Method and means for diagnosing autoimmune hepatitis using autoantibody markers
12044682 ยท 2024-07-23
Assignee
Inventors
Cpc classification
A61B5/41
HUMAN NECESSITIES
G01N33/564
PHYSICS
A61K31/573
HUMAN NECESSITIES
International classification
G01N33/543
PHYSICS
A61B5/00
HUMAN NECESSITIES
G01N33/564
PHYSICS
Abstract
A method for determining or diagnosing the presence or absence, or the risk of development, or the therapy control of autoimmune hepatitis in a subject is provided. In a method, the presence or absence of antibodies against the huntingtin interacting protein 1 related protein (HIP1R) or against immunoreactive peptides derived therefrom are analyzed, the presence of said antibodies is indicative for the presence, or the risk of development or for therapy control of autoimmune hepatitis of the subject. The use of the HIP1R or an immunoreactive peptide derived therefrom in the diagnosis, the risk assessment or therapy control of hepatitis diseases by determining the presence of antibodies against said HIP1R or immunoreactive peptide derived therefrom, may be helpful for differential diagnosis of autoimmune hepatitis.
Claims
1. A method for treating autoimmune hepatitis in a human subject, comprising: detecting in a blood sample of said human autoantibodies against huntingtin interacting protein 1 related protein (HIP1R) or against immunoreactive peptides derived from HIP1R, wherein a level of said autoantibodies is increased as compared to a healthy control; and administering to the human a medication for autoimmune hepatitis.
2. The method of claim 1 wherein the treatment includes the administration of one or more HIP1R immunoreactive peptides.
3. The method of claim 1 wherein the treatment includes the administration of one or more of prednisone and azathioprine.
4. The method of claim 1, wherein the human is an adult human.
5. The method of claim 1, wherein the human is a pediatric human.
6. The method of claim 1, wherein the sample is serum or plasma.
7. The method according to claim 1, wherein said detecting step includes detecting one or more of IgG antibodies and IgA antibodies.
8. The method according to claim 1, wherein the detecting step includes performing an immunoassay.
9. The method according to claim 8 wherein the immunoassay is selected from the group consisting of an ELISA, RIA, multiplex immunoassay, immunofluorescence assay, western blot, line assay, and dot blot assay.
10. The method according to claim 8 wherein the immunoassay includes direct or indirect coupling of one reactant to a detectable marker substance.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
DETAILED DESCRIPTION OF THE PRESENT INVENTION
(5) In a first aspect, the present invention relates to a method for determining or diagnosing the presence or absence, or the risk of development or for the therapy control of autoimmune hepatitis in a subject comprising, analyzing a biological sample provided from said subject for the presence or absence of antibodies against human huntingtin interacting protein 1 related protein (HIP1R) or against immunoreactive peptides derived from HIP1R, whereby the presence of antibodies against HIP1R or against immunoreactive peptides derived from HIP1R is indicative for the presence, or the risk of development or for the therapy control of autoimmune hepatitis in said subject.
(6) That is, the present inventors recognized that subjects afflicted with autoimmune hepatitis or having risk of developing autoimmune hepatitis or for the therapy control of autoimmune hepatitis have autoantibodies against the protein huntingtin interacting protein 1 related (HIP1R).
(7) The HIP1R is expressed ubiquitously in the body. The present inventors demonstrate that HIP1R represents an entity to which autoantibodies can be found in subject afflicted with autoimmune hepatitis (either unknown AIH or diagnosed AIH). Hence, determining the presence of antibodies, in particular, human autoantibodies, against HIP1R is indicative of the presence or the risk of development, or for the therapy control of autoimmune hepatitis in a subject.
(8) Until today autoimmune hepatitis can be diagnosed by expensive and cost intensive diagnosis or exclusion of other diseases, disorders or conditions only. In contrast, it is now possible to diagnose the presence or the risk of development of autoimmune hepatitis or for the therapy control of autoimmune hepatitis in a subject with a simple test system or test kit based on the method described herein.
(9) As demonstrated in the examples, the determination of antibodies against HIP1R allows identifying individuals suffering from AIH.
(10) For example, the present invention allows to identify the therapy regimen of an individual in need thereof. That is, identifying the presence of autoantibodies against HIP1R pin points to a therapy comprising B-cell depletion or inducing tolerance in T-cells or to any other therapy in order to eliminate HIP1R specific antibodies.
(11) At present the goal of treatment is to slow or stop the immune system attack on the liver. Hence, the treatment and medications are based on lowering immune system activity. Initially, prednisone is generally used, as a second medication, azathioprine may be recommended in addition to prednisone.
(12) However, a main problem are the side effects known for prednisone, in particular, when administered over a long time. The treatment regimen of autoimmune disease however requires that the people need to continue take the prednisone for at least 18 to 24 months and may remain at for life, thus, the side effects including diabetes, osteoporosis as well as osteonecrosis, high blood pressure, glaucoma and weight gain occur with high incidence. In case of cirrhosis, a liver transplantation is required. Thus, it is important to identify and determine autoimmune hepatitis at the earliest to avoid e.g. liver transplantation in view of cirrhosis.
(13) The terms patient and subject and individual are used herein interchangeably and refers to patients, subjects or individuals of humans or other mammals and includes any individual it is desired to examine or treat using the methods of the invention. However, it will be understood that patient does not imply that symptoms are present.
(14) As used herein, the terms comprising, comprises and comprised of are synonymous with including, includes or containing, contains, and are inclusive or open ended and do not exclude additional, non-recited members, elements or method steps. It will be appreciated that the terms comprising, comprises and comprised of as well as including, includes, or containing, contains as used herein comprise the terms consisting of, consists and consist of.
(15) All references cited in the present specification are hereby incorporated by reference in their entirety. In particular, the teachings of all references herein specifically referred to are incorporated by reference.
(16) With the term providing is meant that the sample provided as an isolated sample originating from the subject.
(17) With the term obtain from is meant that a sample, such as for example serum has been isolated from or derived from a particular source of the subject. For example, the sample can be obtained from tissue or a body fluid isolated directly from the subject. For clarification, the term obtained from does not include the surgical step itself but relates to an isolated sample.
(18) As used herein, the terms a, an and the mean one or more when used in this application, including the claims. Unless defined otherwise, all technical scientific terms used herein have the same meaning as commonly understood one of the ordinary skilled in the art to which the present disclosed subject matter belongs.
(19) The terms diagnosing and diagnosis as used herein refers to method by which a skilled person can estimate an even determine whether or not a subject is suffering from a given disease, disorder or condition. The skilled artisan makes the diagnosis on the basis of one or more diagnostic indicators, namely antibodies, the amount (including presence or absence) of which is an indicator for the presence severity, or absence of the condition.
(20) Along with diagnosis, therapy control and clinical prognosis is also an area of great concern and interest. It is important to know the severity of the diseases as well as the activity of the diseases in order to design the most effective therapy. Hence, making a diagnosis or diagnosing, as used herein, may further include making a prognosis which can provide from predicting a clinical outcome, selecting an appropriate treatment, or monitoring a current treatment and potentially change in the treatment based on the measure of diagnostic antibodies, in particular, autoantibodies.
(21) The term determining or analyzing as used herein refers to assessing the presence, absence, quantity, level or amount of the respective (auto)antibodies within the subject derived sample, including qualitative or quantitative concentration levels of said substances otherwise evaluating the values or categorization for a subject clinical parameter.
(22) The term biological sample as used herein refers to a sample that may be extracted, untreated, treated, isolated or concentrated from a patient. Suitably, the biological sample is selected from any part of the patient's body, including but not limited to hair, skin, nails, tissues or body fluids, such as saliva, synovia and blood. It is preferred that the samples are from the blood of said individual, like from the sera.
(23) Throughout this specification, unless the content requires otherwise, the word comprise will be understood to apply the conclusion of a stated stable element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements.
(24) That is, in an embodiment of the present invention the biological sample is a body fluid, preferably blood, in particular, serum. The skilled person is well aware of the suitable steps to obtain suitable biological samples for analyzing the same in the absence or presence of antibodies against HIP1R.
(25) As mentioned, the inventors recognized that antibody production against HIP1R can be correlated with the presence of autoimmune hepatitis.
(26) The term presence of antibodies against HIP1R or against immunoreactive peptides derived from HIP1R include the level or amount of antibodies against HIP1R in the sample over a specific threshold whereby said threshold is e.g. representative of normal blood donors representing subjects not afflicted with autoimmune hepatitis.
(27) In an embodiment of the present invention, multiple determinations of the antibodies over time can be made to facilitate stratification, diagnosis and/or prognosis.
(28) As used herein, the term immunoreactive peptide derived from HIP1R refers to polypeptides or oligopeptides derived from the HIP1R protein. These immunoreactive fragments contain the epitope of the (auto)antibodies to be determined. For example, an immunoreactive peptide according to the present invention is a peptide derived from the human HIP1R protein of SEQ ID No. 1. In an embodiment of the present invention, the immunoreactive peptide is the peptide of SEQ ID No. 2.
(29) In some embodiments of the methods disclosed herein, detecting, determining or analyzing the presence of the (auto)antibodies in the sample can include binding the (auto)antibodies to an antigen and then detecting either the binding event or the presence of the (auto)antibody isolated from the biological sample. Suitable methods and techniques for detecting the (auto)antibodies include, but are not limited to enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), multiplex immunoassay or immunofluorescence assay, western blot, line assay or dot blot and other immunoprecipitation and immunoblotting techniques. For example, suitable arrays may be used for immunodetection.
(30) The skilled person is well aware of useful immunodetection methods allowing analyzing the same for the presence or absence of antibodies against HIP1R. For example, the biological sample obtained from the subject is contacted with an antigen, namely with the HIP1R oligo- or polypeptide or the full protein containing the (auto)antibody immunoreactive peptide with the epitope of the (auto)antibody, thus, allowing binding of the (auto)antibody to said peptide. In this connection, the term polypeptide or protein which are used interchangeably herein, refers to a polymer of amino acid having a length of at least 50 aa. The term oligopeptide refers to a polymer of amino acids having a length of from 5 to 49 aa.
(31) The method according to the present invention generally relates to contacting the chosen biological sample with the antigen under conditions effective and for a period of time sufficient to allow the formation of immune complexes formed by the (auto)antibody and the antigen. Said antigen antibody mixture can be detected by known means and methods. That is, detection of immune complex formation of antigen/(auto)antibody can be achieved through the application of numerous approaches. These methods are generally based upon the detection of a label or marker, such as any radioactive, fluorescence, biological or enzymatic tags or labels of standard use in the art. Of course, one may find additional advantageous through the use of a secondary binding ligand such as a second antibody or a biotin/avidin (streptavidin) ligand binding arrangement as it is known in the art. Typically, the method according to the present invention is a method where the detection is performed using an immunoassay, preferably with direct or indirect coupling of one reactant to a detectable marker substance.
(32) In some embodiments, the primary immune complex can be detected by a second binding ligand that has binding affinity for the antigen or the (auto)antibody present in the sample, for example reactivity to the Fc region of the (auto)antibodies or having reactivity to a region of the antigen different to the binding region of the (auto)antibody. In these cases, the second binding ligand can be linked to a detectable label or marker molecule. The second binding ligand is itself often an antibody which may thus be termed a secondary antibody. Typically, the primary immune complexes are contacted with the labelled secondary binding ligand or antibody under conditions effective and for a period of time sufficient to allow the formulation of secondary immune complexes. The secondary immune complexes are then generally washed to remove of any can bound labelled secondary antibodies or ligands, and the remaining label in the secondary immune complex is then detected.
(33) The second binding ligand, such as an antibody, having binding activity for either the antigen or (auto)antibody, may also be used to bind to the primary immune complexes. The second binding ligand may contain an enzyme capable of processing a substituted detectable to a product, and, hence amplify a signal over time. Alternatively, comparative immunodetection may be used. The skilled person is well aware of suitable methods.
(34) It is preferred that the biological sample from the subject, preferably, a human subject is selected from blood, tissue or fluid, preferably selected from hair, skin, nails, saliva, synovia, liquid and blood, in particular, serum or plasma derived from blood.
(35) The (auto)antibodies to be detected may be of the IgA and/or IgG type. In an embodiment, IgG type antibodies are detected. Although it is sufficient to detect one type of antibodies, either IgA or IgG (auto)antibodies, in an embodiment of the present invention both IgA and IgG (auto)antibodies against HIP1R are detected.
(36) In a particular preferred embodiment, the subject is a human and the autoantibodies are human autoantibodies.
(37) In an embodiment of the present invention, the method allows to identify the status of the disease, in particular, the activity of the disease in a subject afflicted with autoimmune hepatitis.
(38) That is, based on the status of the subject, the level or amount of the (auto)antibodies against HIP1R can be detected. While untreated AIH patients have a high level or amount of HIP1R (auto)antibodies, the level or amount is lower thus, demonstrating an effective treatment. Thus, determining quantitatively or semi-quantitatively the amount of (auto)antibodies against HIP1R allows to determine the treatment status and the treatment success in an individual diagnosed with AIH. Namely, it is possible to use the method for the therapy control of AIH by determining the status of the subject under treatment.
(39) Further, the present invention allows to diagnose even patients with untreated AIH and normal immunoglobulin G levels determining anti-HIP1R antibodies. In addition, anti-HIP1R concentrations are correlated generally with serological activities of untreated AIH patients.
(40) In an aspect of the present invention, the method allows to differentiate autoimmune hepatitis against other hepatitic diseases including infectious hepatitis, metabolic induce hepatitis, non-alcoholic fatty liver disease and hepatitis virus infections, in particular, hepatitis virus infection A, B, C, D, and/or E and cholestatic liver diseases, in particular primary sclerosing cholangitis and primary biliary cholangitis.
(41) In an embodiment of the present invention, the method is for use in pediatric subjects. That is, the autoimmune hepatitis can be diagnosed and detected using the method according to the present invention.
(42) That is, the method according to the present invention allows for the first time the diagnosis of the pediatric group in mammals, in particular, humans.
(43) In a further aspect, the disclosed subject matter provides test kits or diagnostic kits for use in a method according to the present invention. In particular, immunological kits for use in detecting (auto)antibodies in biological samples allow diagnosis of autoimmune hepatitis. That is, the present invention provides a test kit for use in a method according to the present invention for diagnosing or determining the presence, or the risk of a development as well as for the therapy control of autoimmune hepatitis in a subject comprising detecting agents for determining antibodies against HIP1R or against immunoreactive peptides derived from HIP1R, preferably human HIP1R, in a biological sample of a subject to be tested and instructions on how to use said test kit.
(44) In an embodiment of the test kit is an ELISA, RIA, multiplex immunoassay or immunofluorescence assay, western blot, line assay or dot blot assay.
(45) The skilled person is well aware of suitable kits in form of test kits or diagnostic kits.
(46) The kits can generally comprise one or more antigens, namely oligo- or polypeptides of HIP1R that can immune react with the (auto)antibodies. Typically, the immunodetection kits will comprise in suitable container (s), one or more antibody immunoreactive peptide antigens derived from HIP1R. Said antigens useful in the presently claimed methods and test kits may be the full HIP1R or immunoreactive peptides derived therefrom. For example, the antigen may be a polypeptide or oligopeptide derived from SEQ ID No. 1 (human HIP1R).
(47) In certain embodiments, the antigen can be provided bound to a solid support, such as for example a column matrix or a well of a microtiter plate, a membrane, beads, dips sticks or the like. The solid support may be in form of an array. Alternatively, the support can be provided as a separate element of the kit.
(48) In an embodiment of the present invention, the use of a kit allows to diagnose, assess the risk or to control therapy hepatitis diseases by determining the presence of (auto)antibodies ZHIP1R. In a further embodiment, the use of a test kit or diagnostic kit according to the present invention allows for differential diagnosis of hepatitis, in particular for differential diagnosis of autoimmune hepatitis.
(49) The test kit for use according to the present invention includes beside the antigen a detection agent for the antibodies which may be an antibody, antibody fragment etc. In addition, the kit may comprise more than one detection agents. If required, the kit further comprises substrate and further means for allowing reaction with an enzyme used as a label for the detecting agent which may be an antibody.
(50) The immunodetecting agent of the kit can include detectable labels that are associated with or linked to the given detecting agent, in particular, the detecting antibody. Detectable labels that are associated with or attached to a secondary binding ligand are also contemplated. Detectable labels include dyes, illuminescent or fluorescent molecules, biotin, radiolabels or enzymes. Typical examples for suitable labels include commonly known fluorescent molecules, like rhodamine, fluorescein, green fluorescent protein or luciferase, or alkaline phosphatase and horseradish peroxidase as examples for suitable enzymes.
(51) Optionally, the kits further comprise positive and negative controls for verifying the results obtained when using the kit. The components of the kits can be packaged either in aqueous medium or lyophilized form and, in addition, the kit comprise one or more containers allowing to conduct the detection. In addition, the test kit comprises instructions for use of the kit.
(52) Moreover, the present invention relates to the use of HIP1R or an immunoreactive peptide derived from HIP1R, in the diagnosis of the presence or absence of autoimmune hepatitis diseases in an individual, in particular in an individual supposed to be afflicted with hepatitis, by determining the presence or absence of (auto)antibodies against HIP1R. In another embodiment, the present invention relates to the use of HIP1R or an immunoreactive peptide derived from HIP1R in the therapy control of AIH in an individual afflicted with AIH by determining the presence or absence of (auto) antibodies against HIP1R. In an embodiment, the use is in vitro.
(53) In particular, the present invention refers to the use of HIP1R or an immunoreactive peptide derived from HIP1R for differential diagnosis of hepatitis, in particular, for differential diagnosis for autoimmune hepatitis or exclusion of autoimmune hepatitis. That is, it is described for the first time that a positive diagnostic is provided allowing positive assessment of autoimmune hepatitis.
(54) Moreover, the present invention relates to the use of peptides derived from HIP1R namely immunoreactive peptides including the full protein in prophylaxis and/or treatment of autoimmune hepatitis. It has been shown that use of peptides derived from the antigen of said (auto)antibodies are suitable in the treatment of said autoimmune disease. That is, the use of HIP1R including the immunoreactive peptides of said molecules allow to induce tolerance, thus, being useful in prophylaxis and therapy of autoimmune hepatitis. For example, HIP1R or an immunoreactive peptide derived from HIP1R may be used for systemic or local therapy of diseases, disorders or conditions which are associated with an immunoreaction against said compound. The administration thereof may be effected orally, parenterally or via mucosal membranes. For example, the HIP1R or an immunoreactive peptide derived therefrom may be used to either induce a tolerance of the immune system or to eliminate T-cells and B-cells reacting therewith. Thus, in an embodiment, the present invention identifies a method of prophylactic or therapeutic treatment of subjects suffering from autoimmune hepatitis including administering HIP1R or immunoreactive fragments thereof for B-cell elimination or T-cell tolerance reduction to the subject suffering therefrom. Alternatively, the reactive B-cells or T-cells may be depleted in vitro by known means, for example, by blood purification or by dialysis, using an immunoreactive peptide or the full protein of HIP1R.
(55) Further, the method according to the present invention is suitable for determining the therapy regimen. It has been recognized that after treatment of autoimmune hepatitis, the level or amount of the (auto)antibodies against HIP1R is reduced. Thus, this marker represents a suitable readout system for determining success of therapy, in particular, on the humoral immune response.
(56) Finally, the present invention provides pharmaceutical compositions containing HIP1R molecules including immunoreactive peptides for use in the prophylaxis and treatment of the autoimmune hepatitis. The pharmaceutical composition may be provided in a suitable form. The skilled person is well aware of useful forms, dosages etc.
EXAMPLES
(57) The following examples have been included to illustrate modes of the present disclosed subject matter. In light of the present disclosure and the general level of the skilled in the art, those skilled will appreciate that the following examples are intended to be exemplary only and that numerous changes, modifications and alterations can be applied without deporting from the scope of the present disclosed subject matter.
(58) The present invention allows to improve the current autoantibody test for the conformation or exclusion of AIH, namely: the method and kits according to the present invention have a better sensitivity and/or specificity to diagnose AIH compared to the routine testing for ANA, SMA, LKM, SLA. Further, the requirement for time and experience of the technician for the autoantibody tests are reduced compared to the routine approach with immunofluorescence. The antigen represents a robust target antigen for the autoantibody test for example compared to the ASGPR molecule. In addition, the test is suitable for all age groups.
(59) The target antigen can be synthesized easily as recombinant peptide/protein and represents a stable antigen. To conclude, the method and test according to the present invention are superior with respect to time sensitivity and specificity as well as suitability for different age groups compared to the long tests described so far.
Example 1
(60) In ten patients with untreated AIH and control patients with a viral hepatitis a screen for immunoglobulin autoantibodies were performed on a protein macro array. One of the autoantigens mostly recognized is a HIP1R fragment. The additional examples are continued with the HIP1R fragment of SEQ ID No. 2, namely MGQLQDQQALRHMQASLVRTPLQGILQLGQELKPKSLDVRQE:
Example 2: ELISA Test with Immunoreactive Peptide of HIP1R Fragment
(61) For performing the ELISA test, 96 well plates (Maxisorb, Nunc, Denmark) were coated with 0.01 ?g of HIP1R fragment of SEQ ID No. 2 per well in 5% bovine serum albumin solution in Tris buffer saline (TBS) overnight at 4? C. Then the plates were blocked with 300 ?m TBS in 5% bovine serum albumin (BSA) per well for 30 minutes at room temperature. The plates were incubated with 100 ?l diluted sera or plasma (1:100) and TBS for 30 minutes at room temperature. After 30 minutes of incubation, the plates were washed three times with 300 ?l TBS with 0.025% Tween? Twenty (TBST; nonionic detergent). Next 100 ?l of a secondary peroxidase-rabbit anti-human IgG labelled with horseradish peroxidase (Jackson Immunoresearch Europe Ltd, Newmarket UK) was added in a dilution of 1:10.000 in TBST. The plates were incubated for 30 minutes at room temperature and washed three times with TBST. The color reaction was performed with 3.3, 5.5 tetramethyl benzydine (biolend, San Diego, California, USA) for up to 30 minutes according to the manufacturer's instructions and the optical density (OD) were read at 450 nm in an ELISA reader. Thereby serum or plasma of five patients with a high/medium-high/medium/medium-low/low OD was used. The concentration of IgG antibodies against HIP1R in this serum was defined as 100/80/60/40/20 arbitrary units.
Example 3
(62) Serum samples of patients with biopsy proven AIH, non-AIH liver disease and healthy adult controls (blood donors and employees of the Hanover Medical School) and pediatric control without elements of a liver or autoimmune disease have been tested with the semi-quantitative ELISA described in example 2.
(63) As shown in
(64) In
(65) Pediatric patient cohort (latest retrospective data set with serum samples):
(66) TABLE-US-00001 Untreated pediatric AIH (pAIH): n = 47 Non-AIH liver disease: Autoimmune sclerosing cholangitis (ASC)/pAIH-PSC: n = 9 Primary sclerosing cholangitis (PSC): n = 19 Toxic hepatitis: n = 2 Non-alcoholic fatty liver disease (NAFLD): n = 14 Cryptogenic hepatopathy: n = 4 Alpha-1-Antitrypsin deficiency (A1AT): n = 34 Healthy control: n = 34
Adult patient cohort (combined data set from retrospective serum and prospective plasma samples):
(67) TABLE-US-00002 Untreated AIH: n = 139 Treated AIH: n = 44 AIH/PBC: n = 12 AIH/PSC: n = 1 PBC: n = 44 PSC: n = 44 Alcoholic hepatitis: n = 35 Toxic hepatitis: n = 20 NAFLD: n = 59 Hepatitis C virus infection (HCV): n = 31 Hepatitis B virus infection (HBV): n = 33 Acute liver failure (ALF): n = 4 Cryptogenic hepatopathy: n = 69 Other liver diseases: n = 11 Healthy controls: n = 46
n
(68) Regarding the healthy controls, two out of 34 children demonstrated an anti-HIP1R value above the cut of while in adults three out of 46 showed the same result. It is described in literature, see Scanlan et al, above, that five out of 74 in the adult colon cancer cohort demonstrated autoantibodies against HIP1R.
(69) In table 1 a comparison of anti-HIP1R versus local routine autoantibody diagnostics in adult and pediatric cohorts are shown.
(70) TABLE-US-00003 TABLE 1 Comparison of anti-HIP1R vs. local routine autoantibody diagnostic (immunofluorescence on rodent tissue for ANA, SMA, LKM; Elisa for SLA): 95% Sample Confidence Odds number AUC Interval (CI) Cut off ratio CI Sensitivity CI Adults Serum (retrospective anti-HIP1R 251 0.860 0.814-0.907 >52.66 Arbitrary Units 12.78 6.91-23.66 0.766 0.665-0.845 training cohort) ANA 248 0.767 0.708-0.826 ?1:80 8.15 4.39-15.16 0.819 0.723-0.888 SMA 247 0.545 0.467-0.624 ?1:80 1.53 0.91-2.58 0.473*** 0.370-0.579 LKM 244 0.522 0.450-0.594 ?1:40 not applicable 0.043*** 0.014-0.114 SLA 231 0.513 0.438-0.587 >40% binding 5.31 0.54-51.83 0.035*** 0.009-0.107 Plasma (prospective anti-HIP1R 238 0.761 0.685-0.837 >52.66 Arbitrary Units 7.23 3.52-14.88 0.711 0.555-0.832 validation cohort) ANA 231 0.762 0.686-0.837 ?1:80 7.89 3.19-19.54 0.867 0.725-0.945 SMA 228 0.716 0.626-0.806 ?1:80 3.10 1.45-6.64 0.778 0.625-0.883 LKM 226 0.524 0.429-0.620 ?1:40 4.24 0.83-21.74 0.067*** 0.017-0.193 SLA 175 0.519 0.419-0.619 >40% binding 6.19 0.55-70.00 0.045*** 0.008-0.167 Children Serum (retrospective anti-HIP1R 96 0.946 0.904-0.988 43.28 Arbitrary Units 87.86 21.30-362.44 0.938 0.818-0.984 training cohort) ANA 102 0.826 0.743-0.909 age dependent 24.60 8.12-74.50 0.745* 0.607-0.849 SMA 100 0.792 0.702-0.882 age dependent 7.57 3.02-18.96 0.648*** 0.506-0.770 SLA 85 0.542 0.419-0.665 >40% binding not applicable 0.083*** 0.027-0.209 LKM 98 0.547 0.433-0.661 ?1:40 not applicable 0.094*** 0.035-0.214 Positive Negative predictive predictive Specificity CI value CI value CI Accuracy CI 0.796 0.722-0.854 0.692 0.593-0.777 0.850 0.780-0.902 0.785 0.728-0.833 0.643** 0.561-0.717 0.583 0.494-0.667 0.853 0.773-0.910 0.710 #.sup. 0.648-0.765 # p = 0.063 0.630** 0.548-0.705 0.436*** 0.338-0.538 0.664*** 0.581-0.739 0.571*** 0.506-0.633 1.000*** 0.969-1.000 1.000 0.396-1.000 0.633*** 0.569-0.694 0.639*** 0.575-0.699 0.993*** 0.957-1.000 0.750 0.219-0.987 0.639*** 0.572-0.701 0.641*** 0.575-0.702 0.746 0.678-0.805 0.395 0.290-0.510 0.917 0.860-0.953 0.739 0.678-0.793 0.548*** 0.474-0.621 0.317 0.238-0.408 0.944 0.878-0.977 0.610** 0.544-0.673 0.470*** 0.396-0.545 .sup.0.265 # 0.194-0.350 0.896 0.813-0.946 0.530*** 0.464-0.597 # p = 0.0502 0.983*** 0.948-0.996 0.500 0.139-0.861 0.809** 0.750-0.858 0.801 0.742-0.850 0.992*** 0.952-1.000 0.667 0.125-0.982 0.756*** 0.683-0.817 0.754 0.682-0.815 0.854 0.716-0.935 0.865 0.736-0.940 0.932 0.803-0.982 0.896 0.813-0.946 0.894 0.761-0.960 0.891 0.756-0.959 0.750* 0.614-0.852 0.814 0.722-0.881 0.804 0.656-0.901 0.795 0.642-0.897 0.661* 0.521-0.778 0.720** 0.620-0.803 1.000* 0.883-1.000 1.000 0.396-1.000 0.457*** 0.347-0.571 0.482*** 0.374-0.593 1.000* 0.902-1.000 1.000 0.463-1.000 0.484*** 0.380-0.589 0.510*** 0.408-0.612 Fisher's exact test (AIH vs non-AIH) for Sensitivity, Specificity, Positive predictive value, Negative predictive value and Accuracy ((true positive + true negative)/total number): *p < 0.05; **p < 0.01; ***p < 0.001; not significant p values are not depicted; # indicate trend to significant results Conclusion: White fonts on dark grey ground indicate significant superiority of HIP1R Dark grey fonts on light grey ground indicate significant inferiority of HIP1R # indicate trend to superiority of HIP1R
(71) In addition, a correlation with disease severity has been conducted. Namely, a correlation analysis with the Spearman rank correlation coefficient (SR) with markers of AIH disease activity (Immunoglobulin G (n=172); alanine aminotransferase (ALT; n=178); aspartate aminotransferase (AST; n=178) in adult and pediatric AIH (n=94 and 47) patients before and under therapy (only adults; n=38). **p<0.01, see
(72) As demonstrated in
Although anti-HIP1R concentrations are correlated with serological activity of untreated AIH (immunoglobulin G, aminotransferases), even patients with untreated AIH and normal immunoglobulin G levels had diagnostic anti-HIP1R antibodies in approximately 70%.
(73) TABLE-US-00004 Immunglobulin G normal 1-2x elevation 2x elevation anti-HIP1R negative 31% 23% 13% anti-HIP1R positive 69% 77% 87%
This underlines that anti-HIP1R antibody status is a marker for untreated AIH independent from the commonly found polyclonal hypergammaglobulinemia.