Means and methods for hyper-production of authentic human basic fibroblast growth factor in Escherichia coli
10273520 ยท 2019-04-30
Assignee
Inventors
Cpc classification
C12N15/70
CHEMISTRY; METALLURGY
C12N15/72
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
International classification
C12P21/02
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
Abstract
The present invention is concerned with a method of production of authentic human epidermal growth factor (EGF) and hyper-production of authentic basic fibroblast growth factor (bFGF) without any modification at either C- or N-terminal of the bFGF.
Claims
1. A method of production of authentic human epidermal growth factor (EGF) and hyper-production of authentic basic fibroblast growth factor (bFGF) without any modification at either C- or N-terminal of the bFGF, comprising: providing an Escherichia coli host; introducing a DNA construct into the Escherichia coli host to produce a transformed Escherichia coli host, the DNA construct including an insert consisting of, in the order of, an expression cassette, a DNA coding for the EGF polypeptide, a first intein sequence, a first copy of a DNA coding for authentic bFGF, a second intein sequence, and a second copy of a DNA coding for the authentic bFGF, but being devoid of an ompA leader sequence; subjecting the transformed Escherichia coli host to a fed-batch fermentation process; wherein: the DNA construct is configured to enable the transformed Escherichia coli host to produce the authentic bFGF in a soluble form cleaved and independent from proteins encoded by DNA regions preceding and subsequent to the authentic bFGF DNA codings in the insert, and intracellularly; the fed-batch fermentation process is free of an induction step making use Isopropyl -D-1-thiogalactopyranoside (IPTG); the fed-batch fermentation process includes, during an early log-growth phase, a feeding step for a duration of time of 6 hours or less; the fed-batch fermentation process includes, after the feeding step, a cultivation step for a duration of time of 7 hours or less; and the Escherichia coli host is configured to produce the bFGF at a concentration at least two times more than a Escherichia coli host transformed with the DNA construct but without the second intein sequence and the second copy of a DNA coding for the authentic bFGF can.
2. A method as claimed in claim 1, wherein the concentration of the produced bFGF at the end of the cultivation step is 610 mg per liter of cell culture.
3. A method as claimed in claim 1, wherein the intein sequences are Saccharomyces cerevisiae vascular membrane ATPase (VMA).
4. A biological system engineered from an Escherichia coli host, comprising a DNA construct including an insert consisting of, in the order of, an expression cassette, a DNA coding for the EGF polypeptide, a first intein sequence, a first copy of a DNA coding for authentic bFGF, a second intein sequence, and a second copy of a DNA coding for the authentic bFGF, but being devoid of an ompA leader sequence; wherein: the DNA construct is configured to enable the transformed Escherichia coli host to produce the authentic bFGF in a soluble form cleaved and independent from proteins encoded by DNA regions preceding and subsequent to the authentic bFGF DNA codings in the insert, and intracellularly; the system is configured to multiply in a fed-batch fermentation process; and the Escherichia coli host is configured to produce the bFGF at a concentration at least two times more than a Escherichia coli host transformed with the DNA construct but without the second intein sequence and the second copy of a DNA coding for the authentic bFGF.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1) Some embodiments of the present invention will now be explained, with reference to the accompanied drawings, in which:
(2)
(3)
(4)
(5)
(6)
(7)
DETAILED DESCRIPTION OF PREFERRED EMBODIMENTS OF THE INVENTION
(8) The versatile physiological functions of bFGF have recently attracted much attention. However, the incredible high prices of bFGF have seriously hindered its availability for wide-scale commercial applications. Moreover, despite the commercial availability of bFGF, very often only structural variants of bFGF instead of the 146 aa authentic product may be procured .sup.1. Conventional approaches of fusing bFGF with tag proteins or signal peptides have shown to be difficult in yielding the authentic 146 aa polypeptide.
(9) The present invention employs novel means and methods for amplification of gene expression, for use in hyper-production of authentic human basic fibroblast growth factor (hbFGF).
(10) It is to be noted that the reference of authentic hbFGF in the context of the present invention means the produced hbFGF is not only authentic in terms of the sequence having the exact 146 amino acids of the native hbFGF, it also possesses the same characteristics or configuration of solubility, bioactivity, non-truncation, free of modification at the C- or N-terminal, free of affinity tags, and is secreted/secretable at least to some extent, self-cleavable or cleaved from proteins or other proteins simultaneously produced, as the native hbFGF.
(11) It is also to be noted that the reference to hyper-production in the context of the present invention refers to the level of production more than at least twice of the expected level, or more than thrice of the expected level. In a preferred embodiment of the present invention, the level of hyper-production is six times of the expected level.
(12) Specifically, compared to the use of a DNA expression construct pWK3R, when an embodiment of an improved DNA construct of the present invention is used there is an unexpected increase in level of production of the authentic human basic fibroblast growth factor. (The improved DNA construct will be discussed below in this description.) When a refined fed-batch fermentation protocol is also adopted, the novel method can achieve a phenomenal and unexpected yield of 610 mg/L of the 146 aa with SEQ ID NO. 1 (NH.sub.2PALPEDGGSG.sup.|10AFPPGHFKDP.sup.|20KRLYCKNGGF.sup.|30FLRIHPDGRV.sup.|40DG VREKSDPH.sup.|50IKLQLQAEER.sup.|60GWSIKGVCA.sup.|70NRYLAMKED.sup.|80GRLLASKCV T.sup.|90DECFFFERLE.sup.|100SNNYNTYRSR.sup.|110KYTSWYVALK.sup.|120RTGQYKLGSK.sup.|130T GPGQKAILFL.sup.140PMSAKS-COOH) authentic human basic fibroblast growth factor (bFGF) in Escherichia coli. Please also see Appendix. (The refined fed-batch fermentation protocol will be discussed below in this application.) This is to be contrasted with when using a prior version of DNA construct and production protocol only about 100 mg/L was yielded. In other words, there is not just an increase of production level of two times or three times, but over six times. This increase of production level satisfies the definition of hyper-production in the context of the present invention. It is to be noted that there is a simultaneous production of authentic EFG. In an embodiment, the level of EGF production is at an unexpected level of substantially 74 mgL.sup.1.
(13) Studies show that with the improved DNA construct a majority of the bFGF was produced intracellular in the cytoplasm of the E. coli host, although in an experiment a small amount (18%) of the bFGF was found extracellularly in the supernatant. In an experiment in which a concentration of about 610 mg/L was yielded, about 510 mg/L was found intracellularly and about 109 mg/L was found extracellularly. Nevertheless, it was ascertained that regardless of the source both intracellularly and extracellularly bFGF produced was found to be authentic and functional with full potency. The meaning of authenticity in the context of the present invention has been discussed above.
(14) As preliminary discussion, experiments conducted leading to the present invention showed that the DNA construct pWK3R was first modified to form plasmid pWK311 ROmpAd, which was devoid of the ompA leader sequence and possessed two copies of a DNA segment encoding a fusion product comprising an intein, Saccharomyces cerevisiae vascular membrane ATPase (VMA), and bFGF. When E. coli transformant JM101 [pWK311ROmpAd] was cultivated using a refined fed-batch fermentation protocol, superb expression resulting in a total yield of 610 mg/L of bFGF was detected. Despite existing in high levels, the bFGF remained to be soluble and with the same level of bioactivity of the native hbFGF.
(15) Further details including experimental data of the present invention are discussed as follows.
(16) Strategy for Enhancing Expression of Recombinant bFGF
(17) The present invention began by employing a human epidermal growth factor (EGF) excretion plasmid, pWKW2, and the coding sequence for an intein, Saccharomyces cerevisiae vascular membrane ATPase (VMA). Then, an expression construct, pWK3R, has been engineered to achieve co-expression of authentic EGF and human basic fibroblast growth factor (bFGF) in E. coli. Please see
(18) The present invention enhances the expression of bFGF through a systematic approach involving two steps: first, by genetic modifications of pWK3R to delete the ompA leader sequence, and applying a novel amplification method, to achieve a two-fold increase in the copy number of the bfgf gene; and second, to further enhance the productivity of an optimized transformant expressing bFGF, employing a refined fed-batch fermentation protocol.
(19) Engineering of DNA Constructs Expressing bFGF
(20) Essentially, two different genetic modifications were performed on pWK3R (
(21) Time Course Studies
(22) Expression of bFGF in E. coli JM101 transformants harboring the four plasmids: pWK3R, pWK3ROmpAd, pWK311R and pWK311ROmpAd (
(23) Despite employing the same regulatory controls and intein, VMA, the four constructs resulted in noticeable difference in the level of bFGF expression (
(24) On the other hand, deletion of the OmpA signal peptide from the precursor products was notably beneficial to the overall expression of bFGF. Without the signal peptide, essentially all resources for bFGF production would be confined in the cytoplasm, as in the case of JM101 [pWK3ROmpAd] and JM101 [pWK311ROmpAd], thereby providing higher yields of bFGF than their respective counterparts, JM101 [pWK3R] and JM101 [pWK311R] (
(25) Primary Structure of bFGF Expressed in E. coli Tranformants Harboring the Four Constructs
(26) The primary structure of bFGF purified from the culture media and cell lysates of E. coli transformants harboring pWK3R, pWK3ROmpAd, pWK311R and pWK311ROmpAd was determined as previously reported.sup.9. Sequencing results confirmed that both the supernatant and cytoplasmic bFGF samples purified from the cultures of the four transformants contained the correct N- and C-termini (Table 2), supporting the conclusion that the bFGF samples comprised 146 aa residues, with the same composition as that of native bFGF. Another noteworthy point concerns the homogeneity of bFGF resulting from the expression of constructs pWK311R (
(27) Activities of bFGF Expressed by Constructs pWK3ROmpAd, pWK311R and pWK311ROmpAd
(28) Purified bFGF from both culture media and lysates of transformants JM101 [pWK3ROmpAd], JM101 [pWK311R] and JM101 [pWK311ROmpAd] were assayed for mitogenic activities performed as described previously .sup.9. The results revealed that all bFGF samples were as potent as that of the authentic standard (
(29) Fermentative Production of bFGF
(30) Among the four constructs studied, pWK311ROmpAd provided the best performance in bFGF expression (
(31) Referring to are presented. The fermentation intervals present developments of cell growth and bFGF expression during two different stages of cultivation (partitioned by the vertical dotted line): last phase of glucose feeding (3-6 h) and the pending period (6-13 h). Each growth experiment of the two transformants was repeated three times and standard error bars are shown. Glucose feeding was commenced at early log-growth phase and was stopped after cell growth had reached the stationary phase, during which production of bFGF was maximum (
(32) Surprisingly, the modified protocol was shown to be highly rewardable to result in a final yield of as high as 610 mg/L of bFGF, e.g., at 5 h after entering the pending period (
(33) Despite employing the refined fermentation protocol, JM101 [pWK3R] (
(34) In the course leading to the present invention, despite a variety of possible microbial systems which could be tried for production of useful recombinant proteins, the inventors have determined that E. coli is to be used for the expression of pharmaceutically important proteins, including a wide range of growth hormones and factors. Applying both excretion and intein-mediated expression systems, the inventors have unexpectedly achieved recombinant simultaneous production of two important skin growth factors, EGF and bFGF, as authentic proteins in E. coli.sup.9. Interestingly, using the latter approach, both independent and cleaved EGF and bFGF were detected not only in the culture medium, but also in the cytoplasm. Moreover, since both EGF and bFGF were identified as precisely processed products detached from their fusion intein partner, VMA, the results support the interpretation that their precursors/intermediates existed likely in soluble forms, which remained auto-cleavable to yield EGF and bFGF. The same approach has also been employed for co-expression and auto- or self-cleavages of fusion products formed between different inteins and widely dissimilar proteins. The products were also found to be free from undesirable modification at the C- or N-terminal, or truncation.
(35) During the course of the present invention of producing authentic bFGF, the inventors had also investigated the effects of two structural modifications: (i) deletion of the ompA leader sequence, and (ii) doubling the copy number of the DNA fusion formed between vma and the bfgf gene, on improving bFGF expression. It was unexpectedly found that both changes had a positive impact on the production of bFGF (
(36) The outcomes support the following conclusions. First, two copies of the bfgf gene yielded better bFGF expression than did one copy. This is counter intuitive and unexpected in three aspects. With the two copies, the increase in yield is not just twice as much, but more than six times. Further, conventionally, there were studies showing that excessive inducement of protein production would cause choking to the cell and cause death. However, with the DNA construct taught in the present invention, not only there was not cell choking or death, the production level is hyper-produced. The meaning of hyper-production has been discussed earlier on in this description.
(37) Second, deletion of the ompA leader sequence from constructs pWK3ROmpAd and pWK311ROmpAd (
(38) Third, while the two copies of bfgf gene in the DNA construct are identical, they are configured differently in that their adjacent elements are different. Specifically, one copy is sandwiched by two intein sequences while the other copy is not. Prior studies indicated that this configuration would cause the protein produced from one of the copies different (i.e. undersirably modified) from the authentic protein.
(39) The rewarding achievement of pWK311ROmpAd in small scale studies prompted us to investigate its performance in fermenter cultivation. We adapted a glucose feeding fed-batch approach previously employed to yield high levels of EGF in E. coli, with the following modifications. First, IPTG induction was excluded in growing JM101 [pWK311ROmpAd] since high efficiencies of transcription of heterologous genes might seriously retard cell growth. Second, a shortened, 6 h instead of the previously reported 9 h, glucose feeding regime was adopted. Despite using a significantly shorter feeding time, the rate of cell growth was shown to be normal and remained high at a cell density of over 10.sup.8 cells/ml (
(40) Although pWK311ROmpAd was devoid of the ompA leader, as a result of cell lysis, high levels of bFGF, reaching 110 mg/L, were released to the culture medium at the latter time points of the pending period (
(41) The application of the novel approach of gene amplification, as illustrated by the bfgf/vma/bfgf gene fusion engineered in constructs pWK311R (
(42) More details regarding experiments leading to the present invention are as follows.
(43) Methods
(44) Bacterial Strain & Chemicals
(45) E. coli strain JM101 was the host employed in this study. The Phusion PCR kit, restriction, and modifying enzymes were purchased from New England Biolabs (Ipswich, Mass., USA). All oligos were purchased from Invitrogen (Carlsbad, Calif., USA). Other chemicals were purchased from Sigma-Aldrich Corporation (St. Louis, Mo., USA) unless otherwise specified. Antibodies against bFGF were raised in rabbits.
Construction of Expression Constructs
Plasmids pWK311R and pWK3ROmpAd were derived from pWK3R, with the following modifications. The EcoRI-SphI fragment of pWK3R was replaced, by a PCR fragment formed using primers P5-P8 (Table 1), which was composed of the following components: lacUV5 promoter, lac operator (lacO), ribosomal binding site (RBS), and egf gene to form pWK3ROmpAd. Another PCR fragment, Fragment A, synthesized using primers P1-P4 (Table 1), containing the bfgf gene fused with the VMA coding sequence (vma), was inserted into the BamHI site of pWK3R to form pWK311R. Lastly, to develop pWK311ROmpAd, Fragment A was inserted into the BamHI site of pWK3ROmpAd.
Shake Flask Cultivations
E. coli transformants were grown at 34 C. in MMBL medium supplemented with 70 g/ml of ampicillin. In time-course experiments, a 250 ml flask containing 50 ml of growth medium was inoculated with a freshly grown colony and shaken at 250 rpm and 34 C. until the culture reached an A.sub.550 reading of 8.0. Subsequently, a final concentration of 0.1 mM IPTG was added and the culture was continuously grown for 8 h. Then 1 ml of the culture was centrifuged and the SN was saved. The cell pellet was suspended in 120 l of Tris.HCl buffer (50 mM, pH 8.0), followed by an addition of 83 l of EDTA solution (0.25 M, pH 8.0). The cell mixture was incubated on ice for 5 min and then treated with 120 l of lysozyme solution (10 mg/ml) at 37 C. for 20 min. After addition of 83 l of lysis buffer (10 mM EDTA, 10% Triton X-100, and 50 mM Tris.HCl, pH 8.0), the tube was inverted gently, followed by spinning at 13,000 rpm for 10 min to remove the cell debris. Both the clarified lysate (CL) and culture supernatant (SN) fractions were analyzed for bFGF by Western blot analysis, of which the images were quantified by densitometry using the ImageJ software (National Institutes of Health, USA).
Purification and Analysis of bFGF
The purification of bFGF using heparin-agarose chromatography and analysis of the purified bFGF by liquid chromatography tandem mass spectrometry were described previously.
Biological Assays of bFGF
The mitogenic effects of purified bFGF samples on the proliferation of BALB/C 3T3 fibroblast cells were analyzed by the MTT assay as described previously.
Fermentation
MMBL medium was used throughout the entire fermentation process including the preparation of starter cultures. To begin with, a fresh colony of JM101 [pWK311ROmpAd] was inoculated in 50 ml of MMBL medium supplemented with 70 g/ml of ampicillin. The cells were grown at 34 C. until an A.sub.550 reading reached 2.0. Then 15 ml of the starter were added into 135 ml of fresh MMBL medium supplemented with 70 g/ml of ampicillin, and the culture was grown for 3 h at 34 C. The entire 150 ml culture was then added into a 2 L fermentor containing 1.35 L of fresh MMBL medium. The pH of the culture was maintained at 6.8 using 1M NaOH solution. When the pH began to decrease, the culture was fed with 50% glucose at a rate of 4 ml/h. The pH was maintained at 6.8 until the A.sub.550 reading was 15.0, which took about 6 h to reach. The feeding process was then stopped, but the operation of the fermentor was allowed to continue for the next 7 h (pending period), during which lytic release of bFGF into the medium was expected to occur. Culture samples were collected at different time points of the fermentation process. The fractionated cell pellet and culture supernatant samples were then subjected to various analyses.
(46) It should be understood that certain features of the invention, which are, for clarity, described in the content of separate embodiments or experiments, may be provided in combination in a single embodiment. Conversely, various features of the invention which are, for brevity, described in the content of a single embodiment, may be provided separately or in any appropriate sub-combinations. It is to be noted that certain features of the embodiments are illustrated by way of non-limiting examples. Also, a skilled person in the art will be aware of the prior art which is not explained in the above for brevity purpose. Some of this prior art are indicated as follows, and their contents in entirety are incorporated herein.
REFERENCES
(47) 1. Bikfalvi, A., Klein, S., Pintucci, G. & Rifkin, D. B. Biological roles of fibroblast growth factor-2. Endocrine Reviews 18, 26-45 (1997). 2. Tabata, Y. et al. Bone regeneration by basic fibroblast growth factor complexed with biodegradable hydrogels. Biomaterials 19, 807-815 (1998). 3. Sellke, F. W., Laham, R. J., Edelman, E. R., Pearlman, J. D. & Simons, M. Therapeutic angiogenesis with basic fibroblast growth Factor: technique and early results. The Annals of Thoracic Surgery 65, 1540-1544 (1998). 4. Andrades, J. A. et al. Production of a recombinant human basic fibroblast growth factor with a collagen binding domain. Protoplasma 218, 95-103 (2001). 5. Mu, X. et al. High-level expression, purification, and characterization of recombinant human basic fibroblast growth factor in Pichia pastoris. Protein Expression and Purification 59, 282-288 (2008). 6. Garke, G., Deckwer, W. D. & Anspach, F. B. Preparative two-step purification of recombinant human basic fibroblast growth factor from high-cell-density cultivation of Escherichia coli. Journal of Chromatography B: Biomedical Sciences and Applications 737, 25-38 (2000). 7. Alibolandi, M., Mirzahoseini, H., Alibolandi, M. & Mirzahoseini, H. Purification and refolding of overexpressed human basic fibroblast growth factor in Escherichia coli. Biotechnology Research International, Biotechnology Research International 2011, 2011, e973741 (2011). 8. Cost of Basic fibroblast growth factor|Biocompare.com. Available at: http://www.biocompare.com/Protein-Biochemistry/21932-Proteins-Human-Source/?search=basic+fibroblast+growth+factor. (Accessed: 11th December 2015) 9. Kwong, K. W. Y. & Wong, W. K. R. A revolutionary approach facilitating co-expression of authentic human epidermal growth factor and basic fibroblast growth factor in both cytoplasm and culture medium of Escherichia coli. Appl Microbiol Biotechnol 1-10 (2013). doi:10.1007/s00253-013-5090-8 10. Kwong, K. W. Y., Ng, K. L., Lam, C. C., Wang, Y. Y. & Wong, W. K. R. Authentic human basic fibroblast growth factor produced by secretion in Bacillus subtilis. Appl Microbiol Biotechnol 1-9 (2012). doi:10.1007/s00253-012-4592-0 11. Kwong, K. W. Y., Ng, A. K. L. & Wong, W. K. R. Engineering versatile protein expression systems mediated by inteins in Escherichia coli. Appl Microbiol Biotechnol 1-8 (2015). doi:10.1007/s00253-015-6960-z 12. Wong, W. K. R. & Sutherland, M. L. Excretion of heterologous proteins from E. coli. (1997). U.S. Pat. No. 5,646,015. 13. Wong, D. K. H. et al. Extracellular expression of human epidermal growth factor encoded by an Escherichia coli K-12 plasmid stabilized by the ytl2-incR system of Salmonella typhimurium. Journal of Industrial Microbiology and Biotechnology 21, 31-36 (1998). 14. Huang, R. et al. Human epidermal growth factor excreted by recombinant Escherichia coli K-12 has the correct N-terminus and is fully bioactive. Process Biochemistry 35, 1-5 (1999). 15. Sivakesava, S. et al. Production of excreted human epidermal growth factor (hEGF) by an efficient recombinant Escherichia coli system. Process Biochemistry 34, 893-900 (1999). 16. Wong, W. K. R., Fu, Z., Wang, Y. Y., Ng, K. L. & Chan, A. K. N. Engineering of efficient Escherichia coli excretion systems for the production of heterologous proteins for commercial applications. Recent Patents on Chemical Engineering 5, 44-55 (2012). 17. Ng, A. K. L. et al. Enhancement of fish growth employing feed supplemented with recombinant fish growth hormone expressed in Bacillus subtilis. Research Journal of Biotechnology 11, 1-11 (2016). 18. Li, Y. Self-cleaving fusion tags for recombinant protein production. Biotechnol Lett 33, 869-881 (2011). 19. Elleuche, S. & Pggeler, S. Inteins, valuable genetic elements in molecular biology and biotechnology. Appl Microbiol Biotechnol 87, 479-489 (2010). 20. Topilina, N. I. & Mills, K. V. Recent advances in in vivo applications of intein-mediated protein splicing. Mobile DNA 5, 5 (2014). 21. Cui, C., Zhao, W., Chen, J., Wang, J. & Li, Q. Elimination of in vivo cleavage between target protein and intein in the intein-mediated protein purification systems. Protein Expression and Purification 50, 74-81 (2006). 22. Shokri, A., Sandn, A. & Larsson, G. Cell and process design for targeting of recombinant protein into the culture medium of Escherichia coli. Appl Microbiol Biotechnol 60, 654-664 (2003). 23. Tsang, M. W., Tsang, K. Y. & Wong, W. K. R. The use of recombinant human epidermal growth factor (rhEGF) in a gentleman with drug-induced Steven Johnson syndrome. Dermatol. Online J 10, 25 1-4 (2004). 24. Tsang, M.-W. et al. Human epidermal growth factor enhances healing of diabetic foot ulcers. Diabetes Care 26, 1856-61 (2003). 25. Wong, W. K. R. Effective Treatment of an unhealed incision of a diabetic patient with recombinant human epidermal growth factor. Modern Chemistry & Applications 3, 4, 1-3 (2015). 26. Fu, Z. B., Ng, K. L., Lam, T. L. & Wong, W. K. R. Cell death caused by hyper-expression of a secretory exoglucanase in Escherichia coli. Protein Expr Purif 42, 67-77 (2005). 27. Fu, Z. B. et al. A two-stage refinement approach for the enhancement of excretory production of an exoglucanase from Escherichia coli. Protein Expr Purif 48, 205-14 (2006). 28. Wang, Y. Y. et al. Efficient Bacillus subtilis promoters for graded expression of heterologous genes in Escherichia coli. Res J Biotechnol 5, 5-14 (2010). 29. Lam, T. L., Wong, R. S. C. & Wong, W. K. R. Enhancement of extracellular production of a Cellulomonas fimi exoglucanase in Escherichia coli by the reduction of promoter strength. Enzyme and Microbial Technology 20, 482-488 (1997).
LIST OF ABBREVIATIONS
(48) kDa=kilo Dalton
(49) SN=culture medium/supernatant
(50) CL=cell lysate
(51) aa=amino acid
(52) MTT=(3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide)
(53) SEM=Standard error of the mean
(54) bFGF=146 aa authentic human basic fibroblast growth factor
(55) EGF=human epidermal growth factor
(56) VMA=Saccharomyces cerevisiae vascular membrane ATPase
(57) vma=VMA coding sequence
(58) OmpA=outer membrane protein A
(59) Tables
(60) TABLE-US-00001 TABLE1 Oligosusedinthestudy SEQ Primer NO. Sequence.sup.a P1 3 5-CACTGAAACGCACTGGGCAG-TATAAACTTGGATCC AA-3 P2 4 5-ACCCTTGGCAAAGCAGCTCTTAGCAGACAT-TATAA ACTTGGATCCAAACAG-3 P3 5 5-ATGTCTGCTAAGAGCTGCTTTGCCAAGGGT-3 P4 6 5-TTTCTGCCCAGGTCCTGTTTT-GGATCCAAGTT-3 P5 7 5-ACGAGGCCCTTTCGTCTTCA-AGAATTCGCAT-3 P6 8 5-CAGAGTCACTATTCATAATTTTTTC-3 P7 9 5-GAAAAAATTATGAATAGTGACTCTG-3 P8 10 5-CAACAACACAGTTGCATGCATACTT-3 .sup.aThe samples included cell lysates and culture media of both shake flask and fermentative cultures. All four transformants: JM101[pWK3R], JM101[pWK3ROmpAd], JM101[pWK311R] and JM101[pWK311ROmpAd], were included in shake flask cultures, whereas only JM101 [pWK311ROmpAd] and JM101[pWK3R] were involved in fermentor cultivation.
(61) TABLE-US-00002 TABLE2 AnalysisofbFGF,purifiedfromthecellsamples ofE.colitransformantsharboringthefour embodimentofplasmidconstructs.sup.abyliquid chromatographytandemmassspectrometry SEQ Mr Mr NO. Peptide.sup.b,c, (Calc).sup.d (Expt).sup.e (1) 11 .sup.NH2-PALPEDGGSG.sup.|10AFPPGHFK 1779 1779 (2) 12 RLYCKNGGF.sup.|30FLR 1529 1530 (3) 13 NGGF.sup.|30FLR 809 808 (4) 14 IHPDGRV.sup.|40DGVR 1219 1220 (5) 15 EKSDPH.sup.|50IK 952 952 (6) 16 SDPHIKLQLQAEER.sup.|60 1662 1663 (7) 17 .sup.|60GVVSIKGVCA.sup.|70NR 1259 1258 (8) 18 YLAMKED.sup.|80GR 1081 1082 (9) 19 CVT.sup.|90DECFFFER 1509 1508 (10) 20 LE.sup.|100SNNYNTYR 1273 1272 (11) 21 LESNNYNTYR 1272 1273 (12) 22 .sup.|110KYTSWYVALK.sup.|120 1259 1258 (13) 23 TGQYKLGSK.sup.|130TGPGQK 1548 1548 (14) 24 AILFL.sup.|140PMSAK 1090 1089 (15) 25 .sup.|130TGPGQKAILFL.sup.|140PMSAKS 1744 1744 (16) 26 AILFL.sup.|140PMSAKS.sup.-COOH 1176 1177 .sup.bSubsequent to trypsin digestion of purified bFGF, a total of 466 peptides were identified by the Mascot search engine. .sup.cThe availability of mature bFGF sequence in the literature has facilitated the selection and alignment of sequencing results of the trypsin digested peptides (16 of them as revealed in the abouve Table) to finally obtain a full sequence of the recombinant bFGF as shown below. NH.sub.2PALPEDGGSG.sup.|10AFPPGHFKDP.sup.|20KRLYCKNGGF.sup.|30FLRIHPDGRV.sup.|40 DGVREKSDPH.sup.|50IKLQLQAEER.sup.|60GVVSIKGVCA.sup.|70NRYLAMKED.sup.|80 GRLLASKCVT.sup.|90DECFFFERLE.sup.|100SNNYNTYRSR.sup.|110KYTSWYVALK.sup.|120 RTGQYKLGSK.sup.|130TGPGQKAILFL.sup.|140PMSAKS-COOH .sup.dTheoretical mass-to-charge ratio of the peptide .sup.eThe experimental mass-to-charge ratio of the peptide
(62) TABLE-US-00003 APPENDIX SEQIDNO.1: NH.sub.2PALPEDGGSG.sup.|10AFPPGHFKDP.sup.|20KRLYCKNGGF.sup.|30FLRIHPDGR V.sup.|40DGVREKSDPH.sup.|50IKLQLQAEER.sup.|60GVVSIKGVDA.sup.|70NRYLAMKE D.sup.|80GRLLASKCVT.sup.|90DECFFFERLE.sup.|100SNNYNTYRST.sup.|110KYTSWYVA LK.sup.|120RTGQYKLGSK.sup.|130TGPGQKAILFL.sup.|140PMSAKS-COOH SEQIDNO.2 NH2-NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQY RDLKWWELR-COOH