METHOD FOR IDENTIFYING 2'O-METHYLATION MODIFICATION IN RNA MOLECULE, AND APPLICATION THEREOF

20220372543 · 2022-11-24

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided is a method for identifying whether an RNA molecule has a 2′-O-methylation modification on a nucleotide, said method comprising: (1) contacting the RNA molecule with a ribonuclease Rnase R; and (2) detecting whether the RNA molecule is degraded or detecting hydrolysis termination positions after degradation. If the RNA molecule is degraded, this indicates that the RNA molecule does not have a 2′-O-methylation modification on a 3′ terminal nucleotide, and if hydrolysis terminates at a same site on multiple random broken fragments, this indicates that the RNA molecule has a 2′-O-methylation modification on the nucleotide at the position immediately preceding the termination site. Also provided are applications of the method for screening for a disease diagnosis target and confirming whether a subject has a 2′-O-methylation modification-related disease.

    Claims

    1. A method for identifying whether an RNA molecule has a 2′-O-methylation modification on the 3′ terminal nucleotide, comprising: (1) contacting the RNA molecule with a ribonuclease Rnase R; and (2) detecting whether the RNA molecule is degraded, wherein, if the RNA molecule is degraded, this indicates that the RNA molecule does not have the 2′-O-methylation modification on the 3′ terminal nucleotide.

    2. The method of claim 1, wherein the ribonuclease Rnase R has an amino acid sequence as shown in SEQ ID NO: 3 or 4, or, compared with the amino acid sequence as shown in SEQ ID NO: 3 or 4, the ribonuclease Rnase R has one or more substitutions, deletions, additions of amino acid residue, or at least 95% sequence identity, and has exonuclease activity.

    3. The method of claim 1, wherein step (2) comprises performing the detection using gel electrophoresis or reverse transcription PCR.

    4. The method of claim 1, wherein the RNA molecule is a miRNA.

    5. A method for screening a miRNA that can be used as a disease diagnosis target, comprising: (1) obtaining the miRNA from a patient suffering from the disease and a normal person, respectively; and (2) identifying whether the miRNA has the 2′-O-methylation modification on the 3′ terminal nucleotide by the method of claim 1, wherein, the miRNA with the 2′-O-methylation modification on the 3′ terminal nucleotide in the patient while without the 2′-O-methylation modification on the 3′ terminal nucleotide in the normal person is used as the disease diagnosis target.

    6. The method of claim 5, wherein the disease is cancer.

    7. The method of claim 5, wherein step (1) comprises extracting the miRNA from the serum of the patient and the normal person.

    8. A method for identifying diseases associated with a 2′-O-methylation modification on a 3′ terminal nucleotide of a miRNA in a subject, comprising: (1) obtaining the miRNA from the subject; and (2) identifying whether the miRNA has the 2′-O-methylation modification on the 3′ terminal nucleotide by the method of claim 1, wherein, if the miRNA has the 2′-O-methylation modification on the 3′ terminal nucleotide, while the miRNA in the normal person does not have the 2′-O-methylation modification on the 3′ terminal nucleotide, it is considered that the subject has a disease associated with the 2′-O-methylation modification on the 3′ terminal nucleotide of the miRNA.

    9. The method of claim 8, wherein the disease is cancer.

    10. The method of claim 9, wherein the disease is lung adenocarcinoma.

    11. The method of claim 8, wherein step (1) comprises extracting the miRNA from the serum of the subject.

    12-13. (canceled)

    14. A kit for detecting a disease associated with a 2′-O-methylation modification on the 3′ terminal nucleotide of a miRNA in a subject, the kit comprises a ribonuclease Rnase R.

    15. The kit of claim 14, wherein the ribonuclease Rnase R has an amino acid sequence as shown in SEQ ID NO: 3 or 4, or, compared with the amino acid sequence as shown in SEQ ID NO: 3 or 4, the ribonuclease Rnase R has one or more substitutions, deletions, additions of amino acid residue, or at least 95% sequence identity, and has exonuclease activity.

    16. The kit of claim 14, wherein it further comprises the miRNA that does not have the 2′-O-methylation modification on the 3′ terminal nucleotide as a standard.

    17. A method for determining a 2′-O-methylation modification site in an RNA molecule, comprising: (1) fragmenting the RNA molecule into a plurality of small molecular RNAs; (2) degrading the small molecular RNAs with the ribonuclease Rnase R, when the small molecular RNA has the 2′-O-methylation modification site, a concentrated degradation termination site will be formed; (3) performing high-throughput sequencing on the digestion product obtained in step (2); and (4) aligning the sequencing results, and determining the nucleotide immediately preceding the concentrated digestion termination site as the 2′-O-methylation modification site.

    18. The method of claim 17, wherein the small molecular RNAs produced in step (1) is 60 to 200 nucleotides in length.

    19. The method of claim 17, wherein the ribonuclease Rnase R has an amino acid sequence as shown in SEQ ID NO: 3 or 4, or, compared with the amino acid sequence as shown in SEQ ID NO: 3 or 4, the ribonuclease Rnase R has one or more substitutions, deletions, additions of amino acid residue, or at least 95% sequence identity, and has exonuclease activity.

    20. The method of claim 17, wherein the RNA molecule is rRNA or mRNA molecule.

    Description

    DESCRIPTION OF DRAWINGS

    [0038] FIG. 1 shows a schematic diagram of the enzymatic hydrolysis reaction to identify whether a single-stranded RNA has a 3′ terminal 2′-O-methylation modification.

    [0039] FIG. 2 shows a photograph of gel electrophoresis results after different RNA substrates are treated with Rnase R enzyme.

    [0040] FIG. 3 is a schematic diagram of determining 2′-O-methylation modification sites in RNAs with a Rnase R enzyme.

    [0041] FIG. 4 shows the statistical results of the degradation termination site near the position of nucleotide 868, obtained by high-throughput sequencing after the 18s RNA is randomly interrupted and treated with a Rnase R enzyme.

    [0042] FIG. 5 shows the ratio obtained by calculation after high-throughput detection in rRNA using the method of the present invention by way of 18s rRNA as an example.

    [0043] FIG. 6 shows a photograph of gel electrophoresis results after different RNA substrates are treated with the truncated Rnase R enzyme (82-725aa).

    DETAILED DESCRIPTION OF EMBODIMENTS

    [0044] Unless otherwise stated, all technical and scientific terms as used herein have the meanings commonly understood by those of ordinary skill in the art.

    [0045] “Ribonuclease (Rnase)” refers to a nuclease that can catalyze the hydrolysis of RNA into single nucleotides or small fragments, and is mainly divided into two categories: endonuclease and exonuclease.

    [0046] Ribonuclease Rnase R has a well-known meaning in the art, and refers to a class of exoribonucleases, including many family members. The members of the RNase R family are widely distributed in species and have wide varieties. They have the highest similarity with the RNase II family, and usually are exonucleases that degrade RNA molecules from the 3′ end to the 5′ end. Previous studies have suggested that members of the RNase R family may be involved in the degradation of foreign RNA fragments or involved in the post-transcriptional modification of endogenous RNAs under specific conditions.

    [0047] In a particularly preferred embodiment, the Rnase R is an exoribonuclease isolated from Mycoplasma genitalium (may be referred to as “MgR” for short). Mycoplasma genitalium has a very small genome, and this ribonuclease Rnase R is also the only exoribonuclease that has been identified therein currently. The inventors found that the activity of this ribonuclease MgR is different from many other RNase R family members. If the 3′ terminal nucleotide of the substrate single-stranded RNA has a 2′-O-methylation modification, it will not exert the RNase hydrolytic activity; and if the 3′ terminal nucleotide of the substrate single-stranded RNA has no modification, it can degrade the substrate like many other RNase R family members (see FIG. 1). The RNA exonuclease activity of the Rnase R is not limited by the sequence and secondary structure of the RNA itself and has universal applicability, and the reaction conditions are mild and simple, and the reaction speed is also very rapid.

    [0048] The ribonuclease Rnase R herein may also include its natural mutants or homologs in other species. In addition, those skilled in the art know that some conservative changes or modifications can be made to the amino acid sequence of the enzyme, such as the substitutions, deletions, or additions of one or more amino acid residues while basically retaining the enzymatic activity, and such changes or modifications are also included in the scope of the present invention.

    [0049] For example, the inventors found that removing up to 81 amino acids from the amino terminus of ribonuclease MgR does not affect the exonuclease activity of the enzyme. Therefore, reference to the ribonuclease RNase R (or MgR) herein also includes these truncated forms of the enzyme (also referred as truncated enzymes).

    [0050] The inventors also found that, in the case of the 2′-O-methylation modification in a RNA molecule, the degradation of the RNA molecule by the ribonuclease Rnase R will terminate at the nucleotide behind the 2′-O-methylation modification site (i.e. the adjacent nucleotide in the 3′ direction) (degradation termination site). When the RNA molecules are numerous (for example, 100, 1000, or 10000 copies or more), as they are degraded by the ribonuclease Rnase R, the degradation will be found to terminate at the nucleotide next to the 2′-O-methylation modification site in a significant amount of fragments. Therefore, this site is also referred to herein as the “concentrated degradation termination site”. If the RNA molecule has multiple 2′-O-methylation modifications, the RNA molecule can firstly be fragmented into, for example, 60 to 200 nucleotide fragments, and then degraded by the ribonuclease Rnase R. Accordingly, multiple concentrated degradation termination sites are generated.

    [0051] “MiRNA (microRNA)” refers to a small non-coding RNA, usually a single-stranded RNA molecule of about 20 to 25 nucleotides. The precursor pre-miRNA (hairpin-like) is transcribed in the nucleus and then cleaved by Dicer enzyme in the cytoplasm to form miRNA. It can form a complex with RISC (RNA-induced silencing complex), and then bind to target mRNA through base pairing to prevent the translation of mRNA, thereby participating in the regulation of gene expression. Studies have shown that the 3′ terminal 2′-O-methylation modification of miRNA is related to the occurrence and development of diseases such as tumors, etc.

    [0052] When referring to a disease, a “subject” as used herein refers to an individual (preferably a human) suffering from or suspected of suffering from a certain disease, and the individual may also be a healthy individual. This term can often be used interchangeably with “patient”, “test subject”, and “treatment subject”, etc.

    [0053] Hereinafter, the present invention will be further described in detail through specific embodiments. It should be understood that the specific embodiments are only used to explain the present invention and are not used to limit the protection scope of the present invention. The instruments, equipments, reagents, and methods, etc., used in the examples are all commonly used instruments, equipments, reagents, and methods in the art unless otherwise specified.

    Example 1 Expression and Purification of Recombinant Protein

    [0054] Invitrogen was commissioned to synthesize the Rnase R gene sequence and the truncated gene sequence (SEQ ID NO: 1 and 2) with the first 81 amino acids removed, and the Nco I endonuclease site was introduced at the 5′ end of the gene fragments and the Hind III endonuclease site was introduced at the 3′ end of the gene fragments. The synthesized gene fragments and pET28a(+) vector were double digested with Nco I and Hind III, and the gene fragments and vector fragments were ligated with T4 DNA ligase, and DH5a competent cells were routinely transformed (Tiangen Biotech (Beijing) Co., Ltd.). Positive clones were screened based on kanamycin resistance and plasmids were extracted. The recombinant plasmids were identified by double digestion with Nco I and Hind III and agarose gel electrophoresis. Invitrogen was commissioned to sequence the recombinant plasmids, and the sequencing results were analyzed using BioEdit software. The results were the same as the designed sequences, indicating the successful construction of recombinant bacteria.

    [0055] The obtained positive clone plasmids were transformed into E. coli BL21 (DE3) competent cells (Tiangen Biotech (Beijing) Co., Ltd.), and cultured overnight at 37° C. in LB medium containing 100 μg/mL kanamycin, then transferred to 1 L of the same LB medium and cultured at 37° C. until OD=about 0.6. The medium was then cooled to 4° C., and 0.5 mM IPTG was added to induce expression for about 16 hours. The cells were collected through 4000 g centrifugation and resuspended in lysis buffer (50 mM Tris pH=7.0, 1M NaCl, 20% glycerol, 10 mM TCEP). The cells were lysed by an ultrasonic method (6 W output for 8 minutes, 20 seconds on and 20 seconds off), and the supernatant was separated by 25000 g centrifugation. The supernatant was placed together with Nickel resin (ThermoFisher) at 4° C. for 1 hour, and then passed through a gravity column and washed with 40 mL of lysis buffer solution. The recombinant protein was eluted with a lysis buffer solution containing 200 mM imidazole, diluted to 0.1 M NaCl and concentrated to 2 mg/ml with a centrifuge tube. The quality and concentration of the recombinant protein were determined by SDS-PAGE.

    [0056] The sequences of the recombinant proteins are as shown in SEQ ID NO: 3 and 4, respectively (with 6his tag not shown). Unless otherwise specified, the following examples are all performed using the full-length Rnase R enzyme with a 6his tag.

    TABLE-US-00001 Synthetic coding nucleic acid sequence of the ribonuclease Rnase R with a 6his purification tag SEQ ID NO: 1 CACCATCACCATCACCATATGAAAGTTCTGACCGA GCTGCAGAAGCAAATCTTCACCATTGTGAAGAAAG AAAACGGCAAGCCGATCCCGCCGGGTATTGTGGTT CGTATGATGGAGAACAGCCCGAACTTTCCGGGCAA ACACCTGATCTACCGTGCGATTGACGATCTGCTGG ACTGGGCGATCCTGCGTAAGGCGGGTGGCGTTACC AACCAACTGCTGGTGAACTATGAGCCGGCGGAACC GCTGCTGGATAAGAAACTGCAGGGTATTCTGACCC TGGGCAACAAAAACAGCGGTTTCATCCGTAGCCTG GACGATGACAAGACCGTTTACTATGTGCACTACAG CAACCTGACCGGTGCGCTGGATGGCGACCTGGTGG AGTTTTGCAAACTGGACAAGCCGCAATTCGGCGAT AAATTTGACGCGGCGGTTATCACCATTCTGAAGCG TGCGCGTATTCTGTATGCGGGTAACTTCCTGGTTG ACCAGAACGAGTTTGCGCTGGAATACAAGATCGTG GCGGATAACCCGCGTTTCTATCTGACCATGATTGT TAACCCGGACAGCATCCCGAACAACCTGGCGAGCA ACACCAAAATCGCGTTTCAAATTGACGAATACGAT CCGGACAACAACCTGTGCAAAGTTAGCGTGCAGCA AGTGCTGGGTAACAACGATGACCCGCTGATCAACA TTAAAGCGATTATGCTGGACAACAGCATCGTTTTC GAGACCAACGATGTGGTTGAACAGCACGCGAACAA ACTGAGCTTTGATACCGAGGAACAACACAAGGCGT ACCGTCAGGATCTGACCGACCTGGCGTTCGTTACC GTGGACCCGACCACCAGCAAAGATCTGGATGACGC GATTTATGTGAAGACCATCCCGACCGGCTTTGTTC TGTACGTGGCGATCGCGGACGTTGCGCACTATGTG AACCGTAACAGCGAGATCGATATTGAAGCGAAACA CAAGACCAGCAGCATCTACCTGCCGGGTCACTATG TGGTTCCGATGCTGCCGGAGCAACTGAGCAACCAG CTGTGCAGCCTGAACCCGGCGCAAAAACGTTACGT GGTTGTGTGCGAAATTAGCTTCGACAACCAGGGCC GTATCAAAACCAACAAGCTGTACCCGGCGACCATC ATTAGCAAGAACCGTTTTAGCTATGATCAAGTGAA CAAATGGCTGAACAACAAGAGCGAGCTGAACTGCG ACGAAACCGTTATTAACAGCCTGAAAGCGGCGTTC ACCCTGAGCGATCTGATCCAGGCGCAACGTCAGAA ACGTGGTACCATTGACCTGAGCCACAAGGAGACCG AAATCGTTGTGGATGAGCACTACTTCCCGATCAAA ATTAACTTTCTGGTGCACGACAAGGCGGAGACCAT GATTGAAAACCTGATGGTTGTGGCGAACGAAACCG TTGCGTGGGTGCTGACCAACAACAAGATCGCGCTG CCGTATCGTGTTCACCCGCGTCCGAGCAAGAAAAA GCTGCAGAGCCTGATTGAGACCGTGGGTGAACTGA ACATCACCAAACCGCAATTCAACCTGGACACCGTT ACCAGCAGCCAGATCGCGAGCTGGCTGAACGAGAA CAAAGATAACCCGAGCTACGAAATCTTTGTGATTC TGCTGCTGCGTACCCTGGGCAAGGCGTTCTATAGC GTTAACCCGCTGATGCACTTTAGCATCGGTAGCAA CCACTACACCCACTTCACCAGCCCGATCCGTCGTT ATATTGACCTGACCATCCACCGTCTGCTGTGGATG CACCTGTTCACCCCGGATCAATTTACCGACAACGA GCGTGATCAACTGAAACAGGAGCTGGAAAAGATTG CGGACACCGTTAACGATACCGAGATCAAGATCATT AACTGCGAACGTAACGCGAACGATTACCTGACCAC CCTGCTGCTGAGCAAACAGATTGGCAAGACCTTCA GCGGTTTTATCAGCGCGATTACCAGCTTCGGCATC TTTATGCGTATGGACGAAAACAACTTCGATGGTCT GATCAAAATTACCACCATTCCGGATGACTTCTTTA TCTTCGAGAAGGAAAAGATGGTTCTGAAAGGCCGT AAGACCAACAAAGTGTATAAGATCGGTGACCGTCT GGAGGCGAAACTGAGCGAAATCGATTTCATTCAGA AGCGTGCGATTCTGACCCTGATCTAA Synthetic coding nucleic acid sequence of the ribonuclease Rnase R with the first 81 amino acids truncated, with a 6his purification tag SEQ ID NO: 2 CACCATCACCATCACCATCTGCAGGGTATTCTGAC CCTGGGCAACAAAAACAGCGGTTTCATCCGTAGCC TGGACGATGACAAGACCGTTTACTATGTGCACTAC AGCAACCTGACCGGTGCGCTGGATGGCGACCTGGT GGAGTTTTGCAAACTGGACAAGCCGCAATTCGGCG ATAAATTTGACGCGGCGGTTATCACCATTCTGAAG CGTGCGCGTATTCTGTATGCGGGTAACTTCCTGGT TGACCAGAACGAGTTTGCGCTGGAATACAAGATCG TGGCGGATAACCCGCGTTTCTATCTGACCATGATT GTTAACCCGGACAGCATCCCGAACAACCTGGCGAG CAACACCAAAATCGCGTTTCAAATTGACGAATACG ATCCGGACAACAACCTGTGCAAAGTTAGCGTGCAG CAAGTGCTGGGTAACAACGATGACCCGCTGATCAA CATTAAAGCGATTATGCTGGACAACAGCATCGTTT TCGAGACCAACGATGTGGTTGAACAGCACGCGAAC AAACTGAGCTTTGATACCGAGGAACAACACAAGGC GTACCGTCAGGATCTGACCGACCTGGCGTTCGTTA CCGTGGACCCGACCACCAGCAAAGATCTGGATGAC GCGATTTATGTGAAGACCATCCCGACCGGCTTTGT TCTGTACGTGGCGATCGCGGACGTTGCGCACTATG TGAACCGTAACAGCGAGATCGATATTGAAGCGAAA CACAAGACCAGCAGCATCTACCTGCCGGGTCACTA TGTGGTTCCGATGCTGCCGGAGCAACTGAGCAACC AGCTGTGCAGCCTGAACCCGGCGCAAAAACGTTAC GTGGTTGTGTGCGAAATTAGCTTCGACAACCAGGG CCGTATCAAAACCAACAAGCTGTACCCGGCGACCA TCATTAGCAAGAACCGTTTTAGCTATGATCAAGTG AACAAATGGCTGAACAACAAGAGCGAGCTGAACTG CGACGAAACCGTTATTAACAGCCTGAAAGCGGCGT TCACCCTGAGCGATCTGATCCAGGCGCAACGTCAG AAACGTGGTACCATTGACCTGAGCCACAAGGAGAC CGAAATCGTTGTGGATGAGCACTACTTCCCGATCA AAATTAACTTTCTGGTGCACGACAAGGCGGAGACC ATGATTGAAAACCTGATGGTTGTGGCGAACGAAAC CGTTGCGTGGGTGCTGACCAACAACAAGATCGCGC TGCCGTATCGTGTTCACCCGCGTCCGAGCAAGAAA AAGCTGCAGAGCCTGATTGAGACCGTGGGTGAACT GAACATCACCAAACCGCAATTCAACCTGGACACCG TTACCAGCAGCCAGATCGCGAGCTGGCTGAACGAG AACAAAGATAACCCGAGCTACGAAATCTTTGTGAT TCTGCTGCTGCGTACCCTGGGCAAGGCGTTCTATA GCGTTAACCCGCTGATGCACTTTAGCATCGGTAGC AACCACTACACCCACTTCACCAGCCCGATCCGTCG TTATATTGACCTGACCATCCACCGTCTGCTGTGGA TGCACCTGTTCACCCCGGATCAATTTACCGACAAC GAGCGTGATCAACTGAAACAGGAGCTGGAAAAGAT TGCGGACACCGTTAACGATACCGAGATCAAGATCA TTAACTGCGAACGTAACGCGAACGATTACCTGACC ACCCTGCTGCTGAGCAAACAGATTGGCAAGACCTT CAGCGGTTTTATCAGCGCGATTACCAGCTTCGGCA TCTTTATGCGTATGGACGAAAACAACTTCGATGGT CTGATCAAAATTACCACCATTCCGGATGACTTCTT TATCTTCGAGAAGGAAAAGATGGTTCTGAAAGGCC GTAAGACCAACAAAGTGTATAAGATCGGTGACCGT CTGGAGGCGAAACTGAGCGAAATCGATTTCATTCA GAAGCGTGCGATTCTGACCCTGATCTAA Amino acid sequence of ribonuclease Rnase R from Mycoplasma genitalium SEQ ID NO: 3 MKVLTELQKQIFTIVKKENGKPIPPGIVVRMMENS PNFPGKHLIYRAIDDLLDWAILRKAGGVTNQLLVN YEPAEPLLDKKLQGILTLGNKNSGFIRSLDDDKTV YYVHYSNLTGALDGDLVEFCKLDKPQFGDKFDAAV ITILKRARILYAGNFLVDQNEFALEYKIVADNPRF YLTMIVNPDSIPNNLASNTKIAFQIDEYDPDNNLC KVSVQQVLGNNDDPLINIKAIMLDNSIVFETNDVV EQHANKLSFDTEEQHKAYRQDLTDLAFVTVDPTTS KDLDDAIYVKTIPTGFVLYVAIADVAHYVNRNSEI DIEAKHKTSSIYLPGHYVVPMLPEQLSNQLCSLNP AQKRYVVVCEISFDNQGRIKTNKLYPATIISKNRF SYDQVNKWLNNKSELNCDETVINSLKAAFTLSDLI QAQRQKRGTIDLSHKETEIVVDEHYFPIKINFLVH DKAETMIENLMVVANETVAWVLTNNKIALPYRVHP RPSKKKLQSLIETVGELNITKPQFNLDTVTSSQIA SWLNENKDNPSYEIFVILLLRTLGKAFYSVNPLMH FSIGSNHYTHFTSPIRRYIDLTIHRLLWMHLFTPD QFTDNERDQLKQELEKIADTVNDTEIKIINCERNA NDYLTTLLLSKQIGKTFSGFISAITSFGIFMRMDE NNFDGLIKITTIPDDFFIFEKEKMVLKGRKTNKVY KIGDRLEAKLSEIDFIQKRAILTLI Amino acid sequence of ribonuclease Rnase R from Mycoplasma genitalium, with the first 81 amino acids truncated SEQ ID NO: 4 LQGILTLGNKNSGFIRSLDDDKTVYYVHYSNLTGA LDGDLVEFCKLDKPQFGDKFDAAVITILKRARILY AGNFLVDQNEFALEYKIVADNPRFYLTMIVNPDSI PNNLASNTKIAFQIDEYDPDNNLCKVSVQQVLGNN DDPLINIKAIMLDNSIVFETNDVVEQHANKLSFDT EEQHKAYRQDLTDLAFVTVDPTTSKDLDDAIYVKT IPTGFVLYVAIADVAHYVNRNSEIDIEAKHKTSSI YLPGHYVVPMLPEQLSNQLCSLNPAQKRYVVVCEI SFDNQGRIKTNKLYPATIISKNRFSYDQVNKWLNN KSELNCDETVINSLKAAFTLSDLIQAQRQKRGTID LSHKETEIVVDEHYFPIKINFLVHDKAETMIENLM VVANETVAWVLTNNKIALPYRVHPRPSKKKLQSLI ETVGELNITKPQFNLDTVTSSQIASWLNENKDNPS YEIFVILLLRTLGKAFYSVNPLMHFSIGSNHYTHF TSPIRRYIDLTIHRLLWMHLFTPDQFTDNERDQLK QELEKIADTVNDTEIKIINCERNANDYLTTLLLSK QIGKTFSGFISAITSFGIFMRMDENNFDGLIKITT IPDDFFIFEKEKMVLKGRKTNKVYKIGDRLEAKLS EIDFIQKRAILTLI

    Example 2 Preparation of Small Molecular RNA Substrates

    [0057] Invitrogen was commissioned to synthesize single-stranded small RNAs with the same sequences (miR-21) (SEQ ID NO: 5): one without any additional modification (miR-21), one with 3′ terminal 2′-O-methylation modification (miR-21-ch3). They were diluted to 100 nmol and store at −20° C. protected from light.

    TABLE-US-00002 Synthetic single-stranded small RNAs SEQ ID NO: 5 UAGCUUAUCAGACUGAUGUUGA

    Example 3 Rnase R Enzyme Degradation Reaction and Electrophoresis Detection

    [0058] 10 μg, 5 μg, or 2.5 μg of the recombinant fusion proteins obtained in Example 1 were mixed with 7 μL of the diluted RNA substrate obtained in Example 2, an appropriate amount of buffer solution and water were added to a final volume of 10 μL (20 mM Tris pH 8.5, 100 mM KCl, 0.01 mM ZnCl.sub.2), reacted at 37° C. for 1 hour, and then treated at 85° C. for 5 minutes to inactivate the enzyme. Afterwards, the product was separated on 10% TBE-urea gel.

    [0059] The results are shown in FIG. 2. In the control group using enzyme buffer, the RNA substrates were clearly displayed on the gel regardless of whether the 3′ end was modified or not. After reacting with three different concentrations of Rnase R enzymes, the RNA substrates with 3′ terminal 2′-O-methylation modification were also clearly displayed on the gel. After reacting with three different concentrations of Rnase R enzymes, the RNA substrates without 3′ terminal modification were completely degraded.

    Example 4 Rnase R Enzyme Reaction and qRT-PCR Identification

    [0060] Similar to the steps of the enzymatic reaction in Example 3, 10 μg, 5 μg, or 2.5 μg of the recombinant fusion proteins obtained in Example 1 were mixed with 7 μL of the 100-fold dilution (1 nmol) of the RNA substrate obtained in Example 2, an appropriate amount of buffer solution and water were added to a final volume of 10 μL (20 mM Tris pH 8.5, 100 mM KCl, 0.01 mM ZnCl.sub.2), reacted at 37° C. for 1 hour, and then treated at 85° C. for 5 minutes to inactivate the enzyme.

    [0061] The qRT-PCR TaqMan probe kit for miR-21 sequence was ordered from ThermoFisher, and the reverse transcription and PCR procedure were completed according to the kit's operation manual. As can be seen from the results in Table 1, after the Rnase R enzyme treatment, the CT values of the amplification of RNA substrates (miR-21) without 3′ terminal 2′-O-methylation modification were all about 27 at three different enzyme concentrations, while the reaction CT value of the control group using Rnase R enzyme buffer solution instead of the enzyme was about 18, with a very obvious difference between the two groups; and after the Rnase R enzyme treatment, the CT values of the amplification of RNA substrates (miR-21-ch3) with 3′ terminal 2′-O-methylation modification were all about 19 at three different enzyme concentrations, while the reaction CT value of the control group using Rnase R enzyme buffer solution instead of enzyme was also about 19, with no obvious difference between the two groups. It can be seen that Rnase R enzyme can selectively hydrolyze the RNA without 3′ terminal 2′-O-methylation modification, but does not hydrolyze the RNA with 3′ terminal 2′-O-methylation modification. Using qRT-PCR, it is possible to identify whether the target RNA has a 3′ terminal 2′-O-methylation modification at nanomole level, at a concentration of 100 times lower than that of gel electrophoresis.

    TABLE-US-00003 TABLE 1 The qRT-PCR results after the substrate RNAs were treated with Rnase R enzyme Rnase R CT value miR-21 10 μg 27.67 5 μg 27.49 2.5 μg 26.56 Buffer control 18.03 miR-21-ch3 10 μg 20.03 5 μg 18.84 2.5 μg 18.77 Buffer control 18.36

    Example 5 Application of 3′ Terminal 2′-O-Methylation Modification of miRNA in the Diagnosis of Lung Cancer

    [0062] 5 mL of blood from each of 4 patients with stage I lung adenocarcinoma and 4 normal persons were collected, mixed into 20 mL blood samples of lung cancer group and normal person group separately, and sodium citrate was added for anticoagulation. It was centrifuged at 150 g for 20 minutes at room temperature, the supernatant was aspirated; which was continued to be centrifuged at 10,000 g at room temperature for 20 minutes, and about 10 mL of supernatant plasma was aspirated. 20 mL of Trizol was added to 10 mL plasma and shaken well. 4 mL of chloroform was further added and shaken well. It was centrifuged at 16000 g for 20 minutes at room temperature. After centrifugation, it could be seen that the solution was divided into three layers: the lower layer was organic solvent, the middle layer was protein, and the upper layer was water-soluble materials. The upper layer of the water-soluble material was transferred to a new centrifuge tube, an equal volume of isopropanol was added, and mixed well, afterwards it was kept still overnight at −20° C. On the next day, it was centrifuged at 16000 g at 4° C. for 20 minutes, and the supernatant was removed after the centrifugation. 1 mL of 75% ethanol was added to wash precipitates at the bottom and wall of the tube, which was then transferred to a new 1.5 mL centrifuge tube. It was centrifuged at 16000 g at 4° C. for 20 minutes, and the supernatant was removed after the centrifugation. The RNA precipitate was dissolved with 40 μL of DEPC-treated water and it was kept still for 10 minutes.

    [0063] After measuring the total amount of RNA, 10 times the amount of Rnase R enzyme obtained in Example 1 (the buffer solution of the enzyme itself was 50 mM Tris-HCl, pH 8.0, 250 mM NaCl, 0.5 mM TCEP), 5 μL 10×Rnase R buffer (200 mM Tris-Cl (pH 8.5), 1000 mM KCl, 0.1 mM ZnCl.sub.2) was added, and the final volume was brought up to 50 mL with DEPC-treated water. The reaction was carried out at 37° C. for 30 minutes, and then treated at 85° C. for 10 minutes to inactivate the Rnase R enzyme.

    [0064] 1 mL of Trizol was added and shaken well. 200 μL of chloroform was added and shaken well. It was centrifuged at 16000 g for 20 minutes at room temperature. After centrifugation, it can be seen that the solution was divided into three layers: the lower layer was organic solvent, the middle layer was protein, and the upper layer was water-soluble materials. The upper layer of the water-soluble material was transferred to a new centrifuge tube, an equal volume of isopropanol was added, and mixed well, afterwards it was kept still for 1 hour at −20° C. Subsequently, it was centrifuged at 16000 g at 4° C. for 20 minutes, and the supernatant was removed after centrifugation. 1 mL of 75% ethanol was added to wash precipitates at the bottom and wall of the tube, which was then transferred to a new 1.5 mL centrifuge tube. It was centrifuged at 16000 g at 4° C. for 20 minutes, and the supernatant was removed after centrifugation. The RNA precipitate was dissolved with 25 μL of DEPC-treated water and it was kept still for 10 minutes. This sample can be used directly for sequencing.

    [0065] The samples of lung adenocarcinoma and normal persons were sent to BGI for miRNA low-density chip sequencing (Applied Biosystems). The chip will detect 384 of the more common and less common miRNAs in the samples, totaling 768. The principle is equivalent to performing 768 sets of qRT-PCR at the same time. The analysis of the results was similar to that of general qRT-PCR. The smaller the CT value, the higher the content, and a CT value greater than or equal to 30 could be considered as basically non-existent. Therefore, we were interested in miRNAs with a CT value less than 30 as much as possible in samples of lung adenocarcinoma and with a CT value greater than or equal to 30 in normal persons, that is, the miRNAs with 3′ terminal 2′-O-methylation modification in blood samples of patients having lung adenocarcinoma and without the same modification in normal persons. Some of the results were shown in Table 2 below.

    TABLE-US-00004 TABLE 2 Low-density chip sequencing results of miRNAs in lung adenocarcinoma and normal persons after Rnase R enzyme treatment (partial) CT value in CT value in Lung miRNA Normal Persons Adenocarcinoma hsa-miR-93-4373302 40 24.99 hsa-miR-106a-4395280 30.69 25.65 hsa-miR-17-4395419 32.48 25.80 hsa-miR-185-4395382 40 25.94 hsa-miR-122-4395356 32.28 26.33 hsa-miR-411-4381013 40 26.87 hsa-miR-451-4373360 40 26.93 hsa-miR-423-5p-4395451 40 27.07 hsa-miR-486-5p-4378096 40 27.67 hsa-miR-28-3p-4395557 30.49 27.92 hsa-miR-1228#-002763 40 27.18 hsa-miR-25#-002442 40 28.07 hsa-miR-338-5P-002658 31.13 28.39 hsa-miR-151-3p-002254 30.23 28.48 hsa-miR-432-001026 40 28.54

    [0066] As shown in Table 2, these miRNAs all showed 3′ terminal 2′-O-methylation modification (CT<30) in blood samples of patients having lung adenocarcinoma, while they were completely hydrolyzed by Rnase R enzyme in blood samples of normal persons (CT>30). The 3′ terminal 2′-O-methylation modification of these miRNAs could all become potential diagnosis targets for lung adenocarcinoma.

    Example 6 Application of Rnase R Enzyme Treatment in Identifying 2′-O-Methylation Sites in 18s rRNA

    [0067] Principle: The overall procedure was as shown in FIG. 3, which was roughly divided into several processes: RNA acquisition, RNA fragmentation, Rnase R enzyme treatment, fragment tailing and high-throughput sequencing, sequencing result comparison, and modification site recovery. Specifically, the RNAs to be tested can be fragmented into fragments with a length of about 60 to 200 nt, and then the product can be processed with the exonuclease Rnase R. The inventors found that RNA fragments without 2′-O-methylation modifications will be degraded, while sites with 2′-O-methylation modifications (Nm) will be recognized by the Rnase R enzyme, and the degradation terminates at Nm+1 site. Subsequently, the degraded RNA samples were purified and a library was prepared and sequenced. Since the Rnase R enzyme generates a concentrated degradation termination site at the nucleotide downstream of each 2′-O-methylation modification site (Nm+1 site), the 2′-O-methylation sites can be identified by comparing the sequencing sequence with the genome.

    [0068] Operation: Total RNA purification kit (Qiagen) was used to extract total RNA from Hela cell line. 100 μL of DEPC-treated water was used to dissolve the total RNA obtained. 1% agarose gel was made, and 1×TAE electrophoresis buffer was formulated with DEPC-treated water. The obtained total RNA was subjected to electrophoresis detection, the 18S rRNA band was cut, and recovered with the RNA agarose recovery kit (zymo research). RNAs were dissolved with 100 μL of DEPC-treated water to obtain 50 μL of 18S RNAs. It was determined that A260:280=1.99, suggesting a relatively pure 18S product. A portion of the sample can be used for 1% agarose gel electrophoresis to test the integrity of 18S.

    [0069] 1.5 μg of the 18S rRNA (45 μL) obtained in the previous step was mixed well with 45 μL of 100 mM Na.sub.2CO.sub.3 (pH 9.0), and treated in a water bath at 95° C. for 10 min. Then 10 μL 3 mol/L Na-oAC (pH 5.2) was added to terminate the reaction. 24 μL of 5 glycogen was added to the system and mixed well. 372 μL of 96% ethanol was added to the system, mixed well, and placed in liquid nitrogen. It was centrifuged for 20 minutes at a condition of 12000 g and 4° C. The supernatant was discarded from the obtained centrifugal product, and 1 mL of 80% ethanol was added to wash the precipitated RNA, and centrifuged again at a condition of 12000 g and 4° C. for 20 minutes. The supernatant of the obtained centrifugal product was discarded, the residual ethanol was completely volatilized in an ultra-clean workbench, and 25 μL of DEPC-treated water was added to dissolve the remaining RNAs.

    [0070] 100 μg of the Rnase R enzyme obtained in Example 1 was added to 25 μL of the fragmented 18s rRNAs obtained in the previous step (the buffer solution of the enzyme itself was 50 mM Tris-HCl, pH 8.0, 250 mM NaCl, 0.5 mM TCEP), 6.1 μL 10×Rnase R buffer (200 mM Tris-Cl (pH 8.5), 1000 mM KCl, 0.1 mM ZnCl.sub.2). The reaction was carried out at 37° C. for 30 minutes, and then treated at 85° C. for 10 minutes to inactivate the Rnase R enzyme. The total RNA purification kit (Qiagen) was used again to purify the RNA fragments after the reaction.

    [0071] The tailing/reverse transcription kit (Sangon Biotech) was used to generate a cDNA library from 0.1 μg of the treated product, and the high-throughput sequencing was used to obtain the sequence information of the fragments. By comparing the sequence information of the fragments obtained by high-throughput sequencing with the 18s rRNAs, it could be found that most of the fragments terminated in certain positions (FIG. 4), and 2′-O-methylation occurs on the nucleotide at the position immediately preceding these positions. In FIG. 4, the abscissa represents a nucleotide site, and the ordinate represents a relative content of the fragments whose 3′ end is located at the corresponding amino acid sites. For example, the statistics of the termination point near the nucleotide at the 850th position showed that about 70% of the fragments terminated on nucleotide at the 868th position, indicating that most of the 18s RNA molecules had a 2′-O-methylation modification on nucleotide at the 867th position. The other fragment termination sites 894, 915, 941, and 988 might be products of incomplete enzymatic hydrolysis after random interruption or a small amount of products after hydrolysis of 2′-O-methylation sites with low ratio of modifications.

    [0072] The method of this example can be used to identify all 2′-O-methylation sites on single-stranded RNA, and these sites may be related to a disease such as a cancer, a heritable disease with a genetic disorder, or a developmental error, etc., in animals. Therefore, the method can be used for in vitro diagnosis of these diseases.

    Example 7 Application of Rnase R Enzyme Treatment in Identifying 2′-O-Methylation Sites in 18s rRNA, 28s rRNA and mRNA

    [0073] By way of the Hela cell line as an example, the principle and operation are the same as those in Example 6. After obtaining the sequencing results, by using the ratio of the number of fragments terminating at each site to the number of fragments terminating at the previous site, based on the principle as described in Example 6, we can determine whether it may be a 2′-O-methylation site. FIG. 5 showed the ratio of each site by way of 18s rRNA as an example.

    [0074] If ranked from high to low ratios, 18 of the top 19 sites (>20) with the highest ratio have been reported in other literatures to have 2′-O-methylation modification, while the site that hasn't been reported (that is, site 889) was further verified by us with mass spectrometry that 2′-O-methylation did exist, which fully demonstrated the accuracy of our methods.

    [0075] Table 3 and Table 4 listed the distribution of some sites with higher ratios in 18s rRNA and 28s rRNA.

    TABLE-US-00005 TABLE 3 The ratios of the sites detected in 18s rRNA in the high- throughput sequencing results (the modification site is the one immediately preceding the detection site) Detection site Base Ratio 117 C 48.16667 122 G 166.8097 160 T 1707.426 167 G 428.5587 355 G 174.2358 429 C 69.34783 463 C 22.05 518 G 25.35197 577 T 35.08333 602 G 28.74733 645 C 246.0549 684 G 211.3834 800 T 115.2574 868 G 64.85556 890 T 21.54957 1289 T 36.85373 1392 T 293.7282 1443 C 37.88632 1807 G 55.44685

    TABLE-US-00006 TABLE 4 The ratios of the sites detected in 28s rRNA in the high- throughput sequencing results (the modification site is the one immediately preceding the detection site) Detection site Base Ratio 317 C 32.76924 371 T 22.47177 373 G 21.51328 390 G 491.7253 392 G 211.7743 1522 C 621.9453 1613 G 27.0214 2339 T 46.56403 2352 C 329.4935 2403 G 36.0185 2412 T 105.3013 2437 G 24.33857 2792 C 37.88587 2809 G 20.76296 2825 G 809.6902 2864 G 161.198 3698 A 65.51724 3704 G 142.0595 3744 G 46.68519 3750 C 40.44883 3765 T 66.8547 3772 T 28.37143 3788 G 160 3798 G 734.2296 3805 C 54.132 3810 T 223.7791 3821 C 66.12058 3847 G 21.62822 3905 C 158.0185 3924 A 24.40569 4033 T 36.66667 4167 G 95.37424 4199 T 58.77964 4341 G 124.8125 4465 G 134.0839 4470 T 290.9694 4494 G 127.5619 4507 C 63.3325 4542 T 37.12903 4550 T 84.502 4561 T 37.50324 4591 C 36.33632

    [0076] Similarly, we can also obtain the distribution of the sites with higher ratios in the mRNA, which correspond to the corresponding positions on the chromosome. Table 5 below shows some of the results.

    TABLE-US-00007 TABLE 5 Detection results of modification sites with the top mRNA ratios in high-throughput sequencing data (the modification site is the one immediately preceding the detection site) Positive/ Detection Negative Chromosome site Chain Base Gene Ratio 3 188883727 + C LPP 17039 16 56740761 + C NUP93 16987 19 46650155 − C DACT3 16972 19 45547720 − C OPA3 16966 19 12633089 + C ZNF791 16952 10 131966904 − C BNIP3 16946 15 34228177 + C EMC4 16945 3 169767069 − C ACTRT3 16944 19 4533118 − C PLIN5 16940 6 7283270 − C SSR1 16928 6 132451121 − C STX7 16917 11 10513703 − C RNF141 16915 7 74601938 + C GTF2IRD1 16893 16 4750513 − C ZNF500 16879 19 54889062 + C FCAR 16855 5 141367531 + C PCDHGA5 16853 X 23702277 − C ACOT9 16773 2 207610080 − C METTL21A 16747 19 12632776 + C ZNF791 14701 3 149813061 + C RNF13 8771 7 82908958 − G PCLO 5153 6 157206930 + C ARID1B 5143 10 67539556 − C CTNNA3 5142 6 166410579 − C RPS6KA2 5142 X 154776224 + C DKC1 5140 19 7459982 + C AC008878.3/ 5135 ARHGEF18 17 47808877 − C AC003665.1 5135 5 71012579 − C NAIP 5135 5 177091710 + G FGFR4 5133 19 44072279 + G ZNF284 5132 2 1423064 + G TPO 5132 6 26252529 + G HIST1H2BH 5132 12 66630256 − G GRIP1 5132 9 127219237 + T RALGPS1 1719

    [0077] The truncated enzyme was used instead of the complete Rnase R enzyme to perform the operations in the above examples, and similar results can be obtained. For example, an operation similar to Example 3 was used to treat miR-21 and miR-21-ch3 with the truncated enzyme, the results are as shown in FIG. 6: miR-21 was degraded, miR-21-ch3 was not degraded. This shows that removing the first (amino-terminal) 81 amino acids of Rnase R enzyme does not affect its RNA exonuclease activity, and the exonuclease activity is inhibited by 2′-O-methylation.

    [0078] The above embodiments are only used to illustrate the technical solutions of the present invention, rather than limiting the same; those having ordinary skills in the art should understand that: the technical solutions described in the foregoing embodiments can still be modified, or a part or all of the technical features therein can be equivalently substituted; and these modifications or substitutions will not make the corresponding technical solutions essentially depart from the scope of the technical solutions of the embodiments of the present invention, and all of which should be covered within the scope of the specification of the present invention.

    REFERENCES

    [0079] 1. Yu Y T, et al. A new method for detecting sites of 2′-O-methylation in RNA molecules. RNA 3, 324-331 (1997). [0080] 2. Wang X D, et al. A three-way junction structure-based isothermal exponential amplification strategy for sensitive detection of 3′-terminal 2′-O-methylated plant microRNA. Chem. Commun. 53, 1124-1127 (2017). [0081] 3. Yang Z Y, et al. Approaches for studying microRNA and small interfering RNA methylation in vitro and in vivo. Methods Enzymol. 427: 139-154 (2007). [0082] 4. Kellner S, et al. Detection of RNA modifications. RNA Biology 7:2, 237-247 (2010). [0083] 5. Aschenbrenner J & Marx A, Direct and site-specific quantification of RNA 2′-O-methylation by PCR with an engineered DNA polymerase. Nucleic Acids Research 44:8, 3495-3502 (2016). [0084] 6. Adhikari S, et al. Hairpin priming is better suited than in vitro polyadenylation to generate cDNA for plant miRNA qPCR. Molecular Plant 6:1, 229-231 (2013). [0085] 7. Yu B, et al. Methylation as a crucial step in plant microRNA biogenesis. Science 307, 932-935 (2005). [0086] 8. Kala R, et al. MicroRNAs: an emerging science in cancer epigenetics. Journal of Clinical Bioinformatics 3:6 1-8 (2013). [0087] 9. Dong Z W, et al. RTL-P: a sensitive approach for detecting sites of 2-O-methylation in RNA molecules. Nucleic Acids Research, 40:20, e157 (2012). [0088] 10. Zhang X D, et al. Small RNA modifications: integral to function and disease. Trends in Molecular Medicine, 22:12, 1025-1034 (2016). [0089] 11. Garzon R, et al. Targeting microRNAs in cancer: rationale, strategies and challenges. Nat Rev Drug Discov. 9:10, 775-789 (2010).