcgaccgcatggacctggtcaacggcaagctgatctgcctggtccgcgccagatccgacgaggaagcacaa gcccggctggacgcgacgttcgatagcggcgacccgtatttggtgcggcactaccgcgaattgggcgccggccgcctcga ggtgctcgccggcgacaagggcgaggccgacctgggcctggaccgggtcacctggcagcggctagccgacacggtgga cctgatcgtggaccccgcggccctggtcaaccacgtgctgccgtatagccagctgttcggcccaaacgcggcgggcaccgc cgagttgcttcggctggcgctgaccggcaagcgcaagccatacatctacacctcgacgatcgccgtgggcgagcagatccc gccggaggcgttcaccgaggacgccgacatccgggccatcagcccgacccgcaggatcgacgacagctacgccaacgg ctacgcgaacagcaagtgggccggcgaggtgctgctgcgcgaagctcacgagcagtgcggcctgccggtgacggtcttcc gctgcgacatgatcctggccgacaccagctataccggtcagctcaacctgccggacatgttcacccggctgatgctgagcctg gccgctaccggcatcgcacccggttcgttctatgagctggatgcgcacggcaatcggcaacgcgcccactatgacggcttgc cggtcgaattcgtcgcagaagccatttgcacccttgggacacatagcccggaccgttttgtcacctaccacgtgatgaacccct acgacgacggcatcgggctggacgagttcgtcgactggctcaactccccaactagcgggtccggttgcacgatccagcgga tcgccgactacggcgagtggctgcagcggttcgagacttcgctgcgtgccttgccggatcgccagcgccacgcctcgctgct gcccttgctgcacaactaccgagagcctgcaaagccgatatgcgggtcaatcgcgcccaccgaccagttccgcgctgccgtc caagaagcgaaaatcggtccggacaaagacattccgcacctcacggcggcgatcatcgcgaagtacatcagcaacctgcga ctgctcgggctgctgtga 44 carB60 atgggcagcagccatcatcatcatcatcacagcagcggcctggtgccgcgcggcagccatATGACGAGCGATG (DNA) TTCACGACGCGACCGACGGCGTTACCGAGACTGCACTGGATGATGAGCAGA GCACTCGTCGTATTGCAGAACTGTACGCAACGGACCCAGAGTTCGCAGCAG CAGCTCCTCTGCCGGCCGTTGTCGATGCGGCGCACAAACCGGGCCTGCGTCT GGCGGAAATCCTGCAGACCCTGTTCACCGGCTACGGCGATCGTCCGGCGCT GGGCTATCGTGCACGTGAGCTGGCGACGGACGAAGGCGGTCGTACGGTCAC GCGTCTGCTGCCGCGCTTCGATACCCTGACCTATGCACAGGTGTGGAGCCGT GTTCAAGCAGTGGCTGCAGCGTTGCGTCACAATTTCGCACAACCGATTTACC CGGGCGACGCGGTCGCGACTATCGGCTTTGCGAGCCCGGACTATTTGACGC TGGATCTGGTGTGCGCGTATCTGGGCCTGGTCAGCGTTCCTTTGCAGCATAA CGCTCCGGTGTCTCGCCTGGCCCCGATTCTGGCCGAGGTGGAACCGCGTATT CTGACGGTGAGCGCAGAATACCTGGACCTGGCGGTTGAATCCGTCCGTGAT GTGAACTCCGTCAGCCAGCTGGTTGTTTTCGACCATCATCCGGAAGTGGACG ATCACCGTGACGCACTGGCTCGCGCACGCGAGCAGCTGGCCGGCAAAGGTA TCGCAGTTACGACCCTGGATGCGATCGCAGACGAAGGCGCAGGTTTGCCGG CTGAGCCGATTTACACGGCGGATCACGATCAGCGTCTGGCCATGATTCTGTA TACCAGCGGCTCTACGGGTGCTCCGAAAGGCGCGATGTACACCGAAGCGAT GGTGGCTCGCCTGTGGACTATGAGCTTTATCACGGGCGACCCGACCCCGGTT ATCAACGTGAACTTCATGCCGCTGAACCATCTGGGCGGTCGTATCCCGATTA GCACCGCCGTGCAGAATGGCGGTACCAGCTACTTCGTTCCGGAAAGCGACA TGAGCACGCTGTTTGAGGATCTGGCCCTGGTCCGCCCTACCGAACTGGGTCT GGTGCCGCGTGTTGCGGACATGCTGTACCAGCATCATCTGGCGACCGTGGA TCGCCTGGTGACCCAGGGCGCGGACGAACTGACTGCGGAAAAGCAGGCCG GTGCGGAACTGCGTGAACAGGTCTTGGGCGGTCGTGTTATCACCGGTTTTGT TTCCACCGCGCCGTTGGCGGCAGAGATGCGTGCTTTTCTGGATATCACCTTG GGTGCACACATCGTTGACGGTTACGGTCTGACCGAAACCGGTGCGGTCACC CGTGATGGTGTGATTGTTCGTCCTCCGGTCATTGATTACAAGCTGATCGATG TGCCGGAGCTGGGTTACTTCTCCACCGACAAACCGTACCCGCGTGGCGAGC TGCTGGTTCGTAGCCAAACGTTGACTCCGGGTTACTACAAGCGCCCAGAAG TCACCGCGTCCGTTTTCGATCGCGACGGCTATTACCACACCGGCGACGTGAT GGCAGAAACCGCGCCAGACCACCTGGTGTATGTGGACCGCCGCAACAATGT TCTGAAGCTGGCGCAAGGTGAATTTGTCGCCGTGGCTAACCTGGAGGCCGT TTTCAGCGGCGCTGCTCTGGTCCGCCAGATTTTCGTGTATGGTAACAGCGAG CGCAGCTTTCTGTTGGCTGTTGTTGTCCCTACCCCGGAGGCGCTGGAGCAAT ACGACCCTGCCGCATTGAAAGCAGCCCTGGCGGATTCGCTGCAGCGTACGG CGCGTGATGCCGAGCTGCAGAGCTATGAAGTGCCGGCGGACTTCATTGTTG AGACTGAGCCTTTTAGCGCTGCGAACGGTCTGCTGAGCGGTGTTGGCAAGTT GCTGCGTCCGAATTTGAAGGATCGCTACGGTCAGCGTTTGGAGCAGATGTA CGCGGACATCGCGGCTACGCAGGCGAACCAATTGCGTGAACTGCGCCGTGC TGCGGCTACTCAACCGGTGATCGACACGCTGACGCAAGCTGCGGCGACCAT CCTGGGTACCGGCAGCGAGGTTGCAAGCGACGCACACTTTACTGATTTGGG CGGTGATTCTCTGAGCGCGCTGACGTTGAGCAACTTGCTGTCTGACTTCTTT GGCTTTGAAGTCCCGGTTGGCACGATTGTTAACCCAGCGACTAATCTGGCAC AGCTGGCGCAACATATCGAGGCGCAGCGCACGGCGGGTGACCGCCGTCCAT CCTTTACGACGGTCCACGGTGCGGATGCTACGGAAATCCGTGCAAGCGAAC TGACTCTGGACAAATTCATCGACGCTGAGACTCTGCGCGCAGCACCTGGTTT GCCGAAGGTTACGACTGAGCCGCGTACGGTCCTGTTGAGCGGTGCCAATGG TTGGTTGGGCCGCTTCCTGACCCTGCAGTGGCTGGAACGTTTGGCACCGGTT GGCGGTACCCTGATCACCATTGTGCGCGGTCGTGACGATGCAGCGGCACGT GCACGTTTGACTCAGGCTTACGATACGGACCCAGAGCTGTCCCGCCGCTTCG CTGAGTTGGCGGATCGCCACTTGCGTGTGGTGGCAGGTGATATCGGCGATC CGAATCTGGGCCTGACCCCGGAGATTTGGCACCGTCTGGCAGCAGAGGTCG ATCTGGTCGTTCATCCAGCGGCCCTGGTCAACCACGTCCTGCCGTACCGCCA GCTGTTTGGTCCGAATGTTGTTGGCACCGCCGAAGTTATCAAGTTGGCTCTG ACCGAGCGCATCAAGCCTGTTACCTACCTGTCCACGGTTAGCGTCGCGATGG GTATTCCTGATTTTGAGGAGGACGGTGACATTCGTACCGTCAGCCCGGTTCG TCCGCTGGATGGTGGCTATGCAAATGGCTATGGCAACAGCAAGTGGGCTGG CGAGGTGCTGCTGCGCGAGGCACATGACCTGTGTGGCCTGCCGGTTGCGAC GTTTCGTAGCGACATGATTCTGGCCCACCCGCGCTACCGTGGCCAAGTGAAT GTGCCGGACATGTTCACCCGTCTGCTGCTGTCCCTGCTGATCACGGGTGTGG CACCGCGTTCCTTCTACATTGGTGATGGCGAGCGTCCGCGTGCACACTACCC GGGCCTGACCGTCGATTTTGTTGCGGAAGCGGTTACTACCCTGGGTGCTCAG CAACGTGAGGGTTATGTCTCGTATGACGTTATGAATCCGCACGATGACGGT ATTAGCTTGGATGTCTTTGTGGACTGGCTGATTCGTGCGGGCCACCCAATTG ACCGTGTTGACGACTATGATGACTGGGTGCGTCGTTTTGAAACCGCGTTGAC CGCCTTGCCGGAGAAACGTCGTGCGCAGACCGTTCTGCCGCTGCTGCATGCC TTTCGCGCGCCACAGGCGCCGTTGCGTGGCGCCCCTGAACCGACCGAAGTG TTTCATGCAGCGGTGCGTACCGCTAAAGTCGGTCCGGGTGATATTCCGCACC TGGATGAAGCCCTGATCGACAAGTACATCCGTGACCTGCGCGAGTTCGGTC TGATTTAG