Reduction of oxidated methionine peptides for mass spectrometry
10266866 ยท 2019-04-23
Assignee
Inventors
- Michael Sweredoski (Altadena, CA, US)
- Annie Moradian (La Canada, CA, US)
- Tanya R. Yakushi (Monterey Park, CA, US)
- Sonja Hess (Arcadia, CA, US)
- Roxana Eggleston-Rangel (Los Angeles, CA, US)
Cpc classification
C12Y108/04011
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
International classification
C12P7/00
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
Abstract
A method for preparing a methionine containing peptide or protein for analysis by mass spectrometry by incubating the methionine containing peptide or protein with a heterologous methionine sulfoxide reductase A (MsrA), a heterologous methionine sulfoxide reductase B (MsrB), or a heterologous methionine sulfoxide reductase AB (MsrAB) enzyme results in the reduction of an oxidized methionine containing peptide or protein.
Claims
1. A method for reducing a methionine containing peptide or protein for mass spectrometry analysis, comprising: obtaining a heterologous methionine sulfoxide reductase (Msr) enzyme composition comprising a heterologous Msr protein expressed and isolated from a host cell, the heterologous Msr enzyme composition comprising: a heterologous MsrA protein and a heterologous MsrB protein, a heterologous MsrAB protein from Neisseria, or a combination thereof; immobilizing the heterologous Msr enzyme composition on a surface to form an immobilized heterologous Msr enzyme composition, incubating the methionine containing peptide or protein with the immobilized heterologous Msr enzyme composition; and separating the methionine containing peptide or protein from the immobilized heterologous Msr enzyme composition after the incubating.
2. The method of claim 1, wherein immobilizing the heterologous Msr enzyme composition comprises coupling the heterologous Msr enzyme composition to resin beads or adding the heterologous Msr enzyme composition to a membrane filter.
3. The method of claim 1, wherein immobilizing the heterologous Msr enzyme comprises adding the heterologous Msr enzyme composition to a membrane filter, and incubating the the methionine containing peptide or protein comprises adding bovine serum albumin (BSA) to the membrane filter.
4. The method of claim 1, further comprising activating the heterologous Msr enzyme composition prior to incubating the methionine containing peptide or protein.
5. The method of claim 4, wherein activating the heterologous Msr enzyme composition comprises incubating the heterologous Msr enzyme composition with a reducing agent.
6. The method of claim 5, wherein the reducing agent is dithiothreitol (DTT) or thioredoxin.
7. The method of claim 1, wherein incubating the methionine containing peptide or protein to the immobilized heterologous Msr enzyme composition further comprises adding a Tris or ammonium bicarbonate buffer.
8. A method for preparing a methionine containing peptide or protein for mass spectrometry analysis, comprising: obtaining a heterologous methionine sulfoxide reductase (Msr) enzyme composition comprising a heterologous Msr protein expressed and isolated from a bacterial, yeast, or human host cell, the heterologous Msr enzyme composition comprising: a heterologous MsrA protein and a heterologous MsrB protein, a heterologous MsrAB protein from Neisseria, or a combination thereof; immobilizing the heterologous Msr enzyme composition on a resin bead or a membrane filter to form an immobilized heterologous Msr enzyme composition; activating the immobilized heterologous Msr enzyme composition to form an activated heterologous Msr enzyme composition; adding the methionine containing peptide or protein to the activated heterologous Msr enzyme composition; and separating the methionine containing peptide or protein from the activated heterologous Msr enzyme composition.
9. The method of claim 8, wherein activating the immobilized heterologous Msr enzyme composition comprises washing or incubating with dithiothreitol or thioredoxin.
10. A kit for reducing a methionine containing peptide or protein according to the method of claim 1, the kit comprising the heterologous Msr protein expressed and isolated from the host cell.
11. The kit of claim 10, wherein the heterologous Msr protein is a heterologous MsrA protein, a heterologous MsrB protein, and/or a heterologous MsrAB protein.
12. The kit of claim 10, wherein the heterologous Msr protein is a heterologous MsrAB protein.
13. The kit of claim 10, wherein the heterologous Msr protein is lyophilized on a membrane filter.
14. The kit of claim 10, further comprising a blocking agent.
15. The kit of claim 10, wherein the heterologous Msr protein is coupled to a resin bead.
16. The kit of claim 10, further comprising Tris or ammonium buffer.
17. The kit of claim 10, further comprising dithiothreitol (DTT) or thioredoxin.
18. A kit for preparing a methionine containing peptide or protein according to the method of claim 8, the kit comprising the heterologous Msr protein expressed and isolated from the host cell.
19. The kit of claim 18, wherein the heterologous Msr protein is a heterologous MsrAB protein.
20. The kit of claim 18, wherein the heterologous Msr protein is lyophilized on a membrane filter.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawings will be provided by the Office upon request and payment of the necessary fee.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION
(16) Methionine sulfoxide reductase A (MsrA) and methionine sulfoxide reductase B (MsrB) are two enzymes that stereospecifically reduce peptide-methionine (S)-sulfoxides and (R)-sulfoxides, respectively, to methionine, as shown schematically in
(17) Embodiments of the present invention include methods for preparing a methionine-containing peptide or protein for routine mass spectrometry analysis by reducing the oxidized methionine residues in a peptide or protein. Methods for reducing oxidized methionine residues in a peptide or protein include incubating the peptide or protein with a methionine sulfoxide reductase A (MsrA) enzyme, a methionine sulfoxide reductase B (MsrB) enzyme, or a methionine sulfoxide reductase AB (MsrAB) enzyme. As used herein, incubating and like terms refer to the mixing of the Msr enzyme and a methionine-containing peptide or protein to allow for molecular interaction of the Msr enzyme and the methionine-containing peptide or protein. In some embodiments, a method for reducing oxidized methionine in a peptide or protein includes incubating the peptide or protein with at least one of MsrA, MsrB, or MsrAB enzyme. In other embodiments, a method for reducing oxidized methionine in a peptide or protein includes incubating the peptide or protein with both MsrA and MsrB enzymes or an MsrAB enzyme.
(18) Methionine sulfoxide reductase (Msr) enzymes are found in biological organisms from bacteria to man, including plants, as described, for example, in Moskovitz et al, Methionine sulfoxide reductase (MsrA) is a regulator of antioxidant defense and lifespan in mammals, PNAS, 2001; 98:12920-12925; Moskovitz et al., The yeast peptide-methionine sulfoxide reductase functions as an antioxidant in vivo, PNAS, 1997; 94:9585-9589; Moskovitz et al., Escherichia coli peptide methionine sulfoxide reductase gene: regulation of expression and role in protecting against oxidative damage, J Bacteriol. 1995; 177:502-507; Douglas et al., Methionine sulfoxide reductase A (MsrA) deficiency affects the survival of Mycobacterium smegmatis within macrophages, J Bacteriol. 2004; 186:3590-3598; St John et al., Peptide methionine sulfoxide reductase from Escherichia coli and Mycobacterium tuberculosis protects bacteria against oxidative damage from reactive nitrogen intermediates, PNAS, 2001; 98:9901-9906; Ruan et al., High-quality life extension by the enzyme peptide methionine sulfoxide reductase, PNAS, 2002; 99:2748-2753; Moskovitz et al., Overexpression of peptide-methionine sulfoxide reductase in Saccharomyces cerevisiae and human T cells provides them with high resistance to oxidative stress, PNAS, 1998; 95:14071-14075; Romero et al., Investigations into the role of the plastidial peptide methionine sulfoxide reductase in response to oxidative stress in Arabidopsis, Plant Physiol, 2004; 136:3784-3794; and Yermolaieva et al., Methionine sulfoxide reductase A protects neuronal cells against brief hypoxia/reoxygenation, PNAS, 2004; 101:1159-1164, the entire contents of all of which are incorporated herein by reference. Accordingly, as methionine is found throughout all living organisms, and the structure of methionine is the same in all organisms, a heterologously expressed Msr enzyme (MsrA, MsrB, or MsrAB) from a suitable organism may be used to catalyze the reduction of oxidized methionine in peptides or proteins.
(19) In some embodiments of the present invention, an Msr enzyme is immobilized on a substrate to facilitate incubation of the enzyme with a peptide, multiple peptides, a cell lysate of peptides, a protein, or multiple proteins. As used herein, immobilized, immobilizing, and like terms with respect to the Msr enzyme refers to the addition of the Msr enzyme to a substrate from which it is not released upon washing, incubation, or elution of a methionine-containing peptide or protein. In some embodiments, an Msr enzyme is immobilized on a substrate using any suitable method. For example, an Msr enzyme may be immobilized on a resin bead. Non-limiting examples of resin beads include agarose resin beads, magnetic resin beds, and tagged resin beads (e.g., streptavidin beads). Suitable resin beads may be of various sizes ranging from 5 um to 500 um. For example, MsrA enzyme may be coupled to agarose beads and incubated with a commercially available peptide (TAGTSFMMTPYVVTR) (SEQ ID NO: 1). After incubation with the MsrA enzyme-coupled beads, the peptide (SEQ ID NO: 1) may be eluted (separated from the MsrA enzyme) with TRIS buffer and analyzed by mass spectrometry (MS). As shown in
(20) In some embodiments of the present invention, an Msr enzyme may be immobilized on a membrane filter by the addition of the Msr enzyme to a membrane filter. Membrane filters may be made of cellulose. In some embodiments, the membrane filters are incorporated into a centrifuge tube. Non-limiting examples of membrane filters include cellulose membrane filters that restrict the size of the peptides or proteins that pass through the pores of the membrane filter, thereby allowing for a separation of the peptide or protein from the Msr enzyme after incubation with the Msr enzyme. For example, membrane filters (e.g., manufactured by Amicon) having a nominal molecular weight limit (NMWL) or molecular weight cutoff (MWCO) of 3 kilodalton (kDa) or 10 kDa may be used to immobilize an Msr enzyme or enzymes. For example, the MsrAB enzyme is 58 kDa and will not pass through a 3 kDa or 10 kDa filter. As shown in
(21) In some embodiments of the present invention, a membrane filter for immobilization of an Msr enzyme has a nominal molecular weight limit (NMWL) or molecular weight cutoff (MWCO) that is less than the molecular weight of the MsrA, MsrB, or MsrAB enzyme and greater than the molecular weight of any of the methionine-containing peptides or proteins to be analyzed.
(22) In some embodiments of the present invention, a method for immobilizing an Msr enzyme on a membrane filter includes prewashing the membrane filter, loading the Msr enzyme or enzymes (MsrA, MsrB, or MsrAB) onto the filter, activating the Msr enzyme using a reducing agent (e.g., DTT), incubating the activated Msr enzyme with a peptide or protein, washing the enzyme and peptide/protein reaction, and releasing the peptide/protein from the filter. The Msr-treated peptide/protein found in the flow through is then analyzed, for example, by mass spectrometry (MS). A schematic of this Msr-immobilized work flow method is shown in
(23) In some embodiments of the present invention, the membrane filter is incubated with a blocking agent prior to incubation with a methionine-containing peptide or protein. Non-limiting examples of a blocking agent include bovine serum albumin (BSA), milk, or casein protein.
(24) In some embodiments of the present invention, the reduction of a methionine-containing peptide or protein using an Msr enzyme is carried out using a buffer compatible with the Msr enzyme, the peptide or proteins, and with the subsequent MS analysis. In some embodiments, the buffer for the Msr-enzyme reduction reaction is a Tris or ammonium bicarbonate buffer. As shown in
(25) In some embodiments of the present invention, the Msr enzyme is activated prior to incubation with a methionine-containing peptide or protein to ensure reduction of the disulfide bonds in the Msr enzyme as shown in
(26) In some embodiments of the present invention, after incubation of the peptide or protein with Msr enzyme, the peptide or protein is released (eluted) or separated from the immobilized Msr enzyme. For example, a peptide or protein after incubation with an Msr enzyme immobilized to agarose beads may be eluted using a Tris buffer. In some embodiments, a peptide or protein after incubation with an Msr enzyme immobilized on a membrane filter may be eluted using an organic solvent. Non-limiting examples of suitable organic solvents for elution include methanol or acetonitrile. Additionally, a mixture of methanol and acetonitrile may be used. In some embodiments, the elution buffer contains 1 part organic solvent (e.g., methanol, acetonitrile, or any mixture thereof) and 1 part water. Some commercially available membrane filters are not compatible with more than 20% acetonitrile.
(27) In some embodiments of the present invention, a kit for reducing methionine-containing peptides or proteins includes an Msr enzyme. The Msr enzyme may be MsrA enzyme, MsrB enzyme, and/or MsrAB enzyme. In some embodiments, the kit includes lyophilized (i.e., freeze dried) Msr enzyme. For example, the kit may include a lyophilized Msr enzyme on a membrane filter or resin bead. In addition to the Msr enzyme, the kit may include Tris or ammonium bicarbonate buffer; 10 mM to 50 mM DTT or thioredoxin for activating the Msr enzyme on the filter; and/or an elution buffer for releasing the Msr-treated peptide or protein from the filter. In some embodiments, the elution buffer is 50% methanol and 50% water or 50% acetonitrile and 50% water. In other embodiments, the elution buffer is 20% acetonitrile, 30% methanol and 50% water.
(28) The following Examples are presented for illustrative purposes only, and do not limit the scope or content of the present application.
EXAMPLES
Example 1. Reduction Experiments Using Commercially Available MsrA
(29) Initial experiments were designed with commercially available MsrA and commercially available standard peptides TAGTSFMMTPYVVTR (SEQ ID NO: 1) and GAILTTMLATR (SEQ ID NO: 2). Peptide synthesis was confirmed by liquid chromatography mass spectrometry (LC-MS). The level of oxidation of the peptides increased over the course of this study (greater than 2 years) during storage in the freezer. Accordingly, the untreated control was always analyzed with the treated (reduced) sample.
(30) To reduce the methionine in these peptides, commercially available MrsA enzyme was coupled to Affi-Gel 10 beads (Bio-Rad, Hercules, Calif.), and tested for its ability to reduce oxidized methionines in these standard peptides. An aliquot (5 pmol) was added to the activated enzyme on the beads and incubated for 1 hour. The peptides were eluted with TRIS buffer and desalted by Zip Tip (Sigma-Aldrich) prior to LC-MS analysis. As shown in
(31) Affi-Gel 10 agarose beads were buffer exchanged from 50 mM Tris, pH 7.6 to 50 mM MOPS, pH7.4. MsrA protein (0.71 nmol=20 g) was coupled to the 100 l slurry of Affi-Gel 10 and free remaining sites were blocked with 100 mM Tris. MsrA protein was reduced with 15 mM DTT in 25 mM TRIS, pH 7.4 for 15 min at 37 C. Standard peptide TAGTSFMMTPYVVTR (SEQ ID NO: 1) (10 pmol) was incubated with the MsrA-slurry for 1 hour at 37 C. Peptides were eluted with 25 mM TRIS, pH 7.4, desalted using ZIP-tips and dried down prior to LC-MS/MS analysis. Samples were analyzed on Orbitrap Classic (MsrA) and Orbitrap Elite (MsrAB) (Orbitrap Classic and Elite were obtained from ThermoFisher Scientific).
Example 2. Preparation of MsrAB and Membrane Filter Reaction Tubes
(32) To efficiently reduce both, methionine-S-sulfoxides and methionine-R-sulfoxides, an enzyme with domains for MsrA and MsrB was needed. Therefore, MsrAB from Neisseria meningitidis was expressed in E. coli and purified using nickel (Ni) affinity columns. Instead of coupling MsrAB to beads, purified MsrAB was added to a prewashed Amicon filter (Sigma-Aldrich) with a 3 and 10 kDa cutoff, respectively. Since MsrAB has a molecular weight of greater than 58 kDa, it will be retained on theses filters. The workflow that was developed in the course of this study is shown in
Example 3. Optimization Studies
(33) Previously reported k.sub.cat values for MsrA and MsrB range between 1 s-1 and 13 s-1 suggesting that a short incubation time (60 min) should be sufficient for enzymatic turnover, as described in Tarrago et al., 2012, JBC, 287:24448-24459, the entire content of which is incorporated herein. Longer incubation times did not improve the reductive efficiency of the enzyme. To determine how the methionine-reduced peptides could be best released from the enzyme, different acetonitrile and methanol concentrations were tested. Since Amicon filters are not compatible with more than 20% acetonitrile, and in fact leach contaminants in the sample, the addition of methanol/water (50:50) was found to be the best releasing buffer for reacted peptides.
(34) As shown in
(35) For optimized studies in
(36) For
(37) For
(38) For
(39) For
(40) Unspecific binding to the Amicon membrane filters may be reduced if the filters are incubated with bovine serum albumin (BSA) prior to incubation with a methionine-containing peptide or protein.
(41) Additionally, MsrAB protein was freeze dried on the membrane filter and was subsequently reactivated with buffer and DTT.
(42) Using the optimized conditions obtained from studies shown in
Example 4. Global Proteomics Studies
(43) The efficacy of methionine reduction in a global HeLa trypsin digest was analyzed. For this study, a sample was split with half of the sample treated with MsrAB enzyme and the other half with buffer alone. The intensities of the treated vs. untreated tryptic peptides were analyzed and the percentage of the ratios in the histogram are shown in
(44) Under the optimized conditions as described above, the vast majority of oxidized peptides (>75%) showed at least a four-fold decrease after a single treatment with MsrAB, while approximately 15% remained unchanged (i.e. had a change of less than 4-fold). As expected, peptides containing reduced methionines (red) and peptides not containing any methionines (green) remained largely unchanged, although some losses due to sample handling were observed for these peptides.
(45) For
(46) As shown in
(47) For
Example 5. Reduction of Methionine-Containing Proteins
(48) To test whether MsrAB could also be used in conjunction with proteins, oxidized apomyoglobin was analyzed with MsrAB. As shown in
(49) For
Example 6. Sample Preparation
(50) Standard peptides TAGTSFMMTPYVVTR (SEQ ID NO: 1) and GAILTTMLATR (SEQ ID NO: 2) were purchased from JPT (Berlin, Germany). iRT peptides were from Biognosys (Zurich, Switzerland). MrsA, apomyoglobin and HeLa digest were purchased from Thermo Fisher (San Jose, Calif.). Affi-Gel 10 was purchased from Biorad (Hercules, Calif.). Amicon filters were purchased from EMD Millipore (Billerica, Mass.).
Example 7. MrsA-Bead Preparation
(51) Affi-Gel 10 was buffer exchanged from 50 mM Tris, pH 7.6 to 50 mM MOPS, pH7.4. MsrA (0.71 nmol=20 g) was coupled to the 100 l slurry of Affi-Gel10 and free remaining sites were blocked with 100 mM Tris. MsrA was reduced with 15 mM DTT in 25 mM TRIS, pH 7.4 for 15 min at 37 C. Standard peptides SEQ ID NOs. 1-2 (10 pmol) was reacted with MsrA-slurry for 1 hr at 37 C. Peptides were eluted with 25 mM TRIS, pH 7.4, desalted using ZIP-tips and dried down prior to LC-MS/MS analysis.
Example 8. Gene Synthesis and Recombinant MrsAB Expression
(52) MsrAB DNA (SEQ ID NO: 3) from Neisseria meningitidis was subcloned to express MSRAB protein (SEQ ID NO: 4) including a C-terminal His-tag (SEQ ID NO: 5). SEQ ID NO: 3 was synthesized by GenScript, optimized for expression in E. coli, and cloned into PET-3A vectors with Nde1-BamHI Amp cloning restriction sites. MsrAB-expressing plasmids were transfected into E. coli cells and secreted MsrAB was isolated from the medium using protein Ni affinity columns.
(53) TABLE-US-00001 SEQIDNO:3:GeneName:MRSAB,Length:1599bp, VectorName:pUC57, CATATGAAACATCGTACCTTCTTCTCCCTGTGTGCTAAATTTGGCTGCCT GCTGGCCCTGGGTGCCTGTAGTCCGAAAATCGTTGACGCTGGTGCCGCAA CCGTCCCGCATACCCTGTCCACCCTGAAAACCGCAGATAACCGTCCGGCT TCAGTTTATCTGAAGAAAGATAAACCGACCCTGATTAAATTCTGGGCCTC CTGGTGCCCGCTGTGTCTGTCAGAACTGGGCCAGACGGAAAAATGGGCGC AAGATGCCAAATTTAGCTCTGCAAACCTGATCACCGTGGCTTCACCGGGC TTTCTGCACGAAAAGAAAGATGGTGACTTCCAGAAATGGTATGCAGGCCT GAATTACCCGAAACTGCCGGTGGTTACGGATAACGGCGGTACCATTGCAC AATCACTGAATATCTCGGTTTATCCGAGCTGGGCTCTGATTGGCAAAGAT GGTGACGTGCAGCGTATTGTTAAAGGTAGTATCAACGAAGCCCAAGCACT GGCTCTGATCCGCGATCCGAATGCGGACCTGGGCTCTCTGAAACATAGTT TCTACAAACCGGATACCCAGAAGAAAGATTCTAAAATCATGAACACCCGT ACGATCTATCTGGCGGGCGGTTGCTTTTGGGGTCTGGAAGCCTACTTCCA GCGCATTGATGGCGTCGTGGACGCCGTGAGTGGCTATGCCAACGGTAATA CGAAAAATCCGTCCTATGAAGATGTTTCATACCGTCATACCGGTCACGCA GAAACGGTTAAAGTCACCTATGATGCTGACAAACTGTCTCTGGATGACAT CCTGCAGTACTTTTTCCGTGTTGTCGATCCGACGTCGCTGAACAAACAGG GCAATGACACCGGTACGCAATATCGCAGCGGCGTCTATTACACCGATCCG GCAGAAAAAGCTGTGATTGCAGCTGCGCTGAAACGCGAACAGCAAAAATA TCAGCTGCCGCTGGTTGTGGAAAACGAACCGCTGAAAAATTTCTACGATG CGGAAGAATATCATCAAGACTACCTGATCAAAAACCCGAATGGTTATTGT CACATTGATATCCGTAAAGCGGACGAACCGCTGCCGGGCAAAACCAAAAC GGCCCCGCAGGGCAAAGGTTTTGATGCCGCAACCTATAAAAAACCGTCCG ACGCCGAACTGAAACGCACCCTGACGGAAGAACAGTACCAAGTGACGCAG AATTCGGCGACCGAATATGCCTTTAGCCATGAATACGATCACCTGTTCAA ACCGGGTATTTATGTTGACGTCGTGAGCGGCGAACCGCTGTTTAGTTCCG CAGATAAATACGACTCTGGCTGCGGTTGGCCGAGTTTCACGCGTCCGATC GATGCGAAATCTGTGACCGAACATGATGACTTTAGTTATAACATGCGTCG CACCGAAGTTCGCTCGCACGCTGCGGATAGCCATCTGGGCCACGTCTTTC CGGATGGTCCGCGTGACAAAGGCGGTCTGCGCTACTGTATTAATGGTGCC AGCCTGAAATTTATCCCGCTGGAACAAATGGACGCTGCCGGTTATGGCGC TCTGAAATCAAAAGTCAAACATCATCACCATCACCACTAGTAAGGATCC. SEQIDNO:4:NeisseriameningitidisserogroupA/ serotype4A(strainZ2491) MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPAS VYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGF LHEKKDGDFQKVVYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKD GDVQRIVKGSINEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTR TIYLAGGCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHA ETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDP AEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNGYC HIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQ NSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPI DAKSVTEHDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCINGA SLKFIPLEQMDAAGYGALKSKVK. SEQIDNO:5:TargetVector:pET-3a,CloningSite: NdeI-XhoI,Comment:Pleaseusethein-house commercialpET-3aprovidedbyGenScript. MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPAS VYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGF LHEKKDGDFQKVVYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKD GDVQRIVKGSINEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTR TIYLAGGCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHA ETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDP AEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNGYC HIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQ NSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPI DAKSVTEHDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCINGA SLKFIPLEQMDAAGYGALKSKVKHHHHHH.
Example 9. MsrAB Assay
(54) Amicon (Amicon Ultra 0.5 mL centrifugal filter) filters with a 10 k cutoff were washed with 3500 L mL of 50% methanol, followed by preconditioning with 3500 L of 100 mM TRIS, pH 8 or 100 mM ammonium bicarbonate, pH 8.0, respectively. An aliquot (20 L of 2.43 g/L) of MsrAB was added to the preconditioned Amicon filter and the enzyme was activated with 500 L reductant and incubated with oxidized methionine-containing peptides (5 pmol or 1 g of trypsinized HeLa lysate) at 37 C. for 30 min. Reduced peptides were washed three times with water, eluted with 350% methanol. Samples were evaporated in vacuo and re-dissolved in 0.2% formic acid and analyzed by LC-MS/MS.
Example 10. Optimization Studies
(55) GAILTTMLATR (SEQ ID NO: 2) standard peptide (5 pmol) was used for optimizing the enzymatic reaction conditions. 3 kDa vs. 10 kDa Amicon filters, ammonium bicarbonate vs. TRIS buffer, various DTT concentrations and TCEP and beta-mercaptoethanol were tested. Select samples were spiked with internal retention time (iRT) standard peptides (500 fmol).
Example 10. Optimization Studies
(56) GAILTTMLATR (SEQ ID NO: 2) standard peptide (5 pmol) was used for optimizing the enzymatic reaction conditions. 3 kDa vs. 10 kDa Amicon filters, ammonium bicarbonate vs. TRIS buffer, various DTT concentrations and TCEP and beta-mercaptoethanol were tested. Select samples were spiked with internal retention time (iRT) standard peptides (500 fmol).
(57) To test the capacity of MsrAB to reduce oxidized peptides in a complex background, 5 pmol standard peptide (SEQ ID NO: 2) and 500 fmol iRT was spiked into 1 ug of a trypsin digested HeLa lysate and evaluated by targeted QTRAP analysis.
Example 11. Lyophilization of MsrAB on Amicon Filters
(58) Amicon filters were washed as described above and 20 L of 2.43 g/L of MsrAB was added to the filter before freeze-drying. The lyophilized filters were reactivated with 500 L reducing agent (DTT or thioredoxin) and used as described above.
Example 12. Intact Proteins
(59) Oxidized apomyoglobin (60 pmol) was reacted with 20 g of DTT-activated MsrAB in 80 mM TRIS HCl pH 8.0, incubated for 1 hr at 37 C, and analyzed by LC-MS using an Agilent (Santa Clara, Calif.) MSD without separation of MsrAB and protein apomyoglobin.
Example 13. Nanoflow Liquid Chromatography Tandem Mass Spectrometry (NanoLC-MS/MS)
(60) Initial experiments were performed on a nanoflow liquid chromatography system, EASY-nLC II coupled to an Orbitrap Classic mass spectrometer, equipped with a nanoelectrospray ion source (all Thermo Fisher Scientific, Bremen, Germany). For the EASY-nLC II system, solvent A was 0.2% formic acid in 98.8% water and 1% acetonitrile, and solvent B was 0.2% formic acid in 80% acetonitrile and 19.8% water. The peptides were separated on a 16 cm analytical column (75 m ID) packed in-house with Reprosil-Pur C18AQ resin (3 m, 120 pore size, Dr. Maisch, Ammerbuch, Germany) at a flow rate of 350 nL/min. The column was heated to 40 C. The peptides were eluted using a 35 min-gradient: 0-4% Solvent B (5 min), 4-72% B (30 min), 72-100% B (30 min), and 100% B (4 min). The Orbitrap was operated to automatically switch between a full scan (m/z=400-1600) in the Orbitrap and 10 CID MS/MS scans in the linear ion trap. CID was performed with helium as collision gas at a normalized collision energy of 35% and 10 ms of activation time, essentially as described in Kalli and Hess, Proteomics, 2012, 12:21-31 and Kalli et al., J. Proteome Res., 2013, 12:3071-3086, the entire contents of both of which are incorporate herein by reference.
(61) Global HeLa digested samples were analyzed on a nanoflow liquid chromatography system, EASY-nLC 1000 coupled to an Orbitrap Elite mass spectrometer, equipped with a nanoelectrospray ion source (all Thermo Fisher Scientific, Bremen, Germany). The solvent and column were the same as described above. The peptides were eluted using a 170 min-gradient: 0-2% Solvent B (5 min), 2-30% B (155 min), 30-100% B (1 min), and 100% B (9 min). The Orbitrap Elite was operated to automatically switch between a full scan (m/z=400-1600) in the Orbitrap and 20 CID MS/MS scans in the linear ion trap. CID was performed with helium as collision gas at a normalized collision energy of 35% and 10 ms of activation time, essentially as described in Kalli and Hess, 2012, supra, and Kalli et al., 2013, supra.
Example 14. Nanoflow Liquid Chromatography Multiple Reaction Monitoring (NanoLC-MRM)
(62) Targeted experiments were performed on an Eksigent ekspert nanoLC 425 pump, ekspert nanoLC400 autosampler, ekspert cHiPLC (Eksigent, Dublin, Calif.), coupled to a NanoSpray III Source and Heated Interface on a QTRAP 6500 (AB Sciex, Framingham, Mass.). The system was controlled with Analyst software. Peptides were concentrated using a 0.5 mm long, 200 m ID cHiPLC Chrom XP C18-CL trap column (3 m particle size, 120A) and separated by a 150 mm long, 75 m ID cHiPLC Chrom XP C18-CL column (3 m particle size, 120A) at a column temperature of 40 C. and a flow rate of 300 nL/min. Solvent A was 0.2% formic acid and solvent B was 98.8% acetonitrile containing 0.2% formic acid. Linear gradients from 0 to 30% B are used within 30 min, 30-100% B in 1 min, followed by 100% B for 10 min. Mass spectra are initially recorded in positive ion mode acquiring data from the transition lists obtained from the Orbitrap to confirm correct peak identification. Optimization of declustering potentials and collision energy was done automatically in Skyline. Quantitative analyses were performed using MRM scheduling in QQQ mode.
Example 15. LC-MSD Intact Protein Analysis
(63) Intact protein samples were analyzed on an HP1100 MSD SL mass spectrometer. Solvent A was 5% acetic acid, solvent B was acetonitrile. A Zorbax 300SB-C3 column (2.1150 mm, 5 micron) was used with the following gradient: 0-5% Solvent B (5 min), 5-95% B (20 min), 95% B (10 min), and 100% B (8 min) at a flow rate of 200 L/min and a column temperature of 40 C. Electrospray voltage was set to 4000 V and after a 5 min delay, the samples were directed into the mass spectrometer, which scanned all ions in the 500-1700 m/z range.
Example 16. Data Analysis
(64) For individual peptide analysis, raw files were loaded into Skyline and areas under the extracted ion chromatograms were used to quantify the relative peptide abundance. For lysate analysis, raw files were loaded into MaxQuant and searched against the UniProt human database (91647 sequences) and a contaminant database (245 sequences). Methionine oxidation and protein N-terminal acetylation were specified as variable modifications and carboxyamidomethylation of cysteine was a fixed modification. Trypsin was specified as the digestion enzyme and up to two missed cleavages were allowed. False discovery rates were fixed to be less than 1% and were estimated by searching a reversed version of the sequence database. Precursor mass tolerance was less than 4.5 ppm after recalibration and fragment mass tolerance was 0.5 Da.
(65) While the present invention has been illustrated and described with reference to certain exemplary embodiments, those of ordinary skill in the art will understand that various modifications and changes may be made to the described embodiments without departing from the spirit and scope of the present invention, as defined in the following claims.