Chemoenzymatic synthesis of heparin and heparan sulfate analogs
10160986 ยท 2018-12-25
Assignee
Inventors
- Xi Chen (Davis, CA)
- Hai Yu (Woodland, CA)
- Yanhong Li (Davis, CA, US)
- Yi Chen (Davis, CA, US)
- Jingyao Qu (Smyrna, GA, US)
- Musleh M. Muthana (Davis, CA, US)
- Kam Lau (Parkwood, AU)
- Lars Bode (San Diego, CA)
Cpc classification
C12P19/18
CHEMISTRY; METALLURGY
C07H1/00
CHEMISTRY; METALLURGY
C08B37/0075
CHEMISTRY; METALLURGY
C07H13/04
CHEMISTRY; METALLURGY
C12P19/00
CHEMISTRY; METALLURGY
C12P19/04
CHEMISTRY; METALLURGY
C12P19/26
CHEMISTRY; METALLURGY
C07H19/10
CHEMISTRY; METALLURGY
C07H3/06
CHEMISTRY; METALLURGY
International classification
C12P19/18
CHEMISTRY; METALLURGY
Abstract
The present invention provides a one-pot multi-enzyme method for preparing UDP-sugars from simple sugar starting materials. The invention also provides a one-pot multi-enzyme method for preparing oligosaccharides from simple sugar starting materials.
Claims
1. A method of synthesizing a UDP-sugar, the method comprising forming a reaction mixture comprising: i) a first sugar, ii) a glucosamine uridylyltransferase (GlmU) or a promiscuous UDP-sugar pyrophosphorylase (USP), wherein the GlmU comprises the amino acid sequence set forth in SEQ ID NO: 46 and the USP comprises the amino acid sequence set forth in SEQ ID NO: 47, and iii) a kinase or a dehydrogenase, under conditions sufficient to form the UDP-sugar.
2. The method of claim 1, wherein the first sugar is selected from the group consisting of substituted or unsubstituted glucose (Glc), substituted or unsubstituted glucose-1-phosphate (Glc-1-P), substituted or unsubstituted glucuronic acid (GlcA), substituted or unsubstituted glucuronic acid-1-phosphate (GlcA-1-P), substituted or unsubstituted iduronic acid (IdoA), substituted or unsubstituted iduronic acid-1-phosphate (IdoA-1-P), substituted or unsubstituted N-acetylglucosamine (GlcNAc), substituted or unsubstituted N-acetylglucosamine-1-phosphate (GlcNAc-1-P), substituted or unsubstituted glucosamine (GlcNH.sub.2), substituted or unsubstituted glucosamine-1-phosphate (GlcNH.sub.21-P), substituted or unsubstituted galactose (Gal), substituted or unsubstituted galactose-1-phosphate (Gal-1-P), substituted or unsubstituted galacturonic acid (GalA), substituted or unsubstituted galacturonic acid-1-phosphate (GalA-1-P), substituted or unsubstituted N-acetylgalactosamine (GalNAc), substituted or unsubstituted N-acetylgalactosamine-1-phosphate (GalNAc-1-P), substituted or unsubstituted galactosamine (GalNH.sub.2), substituted or unsubstituted galactosamine-1-phosphate (GalNH.sub.21-P), substituted or unsubstituted mannose (Man), substituted or unsubstituted mannose-1-phosphate (Man-1-P), and substituted or unsubstituted N-acetylmannosamine (ManNAc), substituted or unsubstituted N-acetylmannosamine-1-phosphate (ManNAc-1-P), substituted or unsubstituted mannosamine (ManNH.sub.2), and substituted or unsubstituted mannosamine-1-phosphate (ManNH.sub.21-P).
3. The method of claim 1, wherein the kinase is selected from the group consisting of an N-acetylhexosamine 1-kinase (NahK), a galactokinase (GalK), and a glucuronokinase (GlcAK).
4. The method of claim 1, wherein the dehydrogenase is UDP-glucose dehydrogenase (Ugd).
5. The method of claim 1, wherein the UDP-sugar is selected from the group consisting of substituted or unsubstituted UDP-Glc, substituted or unsubstituted UDP-GlcA, substituted or unsubstituted UDP-IdoA, substituted or unsubstituted UDP-GalA, substituted or unsubstituted UDP-GlcNAc, substituted or unsubstituted UDP-GlcNH.sub.2, substituted or unsubstituted UDP-Gal, substituted or unsubstituted UDP-GalNAc, substituted or unsubstituted UDP-GalNH.sub.2, substituted or unsubstituted UDP-Man, and substituted or unsubstituted UDP-ManNAc, and substituted or unsubstituted UDP-ManNH.sub.2.
6. The method of claim 1, wherein the reaction mixture further comprises a pyrophosphatase.
7. The method of claim 1, wherein the GlmU comprises the amino acid sequence set forth in SEQ ID NO: 8 and the USP comprises the amino acid sequence set forth in SEQ ID NO: 10.
8. The method of claim 1, wherein the reaction mixture comprises: i) the first sugar, ii) the GlmU comprising the amino acid sequence set forth in SEQ ID NO: 46, and iii) the kinase or the dehydrogenase.
9. The method of claim 1, wherein the reaction mixture comprises: i) the first sugar, ii) the USP comprising the amino acid sequence set forth in SEQ ID NO: 47, and iii) the kinase or the dehydrogenase.
10. A method of preparing an oligosaccharide, the method comprising: forming a first reaction mixture comprising: i) a first sugar, ii) an acceptor sugar, iii) a glycosyltransferase, iv) a glucosamine uridylyltransferase (GlmU) or a promiscuous UDP-sugar pyrophosphorylase (USP), wherein the GlmU comprises the amino acid sequence set forth in SEQ ID NO: 46 and the USP comprises the amino acid sequence set forth in SEQ ID NO: 47, and iv) a kinase or a dehydrogenase, wherein the first sugar is selected from the group consisting of a substituted or unsubstituted N-acetylglucosamine (GlcNAc), a substituted or unsubstituted glucosamine (GlcNH.sub.2), a substituted or unsubstituted glucuronic acid (GlcA), a substituted or unsubstituted galacturonic acid (GalA), a substituted or unsubstituted iduronic acid (IdoA), and a substituted or unsubstituted glucose-1-phosphate (Glc-1-P), wherein the acceptor sugar comprises at least one member selected from the group consisting of a substituted or unsubstituted N-acetylglucosamine (GlcNAc), a substituted or unsubstituted glucosamine (GlcNH.sub.2), a substituted or unsubstituted glucuronic acid (GlcA), and a substituted or unsubstituted iduronic acid (IdoA), under conditions sufficient to convert the first sugar to a UDP-sugar, and sufficient to couple the sugar in the UDP-sugar to the acceptor sugar, such that: when the first sugar is substituted or unsubstituted GlcNAc or GlcNH.sub.2, the sugar in the UDP-sugar is coupled to substituted or unsubstituted GlcA or substituted or unsubstituted IdoA of the acceptor sugar, and when the first sugar is substituted or unsubstituted Glc-1-P, substituted or unsubstituted GlcA, or substituted or unsubstituted IdoA, the sugar in the UDP-sugar is coupled to substituted or unsubstituted GlcNH.sub.2 or substituted or unsubstituted GlcNAc of the acceptor sugar, thereby preparing the oligosaccharide.
11. The method of claim 10, wherein the acceptor sugar is selected from the group consisting of a monosaccharide, a disaccharide, a trisaccharide, a tetrasaccharide, a pentasaccharide, a hexasaccharide, a heptasaccharide, an octasaccharide, and a nonasaccharide.
12. The method of claim 10, wherein the glycosyltransferase is selected from the group consisting of PmHS1, PmHS2, PmCS, PmHAS, NmLgtA, NmLgtB, KfiC, and KfiA.
13. The method of claim 10, wherein the kinase is selected from the group consisting of an N-acetylhexosamine 1-kinase (NahK), a galactokinase (GalK), and a glucuronokinase (GlcAK).
14. The method of claim 10, wherein the dehydrogenase is UDP-glucose dehydrogenase (Ugd).
15. The method of claim 10, wherein the UDP-sugar is selected from the group consisting of substituted or unsubstituted UDP-GlcNAc, substituted or unsubstituted UDP-GlcNH.sub.2, substituted or unsubstituted UDP-Glc, substituted or unsubstituted UDP-GlcA, substituted or unsubstituted UDP-GalA, and substituted or unsubstituted UDP-IdoA.
16. The method of claim 10, wherein the reaction mixture further comprises a pyrophosphatase.
17. The method of claim 10, wherein the oligosaccharide is selected from the group consisting of: GlcNAc-GlcA, GlcA-GlcNAc-GlcA, GlcNAc-GlcA-GlcNAc-GlcA, GlcA-GlcNAc-GlcA-GlcNAc-GlcA, GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA, GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA, GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA, GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA, GlcA-GlcNAc, GlcNAc-GlcA-GlcNAc, GlcA-GlcNAc-GlcA-GlcNAc, GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc, GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc, GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc, GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc, GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc, and GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc.
18. The method of claim 10, wherein the GlmU comprises the amino acid sequence set forth in SEQ ID NO: 8 and the USP comprises the amino acid sequence set forth in SEQ ID NO: 10.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
DETAILED DESCRIPTION OF THE INVENTION
(56) I. General
(57) The present invention provides a convenient and highly efficient one-pot multienzyme system for the synthesis of UDP-sugars and oligosaccharides including heparin and heparosan sulfate (HS) analogs as well as human milk oligosaccharides (HMOs). Kinases or dehydrogenases, nucleotide-sugar pyrophosphorylases, and/or glycosyltransferases are used in one-pot reactions to convert monosaccharide precursors to UDP-sugars and/or oligosaccharides. Chemical diversification of the enzymatically formed UDP-sugars and oligosaccharides can be conducted to produce more structural variations. In particular, non-sulfated oligosaccharides can be selectively modified to prepare structurally defined products with desired sulfation patterns. A diverse set of enzymatic substrates can be used in the methods of the invention to prepare a wide range of useful UDP-sugars and oligosaccharides.
(58) II. Definitions
(59) As used herein, the term first sugar refers to a monosaccharide starting material used in the methods of the invention. The monosaccharide can be a hexose or a pentose. Hexoses include, but are not limited to, glucose (Glc), glucosamine (2-amino-2-deoxy-glucose; GlcNH.sub.2), N-acetylglucosamine (2-acetamido-2-deoxy-glucose; GlcNAc), galactose (Gal), galactosamine (2-amino-2-deoxy-galactose; GalNH.sub.2), N-acetylgalactosamine (2-acetamido-2-deoxy-galactose; GalNAc), mannose (Man), mannosamine (2-amino-2-deoxy-mannose; ManNH.sub.2), N-acetylmannosamine (2-acetamido-2-deoxy-mannose; ManNAc), glucuronic acid (GlcA), iduronic acid (IdoA), and galacturonic acid (GalA). Pentoses include, but are not limited to, ribose (Rib), xylose (Xyl), and arabinose (Arb). The sugar can be a D sugar or an L sugar. The sugar can be unsubstituted or substituted with moieties including, but not limited to, amino groups, azido groups, amido groups, acylamido groups, N-sulfate groups (sulfamate), and O-sulfate groups. A second sugar and subsequent sugars are generally defined as for the first sugar, except that they are used after the first sugar in a multi-step synthesis.
(60) As used herein, the term UDP-sugar refers to a sugar containing a uridine diphosphate moiety. The sugar portion of the UDP-sugar is defined as for the first sugar described above. UDP-sugars include, but are not limited to UDP-Glc, UDP-GlcNAc, UDP-GlcNH.sub.2, UDP-GlcA, UDP-IdoA, UDP-GalA, UDP-Gal, UDP-GalNAc, UDP-GalNH.sub.2, UDP-Man, UDP-ManNAc, and UDP-ManNH.sub.2. The UDP-sugar can be unsubstituted or substituted as described above.
(61) As used herein, the term CMP-sialic acid refers to a sialic acid having a cytidine-5-monophosphate moiety. The sialic acid moiety can include N- and O-substituted derivatives of neuraminic acid (i.e., 5-acetamido-3,5-dideoxy-D-glycero-D-galacto-non-2-ulosonic acid, or (4S,5R,6R,7S,8R)-5-amino-4,6,7,8,9-pentahydroxy-2-oxo-nonanoic acid). CMP-sialic acids include, but are not limited to, cytidine 5-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac).
(62) As used herein, the term oligosaccharide refers to a compound containing at least two monosaccharides covalently linked together. Oligosaccharides include disaccharides, trisaccharides, tetrasachharides, pentasaccharides, hexasaccharides, heptasaccharides, octasaccharides, and the like. Covalent linkages generally consist of glycosidic linkages (i.e., COC bonds) formed from the hydroxyl groups of adjacent sugars. Linkages can occur between the 1-carbon and the 4-carbon of adjacent sugars (i.e., a 1-4 linkage), the 1-carbon and the 3-carbon of adjacent sugars (i.e., a 1-3 linkage), the 1-carbon and the 6-carbon of adjacent sugars (i.e., a 1-6 linkage), or the 1-carbon and the 2-carbon of adjacent sugars (i.e., a 1-2 linkage). Linkages can occur between the 2-carbon and the 3-carbon of adjacent sugars (i.e., a 2-3 linkage), the 2-carbon and the 6-carbon of adjacent sugars (i.e., a 2-6 linkage), the 2-carbon and the 8-carbon of adjacent sugars (i.e., a 2-8 linkage), or the 2-carbon and the 9-carbon of adjacent sugars (i.e., a 2-9 linkage). A sugar can be linked within an oligosaccharide such that the anomeric carbon is in the - or -configuration. The oligosaccharides prepared according to the methods of the invention can also include linkages between carbon atoms other than the 1-, 2-, 3-, 4-, and 6-carbons or the 2-, 3-, 6-, 8-, and 9-carbons.
(63) As used herein, the term sialylated oligosaccharide refers to an oligosaccharide as described above having at least one sialic acid moiety covalently linked to the oligosaccharide. The sialic acid moiety is a monosaccharide subunit and can include N- and O-substituted derivatives of neuraminic acid (i.e., (4S,5R,6R,7S,8R)-5-amino-4,6,7,8,9-pentahydroxy-2-oxo-nonanoic acid).
(64) As used herein, the term enzyme refers to a polypeptide that catalyzes the transformation of a starting material, such as a sugar, to an intermediate or product of the one-pot reactions of the invention. Examples of enzymes include, but are not limited to, kinases, dehydrogenases, nucleotide-sugar pyrophosphorylases, pyrophosphatases, and glycosyltransferases. Other enzymes may be useful in the methods of the invention.
(65) As used herein, the term kinase refers to a polypeptide that catalyzes the covalent addition of a phosphate group to a substrate. The substrate for a kinase used in the methods of the invention is generally a sugar as defined above, and a phosphate group is added to the anomeric carbon (i.e. the 1 position) of the sugar. The product of the reaction is a sugar-1-phosphate. Kinases include, but are not limited to, N-acetylhexosamine 1-kinases (NahKs), glucuronokinases (GlcAKs), glucokinases (GlcKs), galactokinases (GalKs), monosaccharide-1-kinases, and xylulokinases. Certain kinases utilize nucleotide triphosphates, including adenosine-5-triphosphate (ATP) as substrates.
(66) As used herein, the term dehydrogenase refers to a polypeptide that catalyzes the oxidation of a primary alcohol. In general, the dehyrogenases used in the methods of the invention convert the hydroxymethyl group of a hexose (i.e. the C6-OH moiety) to a carboxylic acid. Dehydrogenases useful in the methods of the invention include, but are not limited to, UDP-glucose dehydrogenases (Ugds).
(67) As used herein, the term nucleotide-sugar pyrophosphorylase refers to a polypeptide that catalyzes the conversion of a sugar-1-phosphate to a UDP-sugar. In general, a uridine-5-monophosphate moiety is transferred from uridine-5-triphosphate to the sugar-1-phosphate to form the UDP-sugar. Examples of nucleotide-sugar pyrophosphorylases include glucosamine uridylyltransferases (GlmUs) and glucose-1-phosphate uridylyltransferases (GalUs). Nucleotide-sugar pyrophosphorylases also include promiscuous UDP-sugar pyrophosphorylases, termed USPs, that can catalyze the conversion of various sugar-1-phosphates to UDP-sugars including UDP-Glc, UDP-GlcNAc, UDP-GlcNH.sub.2, UDP-Gal, UDP-GalNAc, UDP-GalNH.sub.2, UDP-Man, UDP-ManNAc, UDP-ManNH.sub.2, UDP-GlcA, UDP-IdoA, UDP-GalA, and their substituted analogs.
(68) As used herein, the term pyrophosphatase (abbreviated as PpA) refers to a polypeptide that catalyzes the conversion of pyrophosphate (i.e., P.sub.2O.sub.7.sup.4, HP.sub.2O.sub.7.sup.3, H.sub.2P.sub.2O.sub.7.sup.2, H.sub.3P.sub.2O.sub.7.sup.) to two molar equivalents of inorganic phosphate (i.e., PO.sub.4.sup.3, HPO.sub.4.sup.2, H.sub.2PO.sub.4.sup.).
(69) As used herein, the term glycosyltransferase refers to a polypeptide that catalyzes the formation of an oligosaccharide from a nucleotide-sugar an acceptor sugar. Nucleotide-sugars include, but are not limited to, nucleotide diphosphate sugars (NDP-sugars) and nucleotide monophosphate sugars (NMP-sugars) such as a cytidine monosphophate sugar (CMP-sugar). In general, a glycosyltransferase catalyzes the transfer of the monosaccharide moiety of an NDP-sugar or CMP-sugar to a hydroxyl group of the acceptor sugar. The covalent linkage between the monosaccharide and the acceptor sugar can be a 1-3 linkage, a 1-4 linkage, a 1-6-linkage, a 1-2 linkage, a 2-3 linkage, a 2-6 linkage, a 2-8 linkage, or a 2-9 linkage as described above. The linkage may be in the - or -configuration with respect to the anomeric carbon of the monosaccharide. Other types of linkages may be formed by the glycosyltransferases in the methods of the invention. Glycosyltransferases include, but are not limited to, heparosan synthases (HSs) glucosaminyltransferases, N-acetylglucosaminyltransferases, glucosyltransferasess, glucuronyltransferases, and sialyltransferases.
(70) The glycosyltransferases useful in the present invention include those in Glycosyltransferase family 80 (GT80 using CAZy nomenclature) and include beta-galactoside alpha-2,3-sialyltransferases that catalyze the following conversion: CMP-sialic acid+-D-galactosyl-R=CMP+-sialic acid-(2.fwdarw.3)--D-galactosyl-R, where the acceptor is GalOR, where R is H, a monosaccharide, an oligosaccharide, a polysaccharide, a glycopeptide, a glycoprotein, a glycolipid, or a hydroxyl-containing compound. GT80 family sialyltransferases also include galactoside or N-acetylgalactosaminide alpha-2,6-sialyltransferases that catalyze the following conversion: CMP-sialic acid+galactosyl/GalNAc-R=CMP+-sialic acid-(2.fwdarw.6)--D-galactosyl/GalNAc-R, where the acceptor is GalOR or GalNAcOR, where R is H, serine or threonine on a peptide or protein, a monosaccharide, an oligosaccharide, a polysaccharide, a glycopeptide, a glycoprotein, a glycolipid, or a hydroxyl-containing compound.
(71) As used herein, the term CMP-sialic acid synthetase refers to a polypeptide that catalyzes the synthesis of cytidine monophosphate sialic acid (CMP-sialic acid) from cytidine triphosphate (CTP) and sialic acid.
(72) As used herein, the term sialic acid aldolase refers to an aldolase that catalyzes a reversible reaction that converts a suitable hexosamine, hexose, pentose, or derivative (such as N-acetyl mannosamine) to sialic acid via reaction with pyruvate.
(73) As used herein, the term substrate sugar refers to a sugar that accepts a sialic acid moiety from a CMP-sialic acid. The substrate sugar can contain a monosaccharide, an oligosaccharide, or a polysaccharide.
(74) As used herein, the term couple refers to catalyzing the formation of a covalent bond between enzyme substrates. The coupling can take place via the direct reaction of two substrates with each other. Alternatively, the coupling can include the formation of one or more enzyme-substrate intermediates. An enzyme-substrate intermediate can, in turn, react with another substrate (or another enzyme-substrate intermediate) to form the bond between the substrates.
(75) As used herein, the terms treat, treating and treatment refer to any indicia of success in the treatment or amelioration of an injury, pathology, condition, or symptom thereof; including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the symptom, injury, pathology or condition more tolerable to the subject; decreasing the duration of the symptom or condition; or, in some situations, preventing the onset of the symptom or condition. The treatment or amelioration of symptoms can be based on any objective or subjective parameter; including, e.g., the result of a physical examination.
(76) As used herein, necrotizing enterocolitis refers to the death of intestinal tissue in a subject.
(77) As used herein, the term subject refers to a human or animal. In certain embodiments, the subject is a human infant.
(78) III. Mono- and Oligo-Saccharides
(79) A number of UDP-sugars can be synthesized according to the methods of the invention. In general, the UDP-sugars have structures according to Formula I:
(80) ##STR00001##
wherein each of R.sup.1, R.sup.2, and R.sup.3 is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, and NHC(O)CH.sub.2N.sub.3; and R.sup.4 is selected from CH.sub.2OH, CO.sub.2.sup., CO.sub.2H, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, and CH.sub.2NHC(O)CH.sub.2N.sub.3.
(81) In some embodiments, the UDP-sugars have structures according to formula Ia:
(82) ##STR00002##
(83) A range of oligosaccharides can also be prepared using the methods of the invention. In general, the oligosaccharides contain one or more unit according to Formula II:
(84) ##STR00003##
(85) In oligosaccharide units according to Formula II, each of R.sup.1a, R.sup.1b, R.sup.2a, and R.sup.2b is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, or NHC(O)CH.sub.2N.sub.3; and each of R.sup.1c and R.sup.2c is independently selected from CH.sub.2OH, CO.sub.2.sup., CO.sub.2H, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3. In some embodiments, one of R.sup.1c and R.sup.2c can be CO.sub.2.sup. or CO.sub.2H, while the other of R.sup.1c and R.sup.2c can be CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3. R includes but not is limited to H, CH.sub.3, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2N.sub.3, CH.sub.2CH.sub.2CH.sub.2N.sub.3, an aglycon according to Formula B, Formula C, Formula D, or Formula E below, substituted or unsubstituted GlcNAc, substituted or unsubstituted GlcNH.sub.2, substituted or unsubstituted GlcA, or substituted or unsubstituted Ido:
(86) ##STR00004##
(87) In some embodiments, the oligosaccharides have the structure of formula IIa:
(88) ##STR00005##
(89) In some embodiments, the method provides oligosaccharides with structures according to Formula III:
(90) ##STR00006##
wherein each of R.sup.1aR.sup.1b, and R.sup.2a is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, or NHC(O)CH.sub.2N.sub.3; and R.sup.1c is selected from CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3.
(91) In some embodiments, the method provides oligosaccharides with structures according to Formula IV:
(92) ##STR00007##
wherein each of R.sup.1a, R.sup.2a, and R.sup.2b is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, and NHC(O)CH.sub.2N.sub.3; and R.sup.20 is selected from CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3.
(93) In some embodiments, the present invention provides oligosaccharides having the structure of formula IVa:
(94) ##STR00008##
(95) In some embodiments, the method provides oligosaccharides with structures according to Formula (V):
(96) ##STR00009##
(97) wherein each of R.sup.1a, R.sup.2a, R.sup.2b, and R.sup.3a is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, and NHC(O)CH.sub.2N.sub.3; and R.sup.2c is selected from CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3.
(98) In some embodiments, the present invention provides oligosaccharides having a structure of formula Va:
(99) ##STR00010##
(100) In some embodiments, the method provides oligosaccharides with structures according to Formula VI:
(101) ##STR00011##
wherein each of R.sup.1a, R.sup.2a, R.sup.2b, R.sup.3a, R.sup.4b, and R.sup.4b is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, or NHC(O)CH.sub.2N.sub.3; and each of R.sup.2c, R.sup.4c is independently selected from CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3.
(102) In some embodiments, the oligosaccharides has the structure of formula VIa:
(103) ##STR00012##
IV. One-Pot Method of Making UDP-Sugars
(104) In a first embodiment, the invention provides a method of synthesizing a UDP-sugar. The method includes forming a reaction mixture comprising a first sugar, a nucleotide-sugar pyrophosphorylase, and a first enzyme selected from a kinase and a dehydrogenase under conditions sufficient to form the UDP-sugar.
(105) In some embodiments, the first sugar is selected from substituted or unsubstituted glucose (Glc), substituted or unsubstituted glucose-1-phosphate (Glc-1-P), substituted or unsubstituted glucuronic acid (GlcA), substituted or unsubstituted glucuronic acid-1-phosphate (GlcA-1-P), substituted or unsubstituted iduronic acid (IdoA), substituted or unsubstituted iduronic acid-1-phosphate (IdoA-1-P), substituted or unsubstituted N-acetylglucosamine (GlcNAc), substituted or unsubstituted N-acetylglucosamine-1-phosphate (GlcNAc-1-P), substituted or unsubstituted glucosamine (GlcNH.sub.2), substituted or unsubstituted glucosamine-1-phosphate (GlcNH.sub.2-1-P), substituted or unsubstituted galactose (Gal), substituted or unsubstituted galactose-1-phosphate (Gal-1-P), substituted or unsubstituted galacturonic acid (GalA), substituted or unsubstituted galacturonic acid-1-phosphate (GalA-1-P), substituted or unsubstituted N-acetylgalactosamine (GalNAc), substituted or unsubstituted N-acetylgalactosamine-1-phosphate (GalNAc-1-P), substituted or unsubstituted galactosamine (GalNH.sub.2), substituted or unsubstituted galactosamine-1-phosphate (GalNH.sub.2-1-P), substituted or unsubstituted mannose (Man), substituted or unsubstituted mannose-1-phosphate (Man-1-P), substituted or unsubstituted N-acetylmannosamine (ManNAc), substituted or unsubstituted N-acetylmannosamine-1-phosphate (ManNAc-1-P), substituted or unsubstituted mannosamine (ManNH.sub.2), substituted or unsubstituted mannosamine-1-phosphate (ManNH.sub.2-1-P). In some embodiments, the first sugar is selected from GlcNAc, Glc-1-P, GlcA, and IdoA.
(106) In some embodiments, the first sugar has the formula VII:
(107) ##STR00013##
Wherein each of R.sup.1, R.sup.2, and R.sup.3 is selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, and NHC(O)CH.sub.2N.sub.3; R.sup.4 is selected from CH.sub.2OH, CO.sub.2.sup., CO.sub.2H, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, and CH.sub.2NHC(O)CH.sub.2N.sub.3; and R.sup.5 can be H, PO.sub.3.sup.2, or HPO.sub.3.sup.. In some embodiments, the first sugar has the formula VIII or IX:
(108) ##STR00014##
(109) In general, the reaction mixture formed in the methods of the invention contains a nucleotide-sugar pyrophosphorylase. The nucleotide-sugar pyrophosporylase can be, but is not limited to, a glucosamine uridyltransferase (GlmU), a Glc-1-P uridylyltransferase (GalU), or a promiscuous UDP-sugar pyrophosphorylase (USP). The present inventors have cloned and characterized a GlmU from P. multocida (PmGlmU) that is useful for the synthesis of UDP-sugars according to the methods of the invention. Suitable GalUs can be obtained, for example, from yeasts such as Saccharomyces fragilis, pigeon livers, mammalian livers such as bovine liver, Gram-positive bacteria such as Bifidobacterium bifidum, and Gram-negative bacteria such as Echerichia coli (EcGalU) (Chen X, Fang J W, Zhang J B, Liu Z Y, Shao J, Kowal P, Andreana P, and Wang P G. J. Am. chem. Soc. 2001, 123, 2081-2082). In some embodiments, the nucleotide-sugar pyrophosporylase is a USP. USPs include, but are not limited to, those obtained from Pisum sativum L. (PsUSP) and Arabidopsis thaliana (AtUSP), as well as enzymes obtained from protozoan parasites (such as Leishmania major and Trypanosoma cruzi) and hyperthermophilic archaea (such as Pyrococcus furiosus DSM 3638). USPs also include human UDP-GalNAc pyrophosphorylase AGX1, E. coli EcGlmU, and Bifidobacterium longum BLUSP. BLUSP was cloned and characterized by the inventors. In some embodiments, the nucleotide-sugar pyrophosphorylase is selected from AGX1, EcGlmU, EcGalU, PmGlmU, and BLUSP. In some embodiments, the nucleotide-sugar pyrophosphorylase is selected from EcGalU, PmGlmU, and BLUSP. In some embodiments, the nucleotide-sugar pyrophosphorylase is EcGalU. In some embodiments, the nucleotide-sugar pyrophosphorylase is PmGlmU. In some embodiments, the nucleotide-sugar pyrophosphorylase is BLUSP.
(110) The reaction mixture formed in the methods of the invention also contains a kinase or a dehydrogenase. In some embodiments, the first enzyme in the reaction mixture is a kinase. The kinase can be, but is not limited to, an N-acetylhexosamine 1-kinase (NahK), a galactokinase (GalK), or a glucuronokinase (GlcAK). In some embodiments, the kinase is an NahK. The NahK can be, for example, Bifidobacterium infantis NahK_ATCC15697 or Bifidobacterium longum NahK_ATCC55813. NahK_ATCC15697 and NahK_ATCC55813 were cloned and characterized by the inventors. In some embodiments, the kinase is a GalK. The GalK can be, for example, Escherichia coli EcGalK (Chen X, Fang J W, Zhang J B, Liu Z Y, Shao J, Kowal P, Andreana P, and Wang P G. J. Am. chem. Soc. 2001, 123, 2081-2082) and Streptococcus pneumoniae TIGR4 SpGalK (Chen M, Chen L L, Zou Y, Xue M, Liang M, Jing L, Guan W Y, Shen J, Wang W, Wang L, Liu J, and Wang P G. Carbohydr. Res. 2011, 346, 2421-2425).
(111) In some embodiments, the UDP-sugar is a substituted or unsubstituted UDP-GlcA. The first sugar employed in the synthesis of UDP-GlcA may vary depending on the enzymes that are used in the one-pot reaction. For example, Glc-1-P can be converted to UDP-Glc using a UDP-sugar pyrophosporylase. UDP-GlcA can be obtained from UDP-Glc using a dehydrogenase. Accordingly, the reaction mixture in some embodiments of the invention includes a dehydrogenase. The dehydrogenase can be, but is not limited to, a UDP-glucose dehydrogenase (Ugd). In some embodiments, the dehydrogenase is Pasteurella multocida PmUgd. The PmUgd was cloned and characterized by the inventors. Alternatively, GlcA can be converted to GlcA-1-P using a GlcAK. In some embodiments, therefore, the kinase in the reaction mixture is a GlcAK. The GlcAK can be, for example, Arabidopsis thaliana AtGlcAK. The GlcA-1-P is then converted to UDP-GlcA by a UDP-sugar pyrophosphorylase such as Arabidopsis thaliana AtUSP. The AtGlcAK was cloned and characterized by the inventors. Other sugars, including iduronic acid (IdoA) and galacturonic acid (GalA), can also be used as substrates for GlcAKs in the methods of the invention.
(112) Various UDP-sugars can be synthesized using the methods of the invention. In some embodiments, the UDP-sugar is selected from substituted or unsubstituted UDP-Glc, substituted or unsubstituted UDP-GlcA, substituted or unsubstituted UDP-IdoA, substituted or unsubstituted UDP-GalA, substituted or unsubstituted UDP-GlcNAc, substituted or unsubstituted UDP-GlcNH.sub.2, substituted or unsubstituted UDP-Gal, substituted or unsubstituted UDP-GalNAc, substituted or unsubstituted UDP-GalNH.sub.2, substituted or unsubstituted UDP-Man, substituted or unsubstituted UDP-ManNAc, and substituted or unsubstituted UDP-ManNH.sub.2. In some embodiments, the UPD-sugar is selected from UDP-GlcNAc, UDP-GlcNH.sub.2, UDP-GlcA, UDP-IdoA, UDP-GalA, UDP-Gal, UDP-Man, and UDP-Glc. The UDP-sugar can also have the structure of formula I described above.
(113) The hydroxyl groups, the amino group, and the N-acetyl amino group in UDP-sugar can be substituted with any suitable substituent. In some embodiments, the hydroxyl groups, the amino group, and the N-acetyl amino group in UDP-sugar can be substituted with an azide, an amine, an N-trifluoroacetyl group, an N-acyl group, an O-sulfate, or an N-sulfate.
(114) The reaction mixture formed in the methods of the invention can further include an inorganic pyrophosphatase (PpA). PpAs can catalyze the degradation of the pyrophosphate (PPi) that is formed during the conversion of a sugar-1-phosphate to a UDP-sugar. PPi degradation in this manner can drive the reaction towards the formation of the UDP-sugar products. The pyrophosphatase can be, but is not limited to, Pasteurella multocida PmPpA (Lau K, Thon V, Yu H, Ding L, Chen Y, Muthana M M, Wong D, Huang R, and Chen X. Chem. Commun. 2010, 46, 6066-6068).
(115) The reaction mixture in the present methods can be formed under any conditions sufficient to convert the first sugar to a UDP-sugar or an intermediate such as a sugar-1-phosphate. The reaction mixture can include, for example, buffering agents to maintain a desired pH, as well as salts and/or detergents to adjust the solubility of the enzymes or other reaction components. In general, the reaction mixture also includes one or more nucleotide triphosphates (NTPs), such as UTP or ATP, that are consumed during sugar phosphorylation and UDP-sugar formation. The reaction mixture can contain a stoichiometric amount of an NTP, with respect to the first sugar, or an excess of the NTP. Divalent metal ions, such as magnesium ions, manganese ions, cobalt ions, or calcium ions, may be required to maintain the catalytic activity of certain enzymes. Enzyme cofactors, including but not limited to nicotinamide adenine dinucleotide (NAD.sup.+), can also be included in the reaction mixture. In some embodiments, the reaction mixture further includes at least one component selected from UTP, ATP, Mn.sup.2+, Co.sup.2+, Ca.sup.2+, and Mg.sup.2+. After the reaction mixture is formed, it is held under conditions that allow for the conversion of the first sugar to the UDP sugar. For example, the reaction mixture can be held at 37 C. for 1 min-72 hr to form the UDP-sugar. The reaction mixture can also be held at 25 C. to form the UDP-sugar. Other temperatures and conditions may be suitable for forming the UDP-sugar, depending on the nature of the first sugar and the enzymes used for the synthesis.
(116) In some embodiments, the invention provides a method of synthesizing a UDP-sugar of Formula I:
(117) ##STR00015##
The method includes forming a reaction mixture comprising a first sugar, a nucleotide-sugar pyrophosphorylase, and a first enzyme selected from the group consisting of a kinase and a dehydrogenase under conditions sufficient to form the UDP-sugar. In some embodiments, the first sugar has the formula VII:
(118) ##STR00016##
Wherein each of R.sup.1, R.sup.2, and R.sup.3 is selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, and NHC(O)CH.sub.2N.sub.3; R.sup.4 is selected from CH.sub.2OH, CO.sub.2.sup., CO.sub.2H, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, and CH.sub.2NHC(O)CH.sub.2N.sub.3; and R.sup.5 can be H, PO.sub.3.sup.2, or HPO.sub.3.sup..
(119) Certain enzymes that are useful in the methods of the invention are characterized by a level of substrate promiscuity that allows for the synthesis of various natural and non-natural UDP-sugars. The scope of the products can be widened further by chemically appending a range of functionality to common enzymatically synthesized UDP-sugars. A UDP-sugar containing an azido moiety, for example, can be reduced to form an amino moiety which can be further elaborated via amide bond formation or N-sulfation to install various functional groups in the UDP-sugar. Similarly, trifluoracetamido moieties can also be converted to amino moieties for further derivitization. Accordingly, some embodiments of the invention include converting a UDP-azido-sugar or a UDP-trifluoroacetamido-sugar to a UDP-amino-sugar. In some embodiments, the UDP amino-sugar is further converted to a UDP-acylamido-sugar or a UDP-N-sulfated-sugar.
(120) V. One-Pot Method of Making Oligosaccharides
(121) The method described above for preparing UDP-sugars can be extended by incorporating additional enzymes that incorporate the sugar in UDP-sugars into oligosaccharide products. Accordingly, some embodiments of the invention provide a method of preparing an oligosaccharide. The method includes forming a first reaction mixture containing a first sugar, an acceptor sugar, a glycosyltransferase, a nucleotide-sugar pyrophosphorylase, and an enzyme selected from a kinase and a dehydrogenase. The first sugar is selected from a substituted or unsubstituted N-acetylglucosamine (2-acetamido-2-deoxy glucose, GlcNAc), a substituted or unsubstituted glucosamine (GlcNH.sub.2), a substituted or unsubstituted glucuronic acid (GlcA), a substituted or unsubstituted iduronic acid (IdoA), and a substituted or unsubstituted glucose-1-phosphate (Glc-1-P), and the acceptor sugar includes at least one member selected from a substituted or unsubstituted N-acetylglucosamine (GlcNAc), a substituted or unsubstituted glucosamine (GlcNH.sub.2), a substituted or unsubstituted glucuronic acid (GlcA), and a substituted or unsubstituted iduronic acid (IdoA). The reaction mixture is formed under conditions sufficient to convert the first sugar to a UDP-sugar, and sufficient to couple the sugar in the UDP-sugar to the acceptor sugar. When the first sugar is substituted or unsubstituted GlcNAc or GlcNH.sub.2, the sugar in the UDP-sugar is coupled to a substituted or unsubstituted GlcA or a substituted or unsubstituted IdoA of the acceptor sugar. When the first sugar is substituted or unsubstituted Glc-1-P, substituted or unsubstituted GlcA, or substituted or unsubstituted IdoA, the sugar in the UDP-sugar is coupled to a substituted or unsubstituted GlcNH.sub.2 or a substituted or unsubstituted GlcNAc of the acceptor sugar.
(122) In some embodiments, the first sugar has the formula:
(123) ##STR00017##
Wherein each of R.sup.1, R.sup.2, and R.sup.3 is selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, and NHC(O)CH.sub.2N.sub.3; R.sup.4 is selected from CH.sub.2OH, CO.sub.2.sup., CO.sub.2H, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, and CH.sub.2NHC(O)CH.sub.2N.sub.3; and R.sup.5 can be H, PO.sub.3.sup.2, or HPO.sub.3.sup.. In some embodiments, the first sugar has the formula VIII or IX:
(124) ##STR00018##
(125) The first sugar is converted to the UDP-sugar by the UDP-sugar pyrophosphorylase and the kinase/dehydrogenase as described above. In some embodiments, the first sugar is selected from substituted or unsubstituted glucose (Glc), substituted or unsubstituted glucose-1-phosphate (Glc-1-P), substituted or unsubstituted glucuronic acid (GlcA), substituted or unsubstituted iduronic acid (IdoA), substituted or unsubstituted glucuronic acid-1-phosphate (GlcA-1-P), substituted or unsubstituted iduronic acid (IdoA), substituted or unsubstituted iduronic acid-1-phosphate (IdoA-1-P), substituted or unsubstituted N-acetylglucosamine (GlcNAc), substituted or unsubstituted N-acetyl glucosamine-1-phosphate (GlcNAc-1-P), substituted or unsubstituted glucosamine (GlcNH.sub.2), substituted or unsubstituted glucosamine-1-phosphate (GlcNH.sub.2-1-P), substituted or unsubstituted galactose (Gal), substituted or unsubstituted galactose-1-phosphate (Gal-1-P), substituted or unsubstituted galacturonic acid (GalA), substituted or unsubstituted galacturonic acid-1-phosphate (GalA-1-P), substituted or unsubstituted N-acetylgalactosamine (GalNAc), substituted or unsubstituted N-acetylgalactosamine-1-phosphate (GalNAc-1-P), substituted or unsubstituted galactosamine (GalNH.sub.2), substituted or unsubstituted galactosamine-1-phosphate (GalNH.sub.2-1-P), substituted or unsubstituted mannose (Man), substituted or unsubstituted mannose-1-phosphate (Man-1-P), substituted or unsubstituted N-acetylmannosamine (ManNAc), substituted or unsubstituted N-acetylmannosamine-1-phosphate (ManNAc-1-P), substituted or unsubstituted mannosamine (ManNH.sub.2), substituted or unsubstituted mannosamine-1-phosphate (ManNH.sub.2-1-P). In some embodiments, the UDP-sugar is a compound of Formula I.
(126) The sugar in the UDP-sugar is, in turn, coupled to an acceptor sugar to form an oligosaccharide product. A variety of sugars can be used as the acceptor sugar. For example, the acceptor sugar can be a monosaccharide, a disaccharide, a trisaccharide, or a tetrasaccharide. Longer oligosaccharides may also be used as the acceptor sugar in the methods of the invention. In some embodiments, the oligosaccharide can be a compound of Formula II, III, IV, V, or VI.
(127) In general, the sugar in a UDP-sugar is coupled to an acceptor sugar by the glycosyltransferase in the reaction mixture. Any suitable glycosyltransferase can be used in the methods of the invention. Certain glycosyltransfers have exhibited a level of substrate promiscuity that are particularly useful for preparing a variety of oligosaccharide products. Promiscuous glycosyltransferases can utilize a range of UDP-sugars and/or a range of acceptor sugars. The glycosyltransferase can be, for example, P. multocida PmHS1 or PmHS2. The glycosyltransferase can also be E. coli KfiA or KfiC. Other glycosyltransferases can also be useful in the methods of the invention. In some embodiments, the glycosyltransferase is selected from PmHS1, PmHS2 and KfiA. In some embodiments, the glycosyltransferase is selected from PmHS1, PmHS2, NmLgtA, NmLgtB, PmCS, PmHAS, KfiC, and KfiA.
(128) In general, the UDP-sugar can be formed enzymatically in the one-pot reaction mixture as described above. The nucleotide-sugar pyrophosporylase can be, but is not limited to, a glucosamine uridyltransferase (GlmU), a Glc-1-P uridylyltransferase (GalU), or a promiscuous UDP-sugar pyrophosphorylase (USP). In some embodiments, the nucleotide-sugar pyrophosphorylase is selected from AGX1, EcGlmU, EcGalU, PmGlmU, and BLUSP. In some embodiments, the nucleotide-sugar pyrophosphorylase is selected from AGX1, EcGalU, and BLUSP. In some embodiments, the nucleotide-sugar pyrophosphorylase is selected from EcGalU, PmGlmU, and BLUSP. In some embodiments, the nucleotide-sugar pyrophosphorylase is EcGalU. In some embodiments, the nucleotide-sugar pyrophosphorylase is PmGlmU. In some embodiments, the nucleotide-sugar pyrophosphorylase is BLUSP.
(129) In some embodiments, the kinase in the reaction mixture is selected from an N-acetylhexosamine 1-kinase (NahK), a galactokinase (GalK), and a glucuronokinase (GlcAK). In some embodiments, the kinase is selected from NahK_ATCC15697, NahK_ATCC55813, EcGalK, SpGalK, and AtGlcAK. In some embodiments, the kinase is selected from NahK_ATCC15697, NahK_ATCC55813, EcGalK, and AtGlcAK. In some embodiments, the kinase is selected from NahK_ATCC15697, NahK_ATCC55813, and AtGlcAK. In some embodiments, the kinase is EcGalK. In some embodiments, the kinase is NahK_ATCC15697. In some embodiments, the kinase is NahK_ATCC55813. In some embodiments, the kinase is AtGlcAK. In some embodiments, the kinase is NahK_ATCC55813.
(130) In some embodiments, the dehydrogenase in the reaction mixture is UDP-glucose dehydrogenase (Ugd). In some embodiments, the Ugd is PmUgd.
(131) In some embodiments, the UDP-sugar formed in the one-pot reaction mixture is selected from substituted or unsubstituted UDP-GlcNAc, substituted or unsubstituted UDP-Glc, substituted or unsubstituted UDP-GlcA, and substituted or unsubstituted UDP-IdoA. In some embodiments, the UDP-sugar is substituted with at least one moiety selected from an azide, an amine, an N-trifluoroacetyl group, an N-acylamido group, an O-sulfate, and an N-sulfate.
(132) In some embodiments, the reaction mixture further contains a pyrophosphatase. In some embodiments, the pyrophosphatase is PmPpA.
(133) The reaction mixture in the present methods can be formed under any suitable conditions sufficient to prepare an oligosaccharide. The reaction mixture can include, for example, buffering agents to maintain a desired pH, as well as salts and/or detergents to adjust the solubility of the enzymes or other reaction components. In general, the reaction mixture also includes one or more nucleotide triphosphates (NTPs), such as UTP or ATP, that are consumed during sugar phosphorylation and UDP-sugar formation. The reaction mixture can contain a stoichiometric amount of an NTP, with respect to the first sugar, or an excess of the NTP. Divalent metal ions, such as magnesium ions, manganese ions, cobalt ions, or calcium ions, may be required to maintain the catalytic activity of certain enzymes. Enzyme cofactors, including but not limited to nicotinamide adenine dinucleotide (NAD.sup.+), can also be included in the reaction mixture. In some embodiments, the reaction mixture further includes at least one component selected from UTP, ATP, Mn.sup.2+, Co.sup.2+, Ca.sup.2+, and Mg.sup.2+. After the reaction mixture is formed, it is held under conditions that allow for preparation of the oligosaccharide. For example, the reaction mixture can be held at 37 C. for 1 min-72 hr. The reaction mixture can also be held at 25 C. Other temperatures and conditions may be suitable for forming the oligosaccharide, depending on the nature of the sugars and the enzymes used for the synthesis.
(134) Heparin and heparan sulfate (HS) oligosaccharides have particularly important biological, pathological, and therapeutic properties. Heparin and HS are sulfated linear polysaccharides composed of alternating 1-4 linked D-glucosamine (GlcNH.sub.2) residues and 1-4 linked uronic acid residues (-linkage for iduronic acid, IdoA, and -linkage for glucuronic acid, GlcA]. In order to prepare heparin and HS oligosaccharides and their analogs, the methods of the invention can be used to prepare oligosaccharides containing alternating glucosamine and uronic acid residues. The oligosaccharides can contain, for example, alternating GlcNAc residues and GlcA residues. In some embodiments, the oligosaccharide is selected from: GlcNAc-GlcA; GlcA-GlcNAc-GlcA; GlcNAc-GlcA-GlcNAc-GlcA; GlcA-GlcNAc-GlcA-GlcNAc-GlcA; GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA; GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA; GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA; GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA; GlcA-GlcNAc; GlcNAc-GlcA-GlcNAc; GlcA-GlcNAc-GlcA-GlcNAc; GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc; GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc; GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc; GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc; GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc; and GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc-GlcA-GlcNAc. In some embodiments, each GlcA and GlcNAc are optionally independently mono- or multi-substituted with a moiety selected from an azide, an amine, an N-trifluoroacetyl group, an N-acyl group, and an N-sulfate.
(135) Other oligosaccharides can also be prepared using the methods of the invention. Oligosaccharides of arbitrary length can be prepared by repeating the one-pot reaction methods as described above. Accordingly, some embodiments of the invention provide a method for preparing an oligosaccharide as described above, wherein the method is repeated with a second sugar in place of the first sugar and the oligosaccharide in place of the acceptor sugar. In this manner, a variety of products can be prepared. In some embodiments, the oligosaccharides of the present invention can be a compound of any of Formulas II, III, IV, V, or VI.
(136) In some embodiments, the present invention provides a method of preparing an oligosaccharide of formula II:
(137) ##STR00019##
wherein the method includes forming a first reaction mixture containing a first sugar, an acceptor sugar, a glycosyltransferase, a UDP-sugar pyrophosphorylase, and/or one enzyme selected from a kinase and a dehydrogenase. The first sugar is selected from a substituted or unsubstituted N-acetylglucosamine (GlcNAc), a substituted or unsubstituted glucosamine (GlcNH.sub.2), a substituted or unsubstituted glucoronic acid (GlcA), a substituted or unsubstituted iduronic acid (IdoA), and a substituted or unsubstituted glucose-1-phosphate (Glc-1-P), and the acceptor sugar includes at least one member selected from a substituted or unsubstituted N-acetylglucosamine (GlcNAc), a substituted or unsubstituted glucosamine (GlcNH.sub.2), a substituted or unsubstituted glucuronic acid (GlcA), and substituted or unsubstituted iduronic acid (IdoA). The reaction mixture is formed under conditions sufficient to convert the first sugar to a UDP-sugar having a structure of formula I:
(138) ##STR00020##
and sufficient to couple the sugar in the UDP-sugar to the acceptor sugar. The first sugar can have a structure of the formula VII:
(139) ##STR00021##
Each of R.sup.1, R.sup.2, R.sup.3, R.sup.1aR.sup.1b, R.sup.2a, and R.sup.2b is independently selected from OH, N.sub.3, NH.sub.2, NHSO.sub.3.sup., OSO.sub.3.sup., NHC(O)CH.sub.3, NHC(O)CF.sub.3, NHC(O)CH.sub.2OH, or NHC(O)CH.sub.2N.sub.3; each of R.sup.4, R.sup.1c, and R.sup.2c is independently selected from CH.sub.2OH, CO.sub.2.sup., CO.sub.2H, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O) CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3; R includes but not is limited to H, CH.sub.3, CH.sub.2CH.sub.3, CH.sub.2CH.sub.2N.sub.3, CH.sub.2CH.sub.2CH.sub.2N.sub.3, an aglycon according to Formula B, Formula C, Formula D, or Formula E below, substituted or unsubstituted GlcNAc, substituted or unsubstituted GlcNH.sub.2, substituted or unsubstituted GlcA, or substituted or unsubstituted IdoA. When R.sup.4 is CO.sub.2.sup. or CO.sub.2H, then R.sup.2c is CO.sub.2.sup. or CO.sub.2H, and R.sup.1c is selected from CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, and CH.sub.2NHC(O)CH.sub.2N.sub.3. Alternatively, when R.sup.4 is CH.sub.2OH, CH.sub.2N.sub.3, CH.sub.2NH.sub.2, CH.sub.2NHSO.sub.3.sup., CH.sub.2OSO.sub.3.sup., CH.sub.2NHC(O)CH.sub.3, CH.sub.2NHC(O)CF.sub.3, CH.sub.2NHC(O)CH.sub.2OH, or CH.sub.2NHC(O)CH.sub.2N.sub.3, then R.sup.1c is CO.sub.2.sup. or CO.sub.2H, and R.sup.2c is R.sup.4.
(140) ##STR00022##
(141) Heparin and HS generally contain varying levels of sulfated sugar residues. Examples of sulfated sugar residues include, but are not limited to, GlcNS, containing an N-sulfate at the 2 position of glucosamine (GlcNH.sub.2); GlcNS3S, containing an N-sulfate at the 2 position and an O-sulfate at the 3 position of glucosamine (GlcNH.sub.2); GlcNS6S, containing an N-sulfate at the 2 position and an O-sulfate at the 6 position of glucosamine (GlcNH.sub.2); GlcNS3S6S, containing an N-sulfate at the 2 position, an O-sulfate at the 3 position, and an O-sulfate at the 6 position of glucosamine (GlcNH.sub.2); GlcNAc3S, containing an O-sulfate at the 3 position of N-acetylglucosamine (GlcNAc); GlcNAc6S, containing an O-sulfate at the 6 position of N-acetylglucosamine (GlcNAc); GlcNAc3S6S, containing an O-sulfate at the 3 position and an O-sulfate at the 6 position of N-acetylglucosamine (GlcNAc); GlcNH.sub.23S, containing an O-sulfate at the 3 position of glucosamine (GlcNH.sub.2); GlcNH.sub.26S, containing an O-sulfate at the 6 position of glucosamine (GlcNH.sub.2); GlcNH.sub.23S6S, containing an O-sulfate at the 3 position and an O-sulfate at the 6 position of glucosamine (GlcNH.sub.2); GlcA2S, containing an O-sulfate at the 2 position of glucuronic acid (GlcA); and IdoA2S, containing an O-sulfate at the 2 position of iduronic acid (IdoA). Substrate preferences for the methods of the invention will vary depending on the specific enzymes employed in the one-pot reactions. As described above, various substituted and unsubstituted sugars can be used in the methods of the invention.
(142) The present inventors have discovered enzymes that exhibit catalytic activity for a number of natural and non-natural UDP-sugar and acceptor sugar substrates. The oligosaccharides that are prepared using these enzymes can contain functional moieties that can be chemically modified to diversify the structure of the products. For example, azido-sugar residues or trifluoroacetamido-sugar residues can be converted to amino-sugar residues. Azido groups and trifluoracetamos groups can be manipulated independently using orthogonal chemical methods to selectively install desired functionality at specific sites on a given oligosaccharide. Amine-containing oligosaccharides can be further elaborated to form acylamino groups and sulfamate groups. Sulfamate (i.e. N-sulfate) groups, in particular, can be installed to form heparin and HS analogs.
(143) The inventors have discovered that certain oligosaccharides containing N-sulfate groups (where O-sulfate groups would normally be present in heparin and HS) demonstrate inhibitory activity against the binding of fibroblast growth factors (FGFs) to heparin. FGFs, in turn, have a role in regulating a number of processes including angiogenesis, cell proliferation, differentiation, morphogenesis, and wound healing. As such, the invention provides convenient and flexible methods for preparation of oligosaccharides with useful biological activity.
(144) VI. One-Pot Method of Preparing Sialylated Oligosaccharides
(145) The methods described above for preparing oligosaccharides can be further extended by incorporating sialyltransferases that convert the oligosaccharides into sialylated oligosaccharides. Sialyltransferases are the key enzymes that catalyze the transfer of a sialic acid residue from cytidine 5-monophosphate-sialic acid (CMP-sialic acid) to an acceptor. Resulting sialic acid-containing products have been implicated in various biological and pathological processes, including cell-cell recognition, cell growth and differentiation, cancer metastasis, immunological regulation, as well as bacterial and viral infection. Besides being prevalent in mammals, sialyltransferases have been found in some pathogenic bacteria. They are mainly involved in the formation of sialic acid-containing capsular polysaccharides (CPS) and lipooligo(poly)saccharides (LOS/LPS), serving as virulence factors, preventing recognition by host's immune system, and modulating interactions with the environment.
(146) Human Milk Oligosaccharides
(147) Human milk oligosaccharides (HMOs) are a mixture of more than 100 glycans which constitute the third major component of human milk. They have been found to contribute significantly to the gut health of breastfed infants. Strong evidences are available now to support the roles of HMOs on promoting the growth of beneficial gut bacteria; inhibiting the binding of pathogenic bacteria, human immunodeficiency virus (HIV), or protozoan parasites to gut epithelial cells; modulating immune responses; and influencing the functions of gut epithelium.
(148) Among individual HMOs with known functions, disialyllacto-N-tetraose (DSLNT), but not its non-sialylated (LNT) or mono-sialylated (sialyllacto-N-tetraose b or LSTb, with a sialic acid 2-6-linked to an internal glycan) analog, was previously identified as a specific human milk oligosaccharide (HMOs) component that is effective for preventing necrotizing enterocolitis (NEC) in a neonatal rat model. The hexasaccharide is presented at a level of 0.2-0.6 gram in a liter of human milk. However, it is not presented in porcine milk, and either is not presented or exists only in trace amount in bovine milk. Due to the limited availability of human milk and the absence or the low abundance of DSLNT in bovine milk, it is impractical to obtain the compound in large scale for potential clinical therapeutic applications. The present invention provides useful methods for preparing sialylated HMOs and novel sialylated HMO-type oligosaccharides. The methods are based in part on the surprising discovery that Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST) can be used to transfer sialic acid moieties to internal monosaccharide subunits as well as to terminal monosaccharide subunits in complex substrate sugars.
(149) Accordingly, some embodiments of the invention provide a method of preparing a sialylated oligosaccharide having at least two sialic acid moieties. The method includes forming a reaction mixture containing: a substrate sugar; cytidine-5-monophospho-sialic acid (CMP-sialic acid or CMP-Sia) or derivatives; and Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST) under conditions sufficient to form the sialylated oligosaccharide.
(150) Any suitable substrate sugar can be used in the methods of the invention. In some embodiments, the substrate sugar is a monosaccharide. In some embodiments, the substrate sugar is selected from a disaccharide, a trisaccharide, a tetrasaccharide, a pentasaccharide, a hexasaccharide, a heptasaccharide, an octasaccharide, a nonasaccharide, a decasaccharide, an undecasaccharide, a dodecasaccharide, a tridecasaccharide, a tetradecasaccharide, a pentadecasaccharide, and a hexadecasaccharide.
(151) The substrate sugar can contain a variety of monosaccharide subunits. The substrate sugar can contain, for example, one or more moieties selected from substituted or unsubstituted glucose (Glc), substituted or unsubstituted glucose-1-phosphate (Glc-1-P), substituted or unsubstituted glucuronic acid (GlcA), substituted or unsubstituted glucuronic acid-1-phosphate (GlcA-1-P), substituted or unsubstituted iduronic acid (IdoA), substituted or unsubstituted iduronic acid-1-phosphate (IdoA-1-P), substituted or unsubstituted N-acetylglucosamine (GlcNAc), substituted or unsubstituted N-acetylglucosamine-1-phosphate (GlcNAc-1-P), substituted or unsubstituted glucosamine (GlcNH.sub.2), substituted or unsubstituted glucosamine-1-phosphate (GlcNH.sub.2-1-P), substituted or unsubstituted galactose (Gal), substituted or unsubstituted galactose-1-phosphate (Gal-1-P), substituted or unsubstituted galacturonic acid (GalA), substituted or unsubstituted galacturonic acid-1-phosphate (GalA-1-P), substituted or unsubstituted N-acetylgalactosamine (GalNAc), substituted or unsubstituted N-acetylgalactosamine-1-phosphate (GalNAc-1-P), substituted or unsubstituted galactosamine (GalNH.sub.2), substituted or unsubstituted galactosamine-1-phosphate (GalNH.sub.2-1-P), substituted or unsubstituted mannose (Man), substituted or unsubstituted mannose-1-phosphate (Man-1-P), and substituted or unsubstituted N-acetylmannosamine (ManNAc), substituted or unsubstituted N-acetylmannosamine-1-phosphate (ManNAc-1-P), substituted or unsubstituted mannosamine (ManNH.sub.2), substituted or unsubstituted mannosamine-1-phosphate (ManNH.sub.2-1-P), and substituted or unsubstituted 2-keto-3-deoxy-D-glycero-D-galactonononic acid (KDN).
(152) In some embodiments, the substrate sugar contains one or more moieties selected from substituted or unsubstituted galactose (Gal) and substituted or unsubstituted N-acetylgalactosamine (GalNAc).
(153) In some embodiments, the substrate sugar is selected from galactose, lactose, N-acetyllactosamine, Gal1-3GalNAc, Gal1-3GlcNAc, Gal1-3Gal, Gal1-4Gal, Gal1-3Lac, Gal1-4Lac, Gal1-4LacNAc, Gal1-4GlcNAc1-3Gal1-4Glc, Gal1-3GlcNAc1-3Gal1-4Glc, GalNAc1-4Gal1-4Glc, Neu5Ac2-3(GalNAc1-4)Gal1-4Glc, GalNAc1-4GlcA1-3GalNAc1-4GlcA, Gal1-4GlcNAc1-3Gal1-4GlcNAc, GlcNAc1-3Gal1-4GlcNAc1-3Gal, and Gal1-9KDN.
(154) In some embodiments, the substrate sugar is prepared by any of the methods for preparing oligosaccharides described above.
(155) Sialic acid is a general term for N- and O-substituted derivatives of neuraminic acid, and includes, but is not limited to, 5-hydroxyl (Kdn), N-acetyl (Neu5Ac), or N-glycolyl (Neu5Gc) derivatives, as well as O-acetyl, O-lactyl, O-methyl, O-sulfate and O-phosphate derivatives. In some embodiments, the sialic acid can be a compound of the formula:
(156) ##STR00023##
wherein R.sup.1 is selected from H, OH, N.sub.3, NHC(O)Me, NHC(O)CH.sub.2OH, NHC(O)CH.sub.2N.sub.3, NHC(O)OCH.sub.2CCH.sub.2, NHC(O)OCHCCH, NHC(O)CH.sub.2F, NHC(O)CH.sub.2NHCbz, NHC(O)CH.sub.2OC(O)Me, and NHC(O)CH.sub.2OBn; and R.sup.2, R.sup.3, and R.sup.4 are independently selected from H, OH, N.sub.3, OMe, F, OSO.sub.3.sup., OPO.sub.3H.sup., and OC(O)Me. In some embodiments, the CMP-sialic acid is cytidine 5-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac) or a CMP-Neu5Ac analog. Other sialic acid forms are useful in the methods of the present invention. In some embodiments, the sialic acid can be a compound of the formula:
(157) ##STR00024##
In some embodiments, the sialic acid can be a compound of the formula:
(158) ##STR00025##
(159) The CMP-sialic acid can be prepared prior to preparation of the oligosaccharide, or prepared in situ immediately prior to preparation of the oligosaccharide. In some embodiments, the method of the present invention also includes forming a reaction mixture including a CMP-sialic acid synthetase, cytidine 5-triphosphate, and N-acetylneuraminic acid (Neu5Ac) or a Neu5Ac analog, under conditions suitable to form CMP-Neu5Ac or a CMP-Neu5Ac analog. Any suitable CMP-sialic acid synthetase (i.e., N-acylneuraminate cytidylyltransferase, EC 2.7.7.43) can be used in the methods of the invention. For example, CMP-sialic acid synthetases from E. coli, C. thermocellum, S. agalactiae, or N. meningitidis can be used. In some embodiments, the step of forming the CMP-sialic acid and the step of forming the sialylated oligosaccharide are performed in one pot.
(160) In some embodiments, the sialic acid moiety of the CMP-sialic acid is prepared separately prior to use in the methods of the present invention. Alternatively, the sialic acid moiety can be prepared in situ immediately prior to use in the methods of the present invention. In some embodiments, the method also includes forming a reaction mixture including a sialic acid aldolase, pyruvic acid or derivatives thereof, and N-acetylmannosamine or derivatives thereof, under conditions suitable to form Neu5Ac or a Neu5Ac analog. Any suitable sialic acid aldolase (i.e., N-Acetylneuraminate pyruvate lyase, EC 4.1.3.3) can be used in the methods of the invention. For example, sialic acid aldolases from E. coli, L. plantarum, P. multocida, or N. meningitidis can be used. In some embodiments, the step of forming the sialic acid moiety, the step of forming the CMP-sialic acid, and the step of forming the sialylated oligosaccharide are performed in one pot.
(161) In some embodiments, the CMP-sialic acid is prepared by a process including: i) forming a reaction mixture containing a CMP-sialic acid synthetase, cytidine triphosphate, and sialic acid (Sia) under conditions sufficient to form the CMP-sialic acid.
(162) In some embodiments, the sialic acid is prepared by a processing including: ii) forming a reaction mixture containing a sialic acid aldolase, pyruvic acid or a salt thereof, and N-acetylmannosamine or derivatives under conditions sufficient to form the sialic acid.
(163) In some embodiments, steps i) and ii) are conducted in one pot.
(164) In some embodiments, the sialylated oligosaccharide has a structure according to Formula 1:
(165) ##STR00026##
wherein each of A, B, C, and D is a monosaccharide moiety independently selected from Gal, GalNAc, Glc, GlcNAc, GlcA, and KDN; each R is a sialic acid moiety; each of subscripts q, r, and s is independently selected from 0 and 1; and each of subscripts u, v, w, x, y, and z is selected from 0 and 1, and the sum of subscripts u, v, w, x, y, and z is equal to 2.
(166) In some embodiments, A is independently selected from Gal, GalNAc, and GlcNAc; B is independently selected from Gal, GalNAc, Glc, GlcNAc, GlcA, and KDN; C is independently selected from Gal, GalNAc, Glc, and GlcNAc; and D is independently selected from Gal, Glc, GlcNAc, and GlcA.
(167) In some embodiments, A is Gal; and each of subscripts q, r, and s is 0.
(168) In some embodiments, the moiety A-B is selected from Gal1-4Glc, Gal1-4GlcNAc, Gal1-3GalNAc, Gal1-3GlcNAc, Gal1-3Gal, Gal1-4Gal, and Gal1-9KDN; subscript q is 1; and each of subscripts r and s is 0.
(169) In some embodiments, the moiety A-B-C is selected from Gal1-3Gal1-4Glc, Gal1-4Gal1-4Glc, Gal1-4Gal1-4GlcNAc, GalNAc1-4Gal1-4Glc, and GalNAc1-4Gal1-4Glc; each of subscripts q and r is 1; and subscript s is 0.
(170) In some embodiments, the moiety A-B-C-D is selected from Gal1-4GlcNAc-3Gal1-4Glc, Gal1-3GlcNAc1-3Gal1-4Glc, GalNAc1-4GlcA1-3GalNAc1-4GlcA, Gal1-4GlcNAc1-3Gal1-4GlcNAc, and GlcNAc1-3Gal1-4GlcNAc1-3Gal; and each of subscripts q, r, and s is 1.
(171) In some embodiments, each R is independently selected from an 2-3 linked Neu5Ac moiety, an 2-6 linked Neu5Ac moiety, and an 2-8 linked Neu5Ac moiety.
(172) In some embodiments, the sialylated oligosaccharide is selected from: Neu5Ac2-3(Neu5Ac2-6)Gal1-4GlcNAc; Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc; Neu5Ac2-6Gal1-4(Neu5Ac2-6) Gal1-4GlcNAc; Neu5Ac2-6Gal1-3GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc; Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4GlcNAc; GlcNAc1-3(Neu5Ac2-6)Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal; Neu5Ac2-6GalNAc1-4GlcA1-3(Neu5Ac2-6)GalNAc1-4GlcA; Neu5Ac2-3(Neu5Ac2-6)Gal; Neu5Ac2-3(Neu5Ac2-6)Gal1-4Glc; Neu5Ac2-8Neu5Ac2-3Gal1-4Glc; Neu5Ac2-8Neu5Ac2-6Gal1-4Glc; Neu5Ac2-3(Neu5Ac2-6)Gal1-3GalNAc; Neu5Ac2-6Gal1-3(Neu5Ac2-6)GalNAc; Neu5Ac2-3Gal1-3(Neu5Ac2-6)GalNAc; Neu5Ac2-3(Neu5Ac2-6)Gal1-3GlcNAc; Neu5Ac2-6Gal1-3(Neu5Ac2-6)Gal; Neu5Ac2-6Gal1-4(Neu5Ac2-6)Gal; Neu5Ac2-6Gal1-3(Neu5Ac2-6) Gal1-4Glc; Neu5Ac2-6Gal1-4(Neu5Ac2-6) Gal1-4Glc; Neu5Ac2-6GalNAc1-4(Neu5Ac2-6)Gal1-4Glc; Neu5Ac2-3GalNAc1-4(Neu5Ac2-6)Gal1-4Glc; and Neu5Ac2-3(Neu5Ac2-6)Gal1-9KDN.
(173) The methods of the invention include forming reaction mixtures that contain Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST). The Pd2,6ST can be, for example, purified prior to addition to the reaction mixture or secreted by a cell present in the reaction mixture. Alternatively, the Pd2,6ST can catalyze the reaction within a cell expressing the enzyme.
(174) Reaction mixtures can contain additional reagents for use in glycosylation techniques. For example, in certain embodiments, the reaction mixtures can contain buffers (e.g., 2-(N-morpholino)ethanesulfonic acid (MES), 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid (HEPES), 3-morpholinopropane-1-sulfonic acid (MOPS), 2-amino-2-hydroxymethyl-propane-1,3-diol (TRIS), potassium phosphate, sodium phosphate, phosphate-buffered saline, sodium citrate, sodium acetate, and sodium borate), cosolvents (e.g., dimethylsulfoxide, dimethylformamide, ethanol, methanol, tetrahydrofuran, acetone, and acetic acid), salts (e.g., NaCl, KCl, CaCl.sub.2, and salts of Mn.sup.2+ and Mg.sup.2+), chelators (e.g., ethylene glycol-bis(2-aminoethylether)-N,N,N,N-tetraacetic acid (EGTA), 2-({2-[Bis(carboxymethyl)amino]ethyl}(carboxymethyl)amino)acetic acid (EDTA), and 1,2-bis(o-aminophenoxy)ethane-N,N,N,N-tetraacetic acid (BAPTA)), reducing agents (e.g., dithiothreitol (DTT), -mercaptoethanol (BME), and tris(2-carboxyethyl)phosphine (TCEP)), and labels (e.g., fluorophores, radiolabels, and spin labels). Buffers, cosolvents, salts, chelators, reducing agents, and labels can be used at any suitable concentration, which can be readily determined by one of skill in the art. In general, buffers, cosolvents, salts, chelators, reducing agents, and labels are included in reaction mixtures at concentrations ranging from about 1 M to about 1 M. For example, a buffer, a cosolvent, a salt, a chelator, a reducing agent, or a label can be included in a reaction mixture at a concentration of about 1 M, or about 10 M, or about 100 M, or about 1 mM, or about 10 mM, or about 25 mM, or about 50 mM, or about 100 mM, or about 250 mM, or about 500 mM, or about 1 M.
(175) Reactions are conducted under conditions sufficient to form the sialylated oligosaccharide. Generally, the conditions are sufficient to transfer the sialic acid from the CMP-sialic acid to the substrate sugar. The reactions can be conducted at any suitable temperature. In general, the reactions are conducted at a temperature of from about 4 C. to about 40 C. The reactions can be conducted, for example, at about 25 C. or about 37 C. The reactions can be conducted at any suitable pH. In general, the reactions are conducted at a pH of from about 5.5 to about 10. The reactions can be conducted, for example, at a pH of from about 6.5 to about 9. The reactions can be conducted for any suitable length of time. In general, the reaction mixtures are incubated under suitable conditions for anywhere between about 1 minute and several hours. The reactions can be conducted, for example, for about 1 minute, or about 5 minutes, or about 10 minutes, or about 30 minutes, or about 1 hour, or about 2 hours, or about 4 hours, or about 8 hours, or about 12 hours, or about 24 hours, or about 48 hours, or about 72 hours. Other reaction conditions can be employed in the methods of the invention, depending on the identity of the particular CMP-sialic acid or substrate sugar. Additional aspects of sialylation reactions are described in WO 2013/022836, WO 2013/070677, and US 2013/0196385, the entirety of which publications are encorporated herein by reference in their entirety.
(176) In a related aspect, the invention provides a sialylated oligosaccharide prepared according to any of the methods described herein. In certain embodiments, the invention provides novel sialylated saccharides. In some embodiments, the sialylated oligosaccharide is selected from: Neu5Ac2-3(Neu5Ac2-6)Gal1-4Glc; Neu5Ac2-8Neu5Ac2-3Gal1-4Glc; Neu5Ac2-3(Neu5Ac2-6)Gal1-3GalNAc; Neu5Ac2-3(Neu5Ac2-6)Gal1-3GalNAc; Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc (DSLNnT); Neu5Ac2-6Gal1-3GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc; and Neu5Ac2-3(Neu5Ac2-6)Gal1-9KDN.
(177) In some embodiments, the sialylated oligosaccharide is selected from: Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc; and Neu5Ac2-6Gal1-3GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc
(178) In some embodiments, the sialylated oligosaccharide is Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc.
(179) VII. Methods for Treating Necrotizing Enterocolitis
(180) In another aspect, the invention provides a method for treating necrotizing enterocolitis (NEC). The method includes administering to a subject in need thereof a sialylated oligosaccharide of the invention.
(181) Necrotizing enterocolitis refers to a condition most often observed in very young infants, newborn infants, and prematurely-born infants. Possible causes include decreased blood flow to the bowel and reduced production of protective mucus, as well as bacteria in the intestine. NEC is considered to be the most serious gastrointestinal disorder among preterm infants.
(182) The sialylated oligosaccharides can be administered at any suitable dose in the methods of the invention. In general, the sialylated oligosaccharides are administered at a dose ranging from about 1 microgram to about 1000 milligrams per kilogram of a subject's body weight (i.e., about 1 g/kg-1000 mg/kg). The dose of a sialylated oligosaccharide can be, for example, about 1 g/kg-1 mg/kg, or about 1-500 g/kg, or about 25-250 g/kg, or about 50-100 g/kg. The dose of a sialylated oligosaccharide can be about 0.1-1000 mg/kg, or about 1-500 mg/kg, or about 25-250 mg/kg, or about 50-100 mg/kg. The dose of the sialylated oliogsacharide can be about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, or 950 g/kg. The dose of the sialylated oliogsacharide can be about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 mg/kg.
(183) The dosages can be varied depending upon the requirements of the subject, the severity of the disorder being treated, and the particular formulation being administered. The dose administered to a subject should be sufficient to result in a beneficial therapeutic response in the subject. In certain instances, the dose administered to a subject will be sufficient to prevent the occurrence of NEC in the subject. The size of the dose will also be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of the compound in a particular subject. Determination of the proper dosage for a particular situation is within the skill of the typical practitioner. Those of skill in the art are aware of the routine experimentation that will produce an appropriate dosage range for a subject in need of treatment by oral administration or any other method of administration of a compound, e.g., intravenous administration or parenteral administration, for example. Those of skill are also aware that results provided by in vitro or in vivo experimental models can be used to extrapolate approximate dosages for a subject in need of treatment. The total dosage can be divided and administered in portions over a period of time suitable to treat NEC.
(184) Administration of a sialylated oligosaccharide can be conducted for a period of time which will vary depending upon the nature of the particular disorder, its severity and the overall condition of the subject. Administration can be conducted, for example, hourly, every 2 hours, three hours, four hours, six hours, eight hours, or twice daily including every 12 hours, or any intervening interval thereof. Administration can be conducted once daily, or once every 36 hours or 48 hours. Following treatment, a subject can be monitored for changes in his or her condition and for alleviation of the symptoms of the disorder. The dosage of the sialylated oligosaccharide can either be increased in the event the subject does not respond significantly to a particular dosage level, or the dose can be decreased if an alleviation of the symptoms of the disorder is observed, or if the disorder has been ablated, or if unacceptable side effects are seen with a particular dosage.
(185) In a related aspect, the invention provides pharmaceutical compositions for the administration of the sialylated oligosaccharides. The pharmaceutical compositions can be prepared by any of the methods well known in the art of pharmacy and drug delivery. In general, methods of preparing the compositions include the step of bringing the active ingredient into association with a carrier containing one or more accessory ingredients. The pharmaceutical compositions are typically prepared by uniformly and intimately bringing the active ingredient into association with a liquid carrier or a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation. The compositions can be conveniently prepared and/or packaged in unit dosage form.
(186) Pharmaceutical compositions containing the sialylated oligosaccharides can be in a form suitable for oral use. Suitable compositions for oral administration include, but are not limited to, tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, syrups, elixirs, solutions, buccal patches, oral gels, chewable tablets, and the like. Compositions for oral administration can be formulated according to any method known to those of skill in the art. Such compositions can contain one or more agents selected from sweetening agents, flavoring agents, coloring agents, antioxidants, and preserving agents in order to provide pharmaceutically elegant and palatable preparations. The sialylated oligosaccharides can be added, for example, to human milk, bovine milk, or infant formula.
(187) Tablets generally contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients, including: inert diluents, such as cellulose, silicon dioxide, aluminum oxide, calcium carbonate, sodium carbonate, glucose, mannitol, sorbitol, lactose, calcium phosphate, and sodium phosphate; granulating and disintegrating agents, such as corn starch and alginic acid; binding agents, such as polyvinylpyrrolidone (PVP), cellulose, polyethylene glycol (PEG), starch, gelatin, and acacia; and lubricating agents such as magnesium stearate, stearic acid, and talc. The tablets can be uncoated or coated, enterically or otherwise, by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate can be employed. Tablets can also be coated with a semi-permeable membrane and optional polymeric osmogents according to known techniques to form osmotic pump compositions for controlled release.
(188) The pharmaceutical compositions can be in the form of a sterile injectable aqueous or oleaginous solutions and suspensions. Sterile injectable preparations can be formulated using non-toxic parenterally-acceptable vehicles including water, Ringer's solution, and isotonic sodium chloride solution, and acceptable solvents such as 1,3-butane diol. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables.
(189) Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions. Such excipients include, but are not limited to: suspending agents such as sodium carboxymethylcellulose, methylcellulose, oleagino-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents such as lecithin, polyoxyethylene stearate, and polyethylene sorbitan monooleate; and preservatives such as ethyl, n-propyl, and p-hydroxybenzoate.
(190) Oily suspensions can be formulated by suspending the active ingredient in a vegetable oil, for example, arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin. The oily suspensions can contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. These compositions can be preserved by the addition of an anti-oxidant such as ascorbic acid.
(191) Dispersible powders and granules (suitable for preparation of an aqueous suspension by the addition of water) can contain the active ingredient in admixture with a dispersing agent, wetting agent, suspending agent, or combinations thereof. Additional excipients can also be present.
(192) The pharmaceutical compositions of the invention can also be in the form of oil-in-water emulsions. The oily phase can be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these. Suitable emulsifying agents can be naturally-occurring gums, such as gum acacia or gum tragacanth; naturally-occurring phospholipids, such as soy lecithin; esters or partial esters derived from fatty acids and hexitol anhydrides, such as sorbitan monooleate; and condensation products of said partial esters with ethylene oxide, such as polyoxyethylene sorbitan monooleate.
(193) Compositions for oral administration can be formulated as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent (such as calcium carbonate, calcium phosphate, or kaolin), or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium (such as peanut oil, liquid paraffin, or olive oil).
(194) Transdermal delivery of the sialylate oligosaccharides can be accomplished by means of iontophoretic patches and the like. The compounds can also be administered in the form of suppositories for rectal administration. These compositions can be prepared by mixing the compound with a suitable non-irritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the compound. Such materials include cocoa butter and polyethylene glycols.
(195) VIII. Examples
Example 1
Enzymes
(196) NahK_ATCC15697 and NahK_ATCC55813N-Acetylhexosamine 1-Kinases
(197) NahK (EC 2.7.1.162) catalyzes the direct addition of a phosphate from adenosine 5-triphophate (ATP) to the anomeric position of N-acetylhexosamine for the formation of N-acetylhexosamine-1-phosphate and adenosine 5-diphophate (ADP). The only characterized NahK to date is encoded by the lnpB gene in the lnpABCD operon of Bifidobacterium longum JCM1217. Herein we report the cloning and characterization of two new NahKs from Bifidobacterium infantis (ATCC15697) and Bifidobacterium longum (ATCC55813), respectively. A new capillary electrophoresis-based assay method has been developed for biochemical characterization of NahKs. We found that in addition to previously reported NahK substrates, various GlcNAc derivatives including those with C2-azido, C6-azido, and 6-O-sulfate groups are tolerable substrates for the newly cloned NahKs. In addition, despite of their low activities toward glucose and galactose, the activities of both NahKs are much higher for mannose and some of its C-2, C-4, and C-6 derivatives including 2-deoxy-mannose or 2-deoxy-glucose.
(198) Experimental
(199) Bacterial strains, plasmids, and materials. Electrocompetent DH5 and chemically competent BL21 (DE3) E. coli cells were from Invitrogen (Carlsbad, Calif.). Bifidobacterium longum Reuter ATCC#55813 was from American Type Culture Collection (ATCC, Manassas, Va.). Genomic DNA of Bifidobacterium longum subsp. infantis (ATCC#15697) was a kind gift from Professor David Mills (University of California, Davis). Vector plasmid pET22b(+) was from Novagen (EMD Biosciences Inc. Madison, Wis.). Ni.sup.2+-NTA agarose (nickel-nitrilotriacetic acid agarose), QIAprep spin miniprep kit, and QIAEX II gel extraction kit were from Qiagen (Valencia, Calif.). Herculase-enhanced DNA polymerase was from Stratagene (La Jolla, Calif.). T4 DNA ligase and 1 kb DNA ladder were from Promega (Madison, Wis.). NdeI and XhoI restriction enzymes were from New England Biolabs Inc. (Beverly, Mass.). Adenosine-5-triphosphate disodium salt (ATP), GlcNAc, and GalNAc were from Sigma (St. Louis, Mo.). GlcNAc, GalNAc, mannose, and ManNAc derivatives were synthesized according to reported procedures.
(200) Cloning. NahK_ATCC15697 and NahK_ATCC55813 were each cloned as a C-His.sub.6-tagged (SEQ ID NO: 22) fusion protein in pET22b(+) vector using genomic DNAs of Bifidobacterium longum subsp. infantis ATCC#15697 and Bifidobacterium longum ATCC#55813, respectively, as the template for polymerase chain reactions (PCR). The primers used for NahK_ATCC15697 were: forward primer 5 ACCCCATATGAACAACACCAATGAAGCCCTG 3 (SEQ ID NO: 23)(NdeI restriction site is underlined) and reverse primer 5 TGACCTCGAGCTTGGTCGTCTCCATGACGTCG 3(SEQ ID NO: 24) (XhoI restriction site is underlined). The primers used for NahK_ATCC55813 were: forward primer 5 ACCCCATATGACCGAAAGCAATGAAGTTTTATTC 3 (SEQ ID NO: 25) (NdeI restriction site is underlined) and reverse primer 5 TGACCTCGAGCCTGGCAGCCTCCATGATG 3 (SEQ ID NO: 26) (XhoI restriction site is underlined). PCR was performed in a 50 L reaction mixture containing genomic DNA (1 fig), forward and reverse primers (1 M each), 10 Herculase buffer (5 dNTP mixture (1 mM), and 5 U (1 M) of Herculase-enhanced DNA polymerase. The reaction mixture was subjected to 35 cycles of amplification with an annealing temperature of 52 C. The resulting PCR product was purified and digested with NdeI and XhoI restriction enzymes. The purified and digested PCR product was ligated with predigested pET22b(+) vector and transformed into electrocompetent E. coli DH5 cells. Selected clones were grown for minipreps and characterization by restriction mapping and DNA sequencing performed by Davis Sequencing Facility at the University of California-Davis.
(201) Expression and purification. Positive plasmids were selected and transformed into BL21(DE3) chemically competent cells. The plasmid-bearing E. coli cells were cultured in LB rich medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) supplied with ampicillin (100 g/mL). Overexpression of the target protein was achieved by inducing the E. coli culture with 0.1 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) when the OD.sub.600 nm of the culture reaches 0.8-1.0 followed by incubation at 20 C. for 24 h with vigorous shaking at 250 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, N.J.). To obtain the cell lysate, cells were harvested by centrifuge cell culture at 4000 g for 2 h. The cell pellet was re-suspended in lysis buffer (pH 8.0, 100 mM Tris-HCl containing 0.1% Triton X-100, 20 mL/L cell culture) containing lysozyme (100 g/mL) and DNaseI (3 g/mL). After incubating at 37 C. for 60 min with vigorous shaking (250 rpm), the lysate was collected by centrifugation at 12,000 g for 30 min. His.sub.6-tagged (SEQ ID NO: 22) target proteins were purified from cell lysate using an KTA FPLC system (GE Healthcare, Piscataway, N.J., USA). To do this, the lysate was loaded to a HisTrap FF 5 mL column (GE Healthcare) pre-washed and equilibrated with binding buffer (0.5 M NaCl, 20 mM Tris-HCl, pH 7.5). The column was then washed with 8 volumes of binding buffer, 10 volumes of washing buffer (10 mM imidazole, 0.5 M NaCl, 20 mM Tris-HCl, pH 7.5) and eluted with 8 volumes of elute buffer (200 mM imidazole, 0.5 M NaCl, 20 mM Tris-HCl, pH 7.5). Fractions containing the purified enzyme were combined and dialyzed against dialysis buffer (Tris-HCl containing 10% glycerol, pH 7.5, 20 mM) and stored at 4 C.
(202) Quantification of purified protein. Protein concentration was determined in a 96-well plate using a Bicinchoninic Acid (BCA) Protein Assay Kit (Pierce Biotechnology, Rockford, Ill.) with bovine serum albumin as a protein standard. The absorbance of each sample was measured at 562 nm by a BioTek Synergy HT Multi-Mode Microplate Reader.
(203) pH Profile by capillary electrophoresis (CE) assays. Typical enzymatic assays were performed in a 20 L reaction mixture containing a buffer (200 mM) with a pH in the range of 6.0-11.0, GlcNAc (1 mM), ATP (1 mM), MgCl.sub.2 (5 mM), and a NahK (0.75 M). Buffers used were: MES, pH 6.0; Tris-HCl, pH 7.0-9.0; CAPS, pH 10.0-11.0. Reactions were allowed to proceed for 10 min at 37 C. and were stopped by adding 20 L of cold ethanol to each reaction mixture. Samples were centrifuged and the supernatants were analyzed by a P/ACE Capillary Electrophoresis (CE) system equipped with a Photodiode Array (PDA) detector (Beckman Coulter, Inc., Fullerton, Calif.). CE conditions were as follows: 75 m i.d. capillary, 25 KV/80, 5 s vacuum injections, monitored at 254 nm, the running buffer used was sodium tetraborate (25 mM, pH 10.0).
(204) Effect of MgCl.sub.2 on the enzymatic activity. Different concentrations of MgCl.sub.2 were used in a Tris-HCl buffer (pH 8.0, 200 mM) containing GlcNAc (1 mM), ATP (1 mM), and a NahK (0.75 M). Reactions were allowed to proceed for 10 min at 37 C. Reaction without MgCl.sub.2 was used as a control.
(205) Substrates specificity assays. GlcNAc, GalNAc, and their derivatives (1 mM) were used as substrates in the presence of ATP (1 mM) and MgCl.sub.2 (5 mM) in a Tris-HCl buffer (pH 8.0, 200 mM) to analyze the substrate specificity of NahKs. Two concentrations (0.75 M or 15 M) of each NahK were used and the reactions were allowed to proceed for 10 min (for 0.75 M NahK) or 30 min (for 15 M NahK) at 37 C. For substrate specificity studies of Glc, Gal, mannose, ManNAc, and their derivatives, 15 M of NahK was used for each reaction and the reactions were carried out at 37 C. for 30 min. All other conditions were the same as for GlcNAc, GalNAc, and their derivatives.
(206) Kinetics by CE assays. Reactions were carried out in duplicate at 37 C. for 10 min in a total volume of 20 L in Tris-HCl buffer (200 mM, pH 7.5) containing MgCl.sub.2 (1 mM), ATP, GlcNAc or GalNAc, and NahK (0.25 M when GlcNAc and ATP were used as substrates, 0.5 M when GalNAc and ATP were used as substrates). Apparent kinetic parameters were obtained by varying the ATP concentration from 0.1-5.0 mM (0.1 mM, 0.2 mM, 0.4 mM, 1 mM, 2 mM, and 5 mM) at a fixed concentration of GlcNAc or GalNAc (1 mM), or varying the concentration of GlcNAc or GalNAc (0.1 mM, 0.2 mM, 0.4 mM, 1 mM, 2 mM, and 5 mM) at a fixed concentration of ATP (1 mM) and fitting the data to the Michaelis-Menten equation using Grafit 5.0.
(207) Results and Discussion
(208) Cloning, expression, and purification. NahKs from Bifidobacterium infantis ATCC#15697 (NahK_ATCC15697) and Bifidobacterium longum ATCC#55813 (NahK_ATCC55813) were each cloned as a C-His.sub.6-tagged (SEQ ID NO: 22) fusion protein in a pET22b(+) vector. Sequence alignment (
(209) Both NahKs were expressed by induction with 0.1 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) followed by incubation at 20 C. for 24 h with vigorous shaking (250 rpm). Up to 180 mg and 185 mg of Ni.sup.2+-column purified NahK_ATCC15697 and NahK_ATCC55813, respectively, could be obtained from one liter of E. coli culture. SDS-PAGE analysis shows that both purified proteins migrated to around 41 kDa, matching well to the calculated molecular weights of the translated His.sub.6-tagged (SEQ ID NO: 22) fusion proteins of 41.4 and 40.9 kDa for NahK_ATCC15697 and NahK_ATCC55813, respectively.
(210) Capillary electrophoresis (CE) assays. Based on the detection of ADP and ATP in the reaction mixture by a UV detector, a capillary electrophoresis-based method was developed to directly measure the formation of ADP and N-acetylhexosamine-1-phosphate from ATP and N-acetylhexosamine for characterizing the activities of NahKs. Both ATP and ADP gave absorbance at 254 nm with equal signal responses.
(211) pH profile. As shown in
(212) Effect of MgCl.sub.2. Similar to NahK_JCM1217 and other kinases, both NahK_ATCC15697 and NahK_ATCC55813 require a divalent metal ion for activity. As shown in
(213) Kinetics. The apparent kinetic parameters shown in Table 1 indicate that the activities of two NahKs are close, with NahK_ATCC55813 having 16% or 39% higher activity than NahK_ATCC15697 when GlcNAc or GalNAc was used as the substrate in the presence of ATP. Overall, GlcNAc is a more efficient (3.1-fold for NahK_ATCC15697 and 2.6-fold for NahK_ATCC55813) substrate than GalNAc for both NahKs due to relatively lower K.sub.m values and higher (2-fold) k.sub.cat values obtained when GlcNAc was used. Using ATP and GlcNAc as the substrates, the K.sub.m values of ATP (0.100.03 mM and 0.110.03 mM) and GlcNAc (0.060.01 mM) for both NahKs are lower than those for NahK_JCM1217 (0.172 mM for ATP and 0.118 mM for GlcNAc) determined by high performance ion chromatography (HPIC) with a pulsed amperometric detector (DX500, Dionex Corporation, Sunnyvale, Calif.) using a Dionex CarboPac PA1 column (4 mm250 mm). The discrepancies of the parameters may be due to the differences in the assay conditions used.
(214) TABLE-US-00001 TABLE 1 Apparent kinetic parameters of NahKs. Enzymes NahK1_ATCC15697 NahK_ATCC55813 K.sub.m k.sub.cat k.sub.cat/K.sub.m K.sub.m k.sub.cat k.sub.cat/K.sub.m Substrate (mM) (s.sup.1) (s.sup.1 mM.sup.1) (mM) (s.sup.1) (s.sup.1 mM.sup.1) ATP.sup.a 0.10 0.03 1.1 0.1 11.0 0.11 0.03 1.3 0.1 11.8 GlcNAc 0.06 0.01 0.95 0.01 15.8 0.06 0.01 1.1 0.1 18.3 ATP.sup.b 0.08 0.03 0.38 0.02 4.8 0.06 0.02 0.48 0.03 8.0 GalNAc 0.09 0.05 0.46 0.07 5.1 0.08 0.03 0.57 0.04 7.1 .sup.aThe other substrate is GlcNAc; .sup.bThe other substrate is GalNAc.
(215) Substrate specificity. The substrate specificity studies using GlcNAc, GalNAc, and their derivatives (Table 2) indicate that both NahKs exhibit promiscuous substrate specificity and have comparable levels of activity toward GlcNAc and GalNAc derivatives. Compared to NahK_ATCC15697, NahK_ATCC55813 is more reactive towards non-modified GlcNAc (T2-1), GalNAc (T2-11), and some of their C2-modified derivatives with an N-trifluoroacetyl (GlcNTFA T2-2 and GalNTFA T2-12), an N-azidoacetyl group (GlcNAcN.sub.3 T2-3 and GalNAcN.sub.3 T2-13), or an N-butanoyl group (GlcNBu T2-4 and GalNBu T2-14). Nevertheless, NahK_ATCC15697 is more reactive than NahK_ATCC55813 for some of C2-modified GlcNAc and GalNAc derivatives such as those with a bulky N-benzoyl group (GlcNBz T2-5 and GalNBz T2-15) and a C2-azido group (GlcN.sub.3 T2-6 and GalN.sub.3 T2-16). NahK_ATCC15697 is also more reactive towards 2-amino-2-deoxy-glucose (GlcNH.sub.2 T2-7), 2-N-sulfo-glucose (GlcNS T2-8), as well as C6-modified GlcNAc derivatives such as 6-deoxy-GlcNAc (GlcNAc6Me T2-9), 6-azido-6-deoxy-GlcNAc (GlcNAc6N.sub.3 T2-10), and 6-O-sulfo-GlcNAc (GlcNAc6S T2-17). Both C2 and C6-modified derivatives GlcNAc such as 6-O-sulfo-N-trifluoroacetyl glucosamine (GlcNTFA6S T2-18) and 6-O-sulfo-2-azido-2-deoxy glucose (GlcN.sub.3 T2-19) as well as both C2 and C3-modified GlcNAc derivative 3-O-sulfo-2-azido-2-deoxy glucose (GlcN.sub.33S T2-20) are poor but acceptable substrates for both enzymes. Overall, some of the C2-modified GlcNAc and GalNAc (T2-1 T2-5 and T2-11 T2-14) are relatively good substrates for both NahKs with yields varied from 5.2-42.3% in a 10 min reaction containing 0.75 M of enzyme. In comparison, other C2-modified GlcNAc and GalNAc (T2-6 T2-8, 15, T2-16), C6-(T2-9, T2-10, T2-17), both C2- and C6-(T2-18, T2-19), as well as both C2- and C3-modified GlcNAc (T2-20) derivatives are poor but tolerable substrates for both NahKs and the assays have to be carried out for a longer reaction time (30 min) with a 20-fold higher concentration (15 M) of enzyme.
(216) TABLE-US-00002 TABLE 2 Substrate specificity of NahKs using GlcNAc, GalNAc, and their derivatives. Percentage Conversion (%) NahK_ATCC15697 NahK_ATCC55813 .sup.a0.75 M .sup.b15 M .sup.a0.75 M .sup.b15 M
(217) Among twenty compounds of GlcNAc, GalNAc and their derivatives tested, compounds T2-1, T2-3T2-5, T2-9T2-11, T2-13T2-15 have been reported before as suitable substrates for NahK_JCM1217 [11-12], while other compounds including T2-2, T2-6T2-8, T2-12, and T2-16T2-20 are newly identified substrates for NahKs. It is worth to note that some of these compounds have negatively charged O-sulfate group at different positions of GlcNAc or its derivatives.
(218) Quite interestingly, the substrate specificity studies using glucose (Glc T3-21), galactose (Gal T3-28), mannose (Man T3-23), N-acetylmannosamine (ManNAc T3-29), and derivatives of mannose and ManNAc (Table 3) indicate that while both Glc (T3-21) and Gal (T3-28) are poor substrates for both NahKs, 2-deoxy glucose (2-deoxyGlc T3-22) or 2-deoxymannose is a better substrate. In addition, mannose (T3-23), its 2-fluoro-(2F-Man T3-24) and 2-azido-(2N.sub.3-Man T3-26) derivatives, as well as its 4-deoxy (4-deoxyMan T3-27) derivative are relatively good substrates. In comparison, 2-methyl modification of mannose (2Me-Man T3-25) decreases its tolerance as the substrate for both NahKs. Quite surprisingly, while ManNAc (T3-29) and some of its C-2 derivatives (T3-30T3-32) are poor substrates for the NahKs, N-azidoacetylmannosamine (ManNAcN.sub.3 T3-33, a C2-derivative of ManNAc) and its C6-derivative N-acetyl-6-O-methylmannosamine (ManNAc6OMe T3-34) are better substrates for both NahKs. Overall, except for 2-fluoro-mannose (2F-Man T3-24), NahK_ATCC15697 shows higher activity than NahK_ATCC55813 for mannose, ManNAc, and their derivatives.
(219) TABLE-US-00003 TABLE 3 Substrate specificity of NahKs using Glc, Gal, Man, ManNAc, and their derivatives. Percentage Conversion (%) Substrates NahK_ATCC15697 NahK_ATCC55813
The concentration of the enzyme used was 15 Reactions were allowed to proceed at 37 C. for 30 min.
AtGlcAKArabidopsis thaliana Glucuronokinase (EC 2.7.1.43)
Experimental
(220) Cloning, expression, and purification. Full length Arabidopsis thaliana glucuronokinase (EC 2.7.1.43) (AtGlcAK) (encoded by gene GlcAK1, DNA GenBank accession number: GU599900; protein GenBank accession number: NP 566144) was cloned in pET15b vector from a cDNA library of Arabidopsis thaliana and expressed as an N-His.sub.6-tagged fusion protein. The primers used were: forward primer 5 GGAATTCCATATGGATCCGAATTCCACGG 3 (SEQ ID NO: 27) (NdeI restriction site is bold and underlined) and reverse primer 540 CCGCTCGAGTCATAAGGTCTGAATGTCAGAATCATTC 3 (SEQ ID NO: 28) (XhoI restriction site is bold and underlined). The resulting PCR products were digested with restriction enzymes, purified, and ligated with pET15b vector predigested with NdeI and XhoI restriction enzymes. The ligated product was transformed into electrocompetent E. coli DH5 cells. Selected clones were grown for minipreps and positive clones were verified by restriction mapping and DNA sequencing performed by Davis Sequencing Facility. The DNA sequence of the insert matched to GlcAK1.
(221) The plasmid was transformed into E. coli BL21 (DE3) chemically competent cells for protein expression. E. coli cells harboring the pET15b-AtGlcAK plasmid were cultured in LB medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) with ampicillin (100 g/mL) at 37 C. with rigorous shaking at 250 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, N.J.) until the OD600 nm of the culture reached 0.8-1.0. Overexpression of the targeted proteins was achieved by adding 0.15 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) followed by incubation at 18 C. for 20 h with rigorous shaking at 250 rpm.
(222) His.sub.6-tagged protein (SEQ ID NO: 22) was purified from cell lysate using Ni.sup.2+-NTA affinity column. To obtain cell lysate, cells were harvested by centrifugation at 4,000 rpm (Sorvall) at 4 C. for 2 h. The cell pellet was resuspended in lysis buffer (pH 8.0, 100 mM Tris-HCl containing 0.1% Triton X-100). Lysozyme (100 g/mL) and DNaseI (5 g/mL) were added to the cell suspension. The mixture was incubated at 37 C. for 1 hr with vigorous shaking (200 rpm). Cell lysate was obtained as the supernatant by centrifugation at 11,000 rpm (Sorvall) at 4 C. for 45 min. Purification was performed by loading the supernatant onto a Ni.sup.2+-NTA column pre-equilibrated with 10 column volumes of binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The column was wash with 10 column volumes of binding buffer and 10 column volumes of washing buffer (40 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). Protein of interest was eluted with Tris-HCl (pH 7.5, 50 mM) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzyme were collected and dialyzed against Tris-HCl buffer (pH 7.5, 20 mM) containing 30% glycerol. Dialyzed proteins were stored at 20 C. Alternatively, fractions containing purified enzyme were dialyzed against Tris-HCl buffer (pH 7.5, 20 mM) and freeze dried. On average, 57 mg of purified protein was obtained from 1 liter of cell culture.
(223) Substrates specificity assays by thin-layer chromatography (TLC). Enzymatic assays were carried out in a total volume of 10 L in Tris-HCl buffer (100 mM, pH 7.5) containing GlcA (or GalA, IdoA, xylose) (10 mM), ATP (20 mM), MgCl.sub.2 (20 mM), and AtGlcAK (22 g). Reactions were allowed to proceed at 37 C. for 15 hr and monitored using thin-layer chromatographic (TLC) analysis using n-PrOH:H.sub.2O:NH.sub.4OH=7:4:2 (by volume) as a developing solvent. For visualizing compounds on TLC plate, p-anisaldehyde sugar stain was used.
(224) LC-MS assays for AtGlcAK reactions. The AtGlcAK reaction mixtures above were also analyzed by LC-MS. 2 L of sample was diluted 100 fold and 8 L was injected into a Waters spherisorb ODS-2 column (5 m particles, 250 mm length, 4.6 mm I.D.). The sample was eluted with 30% acetonitrile in H.sub.2O with 0.1% formic acid and detected by ESI-MS in negative mode.
(225) Results and Discussion
(226) Substrates specificity assays. As shown in
(227) PmGlmUPasteurella multocida Glucosaminyl Uridyltransferase
(228) Glycosyltranferases are key enzymes for the formation of oligosaccharides and glycoconjugates in nature. Most glycosyltransferases require sugar nucleotides as donor substrates and catalyze the transfer of monosaccharides from sugar nucleotides to acceptors in high regio- and stereoselective manner. Some carbohydrate structures contain post-glycosylational modifications (modifications on carbohydrates and glycoconjugates which take place after the formation of glycosidic bonds). One strategy to obtain naturally existing oligosaccharides and glycoconjugates with modified sugar moieties is to develop novel chemoenzymatic methods using structurally modified monosaccharides as starting materials and carbohydrate biosynthetic enzymes (the simplest carbohydrate biosynthetic route usually involves a monosaccharide kinase, a nucleotidyltransferase, and a glycosyltransferase) with substrate promiscuities. Carbohydrates with non-natural modifications can be synthesized similarly. Some of these compounds are potential drug candidates as they can effectively interfere with carbohydrate-dependent biological processes.
(229) Glycosaminoglycans including keratan sulfate, heparan sulfate, and heparin are N-acetylglucosamine (GlcNAc)-containing polysaccharides with post-glycosylational modifications. While GlcNAc and 6-O-sulfo-GlcNAc are commonly found in kearatan sulfate, additional modified GlcNAc forms such as N-sulfo- and 3-O-sulfo-GlcNAc are common for heparan sulfate and heparin. In addition, 6-O-sulfation on GlcNAc is also common in Lewis x and sialyl Lewis x structures and has been shown to affect the binding affinity of the related carbohydrate-binding proteins such as Selectins and Siglecs. In attempts to synthesizing glycans containing naturally modified GlcNAc and their non-natural derivatives using glycosyltransferase-catalyzed reactions, we applied an efficient one-pot three-enzyme approach to synthesize UDP-GlcNAc derivatives including UDP-6-O-sulfo-GlcNAc, UDP-GlcNTFA, and azido-containing UDP-GlcNAc derivatives. Additional UDP-GlcNAc derivatives, including UDP-N-sulfo-glucosamine, were also produced by chemical diversification from enzymatically produced UDP-GlcNAc derivatives. These compounds will be tested as potential donor substrates for GlcNAc-glycosyltransferases.
(230) Experimental
(231) Cloning, expression, and purification of PmGlmU. The gene sequence of Pm1806 from Pasteurella multocida subsp. multocida strain Pm70 (GenBank accession no. AAK03890) was used as a reference for designing primers. The genomic DNA of Pasteurella multocida strain P-1059 (ATCC 15742) was used as a template for polymerase chain reaction (PCR). Full length Pasteurella multocida N-acetylglucosamine-1-phosphate uridylyltransferase (PmGlmU) was cloned in pET15b and pET22b(+) vectors as N-His.sub.6-(SEQ ID NO: 22) and C-His.sub.6-tagged (SEQ ID NO: 22) fusion proteins, respectively. For cloning into pET15b vector as an N-His.sub.6-tagged protein, the primers used were: forward primer 5 GATCCATATG AAAGAGAAAGCATTAAGTATCGTG 3 (SEQ ID NO: 29) (NdeI restriction site is bold and underlined) and reverse primer 5 CCGCTCGAGTTACTTTTTCGTTTGTTTAGTAGGGCG 3 (SEQ ID NO: 30) (XhoI restriction site is bold and underlined). For cloning into pET22b(+) vector as a C-His.sub.6-tagged (SEQ ID NO: 22) protein, the primers used were: forward primer 5 GATCCATATGAAAGAGAAAGCATTAAGTATCGTG 3 (SEQ ID NO: 31) (NdeI restriction site is bold and underlined) and reverse primer 5 CCGCTCGAG CTTTTTCGTTTGTTTAGTAGGGCGTTGC 3 (SEQ ID NO: 32) (XhoI restriction site is bold and underlined). The resulting PCR products were digested with restriction enzymes, purified, and ligated with pET15b or pET22b(+) vector predigested with NdeI and XhoI restriction enzymes. The ligated product was transformed into electrocompetent E. coli DH5 cells. Selected clones were grown for minipreps and positive clones were verified by restriction mapping and DNA sequencing performed by Davis Sequencing Facility.
(232) Positive plasmids were transformed into E. coli BL21 (DE3) chemically competent cells. E. coli cells harboring the pET15b-PmGlmU or pET22b(+)-PmGlmU plasmid were cultured in LB medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) with ampicillin (100 g/mL) until the OD.sub.600 nm of the culture reached 0.8-1.0. Overexpression of the targeted proteins was achieved by adding 0.1 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) followed by incubation at 25 C. for 18 h with rigorous shaking at 250 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, N.J.).
(233) His.sub.6-tagged (SEQ ID NO: 22) proteins were purified from cell lysate using Ni.sup.2+-NTA affinity column. To obtain cell lysate, cells were harvested by centrifugation at 4,000 rpm (Sorvall) at 4 C. for 2 hr. The cell pellet was resuspended in lysis buffer (pH 8.0, 100 mM Tris-HCl containing 0.1% Triton X-100). Lysozyme (100 g/mL) and DNaseI (5 g/mL) were then added to the cell suspension. The mixture was incubated at 37 C. for 1 hr with vigorous shaking (200 rpm). Cell lysate was obtained as the supernatant by centrifugation at 11,000 rpm (Sorvall) at 4 C. for 45 min. Purification is performed by loading the supernatant onto a Ni.sup.2+-NTA column pre-equilibrated with 10 column volumes of binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The column was wash with 10 column volumes of binding buffer and 10 column volumes of washing buffer (40 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). Protein of interest was eluted with Tris-HCl (pH 7.5, 50 mM) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzymes were collected and dialyzed against Tris-HCl (pH 7.5, 25 mM) buffer containing 10% glycerol. Dialyzed proteins were stored at 4 C.
(234) Results and Discussion
(235) DNA and protein sequences of PmGlmU cloned from Pasteurella multocida strain P-1059 (ATCC 15742). Compared to the sequences of GlmU (gene Pm1806) from Pasteurella multocida genomic strain Pm70 (GenBank accession numbers: AE004439 for gene and AAK03890 for protein), there are 13 base differences (C39A, T195C, A333G, G334A, T339C, G636A, G655A, G817C, T882A, A1006G, A1008T, G1071A, and G1266T) and four amino acid differences (E112K, D219N, E273Q, and T336A) (italicized and underlined) in Pasteurella multocida strain P-1059 (ATCC 15742).
(236) Expression level and SDS-PAGE of PmGlmU. The N-His.sub.6-tagged (SEQ ID NO: 22) PmGlmU has a higher expression level than the C-His.sub.6-tagged PmGlmU. On average, 170 mg of purified N-His.sub.6-tagged (SEQ ID NO: 22) PmGlmU was obtained from 1 liter of cell culture. SDS-PAGE analysis shows that both the purified protein migrated to around 55 kDa.
(237) BLUSP Bifidobacterium longum UDP-sugar Pyrophosphorylase
(238) Carbohydrates are widespread in nature and play pivotal roles in biological systems. The key enzymes for the formation of glycosidic bonds in carbohydrates are glycosyltransferases. Most glycosyltransferases require monosaccharide nucleotides as the common activated donor substrates. Among monosaccharide nucleotides used by mammalian glycosyltransferases, many are uridine 5-diphosphate (UDP)-monosaccharides such as UDP-glucose (UDP-Glc), UDP-galactose (UDP-Gal), UDP-glucuronic acid (UDP-GlcA), UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-N-acetylgalactosamine (UDP-GalNAc), and UDP-xylose (UDP-Xyl). In addition, UDP-mannose (UDP-Man) has been isolated from Mycobacterium smegmatis and proposed to be an intermediate in the biosynthesis of mycobacterial polysaccharides. Furthermore, UDP-N-acetylmannosamine (UDP-ManNAc) and UDP-N-acetylmannosaminuronic acid (UDP-ManNAcA) have been used by some bacteria for producing capsular polysaccharides containing ManNAc or ManNAcA residues or forming ManNAc1-4GlcNAc-PP-undecaprenol (lipid II) for the biosynthesis of cell wall teichoic acids of Gram-positive bacteria.
(239) The simplest biosynthetic route for obtaining monosaccharide nucleotides such as UDP-monosaccharides usually involves the formation of a monosaccharide-1-phosphate catalyzed by a monosaccharide-1-phosphate kinase followed by the formation of monosaccharide nucleotides catalyzed by a nucleotidyltransferase (or pyrophosphorylase). However, the simplest route has not been applied routinely for the formation of UDP-Gal due to the less common access to UTP:galactose-1-phosphate uridylyltransferases or UDP-Gal pyrophosphorylase (EC 2.7.7.10) for direct formation of UDP-Gal from Gal-1-phosphate and UTP. For example, UDP-Gal used in galactosyltransferase-catalyzed enzymatic synthesis of galactosides has been more frequently obtained from UDP-Glc by reactions catalyzed by UDP-Gal 4-epimerases or UDP-glucose:galactose-1-phosphate uridylyltransferases (EC 2.7.7.12, GalT or GalPUT) in the Leloir pathway.
(240) Nevertheless, UDP-galactose pyrophosphorylase activity was identified from yeast Saccharomyces fragilis, pigeon liver, and mammalian livers. The enzyme was purified from bovine liver and Gram-positive bacterium Bifidobacterium bifidum. Recently, promiscuous UDP-sugar pyrophosphorylases (USPs) (EC 2.7.7.64) that can use various monosaccharide 1-phosphates in the presence of UTP for direct synthesis of UDP-monosaccharides including UDP-Glc, UDP-Gal, and UDP-GlcA, etc. were cloned from plants such as pea (Pisum sativum L.) sprouts (PsUSP) and Arabidopsis thaliana (AtUSP). Enzymes which share sequence homology to plant USPs were also cloned from Leishmania major and Trypanosoma cruzi, two trypanosomatid protozoan parasites, and were shown to have good activity towards Gal-1-P and Glc-1-P and weaker activity towards xylose-1-phosphate and GlcA-1-P. A USP with broad substrate specificity and optimal activity at 99 C. was also cloned from a hyperthermophile archaea Pyrococcus furiosus DSM 3638 for which Glc-1-P, Man-1-P, Gal-1-P, Fuc-1-P, GlcNH.sub.2-1-P, GalNH.sub.2-1-P, and GlcNAc-1-P were all shown to be tolerable substrate, and both UTP and dTTP could be used as nucleotide triphosphate substrates by the enzyme. Nevertheless, none of these enzymes has been used in preparative-scale or large-scale synthesis of sugar nucleotides and non-natural derivatives of monosaccharide-1-P have not been tested as substrates for USPs.
(241) Here we report the cloning of a promiscuous USP from a probiotic Bifidobacterium longum strain ATCC55813 and its application in an efficient one-pot three-enzyme system for preparative-scale synthesis of UDP-monosaccharides and their derivatives from simple monosaccharides or derivatives (except for UDP-Glc which was synthesized from Glc-1-P in a one-pot two-enzyme system as discussed below). These compounds will be tested as potential donor substrates for various glycosyltransferases.
(242) Experimental
(243) Cloning, expression, and purification of BLUSP. Full length Bifidobacterium longum UDP-sugar pyrophosphorylase (EC 2.7.7.64) (BLUSP) (encoded by gene ugpA, DNA GenBank accession number: ACHI01000119, locus tag: HMPREF0175_1671; protein GenBank accession number: EEI80102) was cloned from the genomic DNA of Bifidobacterium longum strain ATCC55813 in pET15b vector as an N-His.sub.6-tagged (SEQ ID NO: 22) fusion protein. The primers used were: forward primer 5 GGAATTCCATATGACAGAAATAAACGATAAGGCC 3 (SEQ ID NO: 33) (NdeI restriction site is bold and underlined) and reverse primer 5 CGCGGATCCTCACACCCAATCGTCCG 3 (SEQ ID NO: 34) (BamHI restriction site is bold and underlined). The resulting PCR products were digested with restriction enzymes, purified, and ligated with pET15b vector predigested with NdeI and BamHI restriction enzymes. The ligated product was transformed into electrocompetent E. coli DH5 cells. Selected clones were grown for minipreps and positive clones were verified by restriction mapping and DNA sequencing performed by Davis Sequencing Facility. The DNA sequence of the insert matched to BL0739 (ugpA) gene in the genomic sequence of Bifidobacterium longum NCC2705. Compared to the BL0739 (ugpA) gene sequence of Bifidobacterium longum NCC2705 (GenBank accession number: AE014295) which was annotated to encoding a hypothetical UTP:glucose-1-phosphate uridylyltransferase (GenBank accession number: AAN24556), there are 4 base differences (T35C, A47G, C228T, A465C) resulting in one amino acid difference (D16G) in the protein sequence of BLUSP.
(244) The plasmid was transformed into E. coli BL21 (DE3) chemically competent cells for protein expression. E. coli cells harboring the pET15b-BLUSP plasmid were cultured in LB medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) with ampicillin (100 g/mL) at 37 C. with rigorous shaking at 250 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, N.J.) until the OD.sub.600 nm of the culture reached 0.8-1.0. Overexpression of the targeted proteins was achieved by adding 0.15 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) followed by incubation at 18 C. for 20 hr with rigorous shaking at 250 rpm.
(245) His.sub.6-tagged (SEQ ID NO: 22) protein was purified from cell lysate using Ni.sup.2+-NTA affinity column. To obtain cell lysate, cells were harvested by centrifugation at 4,000 rpm (Sorvall) at 4 C. for 2 hr. The cell pellet was resuspended in lysis buffer (pH 8.0, 100 mM Tris-HCl containing 0.1% Triton X-100). Lysozyme (100 g/mL) and DNaseI (5 g/mL) were added to the cell suspension. The mixture was incubated at 37 C. for 1 hr with vigorous shaking (200 rpm). Cell lysate was obtained as the supernatant by centrifugation at 11,000 rpm (Sorvall) at 4 C. for 45 min. Purification was performed by loading the supernatant onto a Ni.sup.2+-NTA column pre-equilibrated with 10 column volumes of binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The column was wash with 10 column volumes of binding buffer and 10 column volumes of washing buffer (40 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). Protein of interest was eluted with Tris-HCl (pH 7.5, 50 mM) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzyme were collected and dialyzed against Tris-HCl buffer (pH 7.5, 25 mM) containing 10% glycerol and 0.25 M NaCl. Dialyzed proteins were stored at 4 C. Alternatively, fractions containing purified enzyme were dialyzed against Tris-HCl buffer (pH 7.5, 25 mM) and freeze dried. On average, 167 mg of purified protein was obtained from 1 liter of cell culture. Protein concentration was determined in a 96-well plate using bicinchoninic acid with BSA as standard. The absorbance was measured at 562 nm using a plate reader.
(246) pH Profile study for BLUSP. Typical enzymatic assays for pH profile studies were carried out for 10 min at 37 C. in a total volume of 20 L containing Glc-1-P (1 mM), UTP (1 mM), Mg.sup.2+ (20 mM), and BLUSP (10 ng) in a buffer (100 mM) with pH varying from 3.0 to 9.5. The reaction mixture was quenched by boiling for 5 min followed by adding 20 L of pre-chilled 95% (v/v) ethanol. The samples were then kept on ice until analyzed by a Beckman Coulter P/ACE MDQ Capillary Electrophoresis system equipped with a UV detector and a 50 cm capillary tubing (75 m I.D., Beckman Coulter). Assays were run at 25 kV with 25 mM sodium borate buffer (pH 9.8) for 22 min. Percent conversions were calculated from peak areas of UDP-sugar and UTP monitored by UV absorbance at 254 nm. All assays were carried out in duplicate.
(247) Effects of metal ions and EDTA. EDTA (5 mM), different concentrations (0.5, 1, 5, 10, 20, 50 mM) of MgCl.sub.2, and various divalent metal cations (CaCl.sub.2, CoCl.sub.2, CuSO.sub.4, MnCl.sub.2, ZnCl.sub.2) were used in a MES buffer (pH 6.5, 100 mM) to analyze their effects on the uridylyltransferase activity of BLUSP (10 ng in 20 L total volume) using Glc-1-P (1 mM) as the acceptor. Other components are the same as those described for the pH profile studies. Reaction without EDTA or metal ions was used as a control.
(248) Capillary electrophoresis (CE) and thin-layer chromatograph (TLC) assays for kinase reactions. Kinase reactions were carried out at 37 C. in a total volume of 30 L in Tris-HCl buffer (100 mM, pH 8.0) containing monosaccharide (15 mM), ATP (18 mM, 1.2 eq.), MgCl.sub.2 (10 mM), and a kinase (6 g). These conditions were similar to those used for preparative-scale synthesis. After 1 hr, 4 hr, and 24 hr, an aliquot of 8 L was withdrawn from each reaction mixture, boiled in a water bath for 5 min and stored at 20 C. until being analyzed by capillary electrophoresis (CE) and TLC. For TLC analysis, 0.5 L of each sample was directly spotted on TLC plates, developed using suitable developing solvents, and stained with anisaldehyde sugar stain. For CE analysis, 1.5 L of each sample was diluted into 30 L and subjected to CE analysis as described above for pH profile studies.
(249) Results and Discussion
(250) SDS-PAGE analysis of BLUSP. SDS-PAGE analysis shows that the recombinant BLUSP has a very good expression level in E. coli and has a high solubility. It consists of about 90% of the total protein extracts from E. coli host cells and more than 90% of the soluble protein. The protein size observed is about 60 kDa which is close to 59.7 kDa calculated molecular weight.
(251) pH profile of BLUSP. As shown in
(252) Effects of metal ions and EDTA. As shown in
(253) PmUgdPasteurella multocida UDP-Glucose Dehydrogenase
(254) Cloning of PmUgd. PmUgd was cloned as a C-His.sub.6-tagged (SEQ ID NO: 22) fusion protein in pET22b(+) vector using the genomic DNA of P. multocida P-1059 (ATCC#15742) as the template for polymerase chain reactions (PCR). Primers used for cloning were: forward primer 5-GATCCATATGAAGAAAATTACAATTGCTGGGGC-3 (SEQ ID NO: 35) (NdeI restriction site is underlined) and reverse primer 5-CCGCTCGAGAGCATCACCGCCAAAAATATCTCTTG-3 (SEQ ID NO: 36) (XhoI restriction site is underlined). PCR was performed in a reaction mixture of 50 l containing genomic DNA (1 g), forward and reverse primers (1 M each), 10 Herculase buffer (5 l), dNTP mixture (1 mM), and 5 U (1 l) of Herculase-enhanced DNA polymerase. The reaction mixture was subjected to 30 cycles of amplification with an annealing temperature of 55 C. The resulting PCR products were purified, digested, and ligated with the corresponding pre-digested vector. The ligation products were transformed into electrocompetent E. coli DH5 cells. Plasmids containing the target genes as confirmed by DNA sequencing (performed by UC-Davis Sequencing Facility) were selected and transformed into E. coli BL21(DE3) chemically competent cells.
(255) Compared to the DNA sequence of PM0776 gene from P. multocida strain Pm70 (its genomic DNA sequence is available on NCBI), the obtained gene of PmUgd has 19 base differences (A357G, C381A, A390G, A397C, C404A, A406G, T408A, C414T, A420T, A426G, C430T, G438A, C447A, T451C, C453T, T456C, A464T, C582T, and G807A, the nucleotide before the number is from the DNA sequence of PM0776, the number is based on PM0776 gene) compared to publically available PM0776 gene sequence. Furthermore, the C at position 401 in PM0776 is missing in PmUgd and PmUgd has an extra A between 408 and 409 of PM0776. Overall, there are five amino acid differences in PmUgd (N127K, N133H, L137I, Y151H and Y155F, the amino acid residue before the number is from the protein sequence deduced from PM0776, the number is based on the protein sequence deduced from PM0776) compared to the deduced protein sequence from PM0776 gene.
(256) Expression and purification. E. coli strains were cultured in LB rich medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) supplemented with ampicillin (100 g/mL). Over-expression of PmUgd was achieved by inducing the E. coli BL21(DE3) cell culture with 0.1 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) when the OD.sub.600 nm of the culture reached 0.8-1.0 followed by incubation at 20 C. for 20 h.
(257) Bacterial cells were harvested by centrifugation at 4 C. in a Sorvall Legend RT centrifuge with a hanging bucket rotor at 4000 rpm for 2 h. Harvested cells were resuspended in lysis buffer (Tris-HCl buffer, 100 mM, pH 8.0 containing 0.1% Triton X-100) (20 mL for cells collected from one liter cell culture). Lysozyme (100 g/mL) and DNaseI (5 g/mL) were added to the cell resuspension. The resulting mixture was incubated at 37 C. for 1 h with shaking at 200 rpm. Cell lysate (supernatant) was obtained by centrifugation at 12000rpm for 15 min. Purification was carried out by loading the supernatant onto a Ni.sup.2+-NTA column pre-equilibrated with 8 column volumes of binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The column was washed with 8 column volumes of binding buffer and 8 column volumes of washing buffer (40 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The target protein was eluted with Tris-HCl buffer (50 mM, pH 7.5) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzymes were collected and dialyzed against Tris-HCl buffer (20 mM, pH 7.5) containing 10% glycerol. Dialyzed proteins were stored at 4 C.
(258) About 23 mg PmUgd can be routinely expressed and purified from 1 of E. coli culture under expression conditions described above.
(259) PmHS1, PmHS2, KfiA
(260) Materials and Methods
(261) Bacterial strains, plasmids, and materials. E. coli electrocompetent DH5 and chemically competent BL21 (DE3) cells were from Invitrogen (Carlsbad, Calif.). P. multocida P-934 (ATCC#12948) and P. multocida P-1059 (ATCC#15742) were from American Type Culture Collection (ATCC, Manassas, Va., USA). KfiA synthetic gene with codons optimized for E. coli expression was synthesized by GeneArt (Grand Island, N.Y.) based on KfiA gene sequence from E. coli Nissle 1917 (GenBank accession number: AJ586888, ORF79). Vector plasmid pET15b was from Novagen (EMD Biosciences Inc. Madison, Wis., USA). Vector pMAL-c4X was purchased from New England Biolabs (Ipswich, Mass.). Nickel-nitrilotriacetic acid agarose (Ni.sup.2+-NTA agarose), QIAprep spin miniprep kit, and QIAEX II gel extraction kit were from Qiagen (Valencia, Calif., USA). Herculase-enhanced DNA polymerase was from Stratagene (La Jolla, Calif., USA). T4 DNA ligase and 1 kb DNA ladder were from Promega (Madison, Wis., USA). NdeI, BamHI, EcoRI, and HindIII restriction enzymes were from New England Biolabs Inc. (Beverly, Mass., USA).
(262) Cloning of PmHS1, PmHS2 and KfiA. PmHS2 was cloned as N- and C-His.sub.6-tagged (SEQ ID NO: 22) fusion proteins in pET15b and pET22b(+) vector, respectively, using genomic DNAs of P. multocida P-1059 (ATCC#15742) as the template for polymerase chain reactions (PCR). PmHS1 and KfiA were cloned as a fusion protein of an N-terminal with a maltose-binding protein (MBP) and a C-terminal His.sub.6 tag in pMAL-c4X vector using the P. multocida P-934 (ATCC#12948) and KfiA synthetic gene as template, respectively. Primers used for cloning are summarized in Table 8. PCR was performed in a reaction mixture of 50 L containing genomic DNA (1 g), forward and reverse primers (1 M each), 10 Herculase buffer (5 L), dNTP mixture (1 mM), and 5 U (1 L) of Herculase-enhanced DNA polymerase. The reaction mixture was subjected to 30 cycles of amplification with an annealing temperature of 55 C. (for PmHS1 and PmHS2) or 52 C. (for KfiA). The resulting PCR products were purified, digested, and ligated with the corresponding pre-digested vector. The ligation products were transformed into electrocompetent E. coli DH5 cells. Plasmids containing the target genes as confirmed by DNA sequencing (performed by UC-Davis Sequencing Facility) were selected and transformed into E. coli BL21(DE3) chemically competent cells.
(263) TABLE-US-00004 TABLE4 Primersusedforcloning PmHS1,PmHS2andKfiA. Sequences(5-3) Primers (SEQIDNO:) KfiA_pMAL-c4X_F_EcoRI GACCGAATTCATGATTGTTG CAAATATGAGC(37) KfiA_pMAL-c4X_R_HindIII GTCGAAGCTTTTAGTGGTGG TGGTGGTGGTGACCTTCCAC ATTATAC(38) PmHS1_pMAL-c4X_F_BamHI CGCGGATCCATGAGCTTATT TAAACGTGCTAC(39) PmHS1_pMAL-c4X_R_HindIII GATCAAGCTTTTAGTGATGA TGATGATGATGCTCGTTATA AAAAGATAAACACGG(40) PmHS2_pET15b/22b+_F_NdeI GATCCATATGAAGGGAAAAA AAGAGATGAC(41) PmHS2_pET15b_R_BamHI AAGGGATCCTTATAAAAAAT AAAAAGGTAAACAGG(42) PmHS2_pET22b+_R_BamHI AAGGGATCCTTAGTGGTGGT GGTGGTGGTGTAAAAAATAA AAAGGTAAACAGG(43)
(264) Expression and purification. E. coli strains were cultured in LB rich medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) supplemented with ampicillin (100 g/mL). Over-expression of PmHS1 and PmHS2 were achieved by inducing the E. coli BL21(DE3) cell culture with 0.1 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) when the OD.sub.600 nm of the culture reached 0.8-1.0 followed by incubation at 20 C. for 20 h. Overexpression of KfiA was performed by inoculating 10 mL of a fresh overnight bacterial culture grown in LB containing 50 g/mL ampicillin and 20 g/mL chloramphenicol into 1 of LB (containing 50 g/mL of ampicillin, 20 g/mL of chloramphenicol and 2 mg/mL of L-arabinose). The culture was incubated at 37 C. with shaking at 250 rpm. When the OD.sub.600 of the culture reached 0.4-0.6, expression was induced by adding IPTG to a final concentration of 0.3 mM and then the cell was cultured at 20 C. for 20 h.
(265) Bacterial cells were harvested by centrifugation at 4 C. in a Sorvall Legend RT centrifuge with a hanging bucket rotor at 4000 rpm for 2 h. Harvested cells were resuspended in lysis buffer (Tris-HCl buffer, 100 mM, pH 8.0 containing 0.1% Triton X-100) (20 mL for cells collected from one liter cell culture). Lysozyme (100 g/mL) and DNaseI (5 g/mL) were added to the cell resuspension. The resulting mixture was incubated at 37 C. for 1 h with shaking at 200 rpm. Cell lysate (supernatant) was obtained by centrifugation at 12000 rpm for 15 min. Purification was carried out by loading the supernatant onto a Ni.sup.2+-NTA column pre-equilibrated with 10 column volumes of binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The column was washed with 10 column volumes of binding buffer and 10 column volumes of washing buffer (20-50 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The target protein was eluted with Tris-HCl buffer (50 mM, pH 7.5) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzymes were collected and dialyzed against Tris-HCl buffer (20 mM, pH 7.5) containing 10% glycerol. Dialyzed proteins were stored at 4 C.
(266) pH profile by HPLC. Typical enzymatic assays were performed in a 10 l reaction mixture containing a buffer (100 mM) with a pH in the range of 4.0-10.0, UDP-GlcNAc (1 mM), GlcA2AA (1 mM), MnCl.sub.2 (10 mM) and KfiA (9.0 g) or PmHS2 (0.25 g). Buffers used were: Na.sub.2HPO.sub.4/citric acid, pH 4.0; MES, pH 5.0-6.5; TrisHCl, pH 7.0-9.0; and CAPS, pH 10.0. Reactions were allowed to proceed for 30 min at 37 C. and were quenched by adding ice-cold 10% (v/v) acetonitrile to make 100-fold dilutions. The samples were then kept on ice until an aliquot of 8 l was injected and analyzed by a Shimadzu LC-2010A system equipped with a membrane on-line degasser, a temperature control unit and a fluorescence detector. A reverse phase Premier C18 column (250 9 4.6 mm I.D., 5 m particle size, Shimadzu) protected with a C18 guard column cartridge was used. The mobile phase was 25% (v/v) acetonitrile. The fluorescent compounds GlcA2AA and GlcNAc1-4GlcA2AA were detected by excitation at 315 nm and emission at 400 nm.
(267) Effects of metal ions. Different concentrations (1, 5, 10, and 20 mM) of MgCl.sub.2 MnCl.sub.2, CaCl.sub.2, or CuCl.sub.2 were used in a IVIES buffer (pH 6.5, 100 mM) to analyze their effects on the activity of KfiA (0.9 g l.sup.1) or PmHS2 (2.510.sup.2 g l.sup.1). Reaction without metal ions was used as a control. The assay was performed as above pH profile.
(268) Substrate specificity of KfiA and PmHS2. All reactions were carried out in duplicate at 37 C. in MES (100 mM, pH 6.5) containing an UDP-GlcNAc or its derivatives (1 mM), GlcA2AA (1 mM), MnCl.sub.2 (10 mM) and KfiA (1.08 or PmHS2 (2.510.sup.2 g l.sup.1). At 30 min, 4 h or 16 h, aliquots of reaction mixture were withdrawn and were quenched by adding ice-cold 10% (v/v) acetonitrile to make 100-fold dilutions. The assays were analyzed by HPLC.
(269) Results
(270) Cloning, expression and purification of recombinant proteins. PmHS2 was cloned as an N- or a C-His.sub.6-tagged (SEQ ID NO: 22) protein using pET15b and pET22b (+) vectors, respectively. Both N- and C-His.sub.6-tagged (SEQ ID NO: 22) proteins were able to be expressed as soluble forms in E. coli BL21(DE3) cells by induction 0.1 mM IPTG. Both could be easily purified using Ni.sup.2+-affinity chromatography. The expression level of the soluble and active N-His.sub.6-tagged (SEQ ID NO: 22) form was relatively higher than its C-His.sub.6-tagged (SEQ ID NO: 22) counterpart and N-His.sub.6-PmHS2 was studied in detail. About 11 mg of N-His.sub.6-PmHS2 was routinely obtained from the cell lysate of one liter E. coli cell culture. KfiA was expressed in an N-terminal MBP and a C-terminal six-His fusion protein in BL21(DE3) cells coexpressed with chaperone protein pGro7. The recombinant KfiA was purified to homogeneity with a Ni.sup.2+-affinity column. About 8.0 mg of MBP-KfiA-His.sub.6 was routinely obtained from the cell lysate of one liter E. coli cell culture. Sodium dodecylsulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis indicated that one-step Ni.sup.2+-column purification was efficient to provide pure PmHS2 and KfiA. As expected from the calculated molecular weight of PmHS2 and KfiA, the size of the protein shown by SDS-PAGE was about 75 kDa and 69 kDa, respectively. To obtain a soluble and active recombinant PmHS1 in E. coli expression system, the MBP tag was introduced by using pMAL-c4X vector, while the C-His.sub.6-tag (SEQ ID NO: 22) was introduced by including the His.sub.6-tag (SEQ ID NO: 22) codons in the 3-primer used for cloning. Expression was achieved by incubating E. coli BL21(DE3) cells at 20 C. for 20 h with vigorous shaking (250 rpm) after the addition of IPTG (0.1 mM) for induction. Although it has activity, SDS-PAGE analysis indicated that only a small portion of the recombinant protein was seen in the cell lysate, the soluble portion of the cell extraction.
(271) pH profile of KfiA and the N-acetylglucosaminyltransferase activity of PmHS2. As shown in
(272) Effects of metal ions on the heparosan synthase activity of KfiA and PmHS2. The effects of different metal ions, Mg.sup.2+, Mn.sup.2+, Ca.sup.2+ and Cu.sup.2+ on the heparosan synthase activity of KfiA and PmHS2 were investigated. Reaction without metal ions was used as a control. As shown in
(273) Substrate specificity of KfiA and PmHS2. Using the HPLC method described above, the substrate specificities of KfiA and PmHS2 were examined using GlcA2AA and twenty two compounds of UPD-GlcNAc or UDP-Mannose or their derivatives. Experimental data is shown in
Example 2
Preparation of UDP-GlcNAc and Derivatives
(274) General methods for compound purification and characterization. Chemicals were purchased and used without further purification. .sup.1H NMR and .sup.13C NMR spectra were recorded on a 600 MHz NMR spectrometer. High resolution electrospray ionization (ESI) mass spectra were obtained at the Mass Spectrometry Facility in the University of California, Davis. Silica gel 60 (Sorbent Technologies) was used for flash column chromatography. Analytical thin-layer chromatography (Sorbent Technologies) was performed on silica gel plates using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm2.5 cm) packed with BioGel P-2 Fine resins. ATP, UTP, and GlcNAc were purchased from Sigma. GlcNTFA, GlcN.sub.3, GlcNAc6N.sub.3, GlcNAc6S, GlcNS were synthesized as described previously. NanK_ATCC55813 and PmPpA were overexpressed as discussed previously.
(275) Synthesis of GlcNTFA6S T5b-6. GlcNTFA T5b-2 (300 mg, 1.09 mmol) was dissolved in 15 mL of anhydrous DMF. Anhydrous Et.sub.3N (5 mL) and sulfur trioxide pyridine complex (1.2 eq.) were added at 0 C. After being stirred at room temperature for overnight, the reaction was stopped by adding MeOH and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=8:2:1, by volume) to afford 6-O-sulfo-GlcNTFA T5b-6 (243 mg, 63%). .sup.1H NMR (600 MHz, D.sub.2O) 5.25 (d, J=2.4 Hz, 0.6H), 4.84 (d, J=8.4 Hz, 0.4H), 4.26-3.51 (m, 6H). .sup.13C NMR (150 MHz, D.sub.2O) 159.75 (J=37.5 Hz), 159.69 (J=37.5 Hz), 117.01 (J=284.7 Hz), 116.93 (J=284.7 Hz), 94.46, 80.59, 74.03, 73.24, 70.21, 70.00, 69.84, 96.75, 67.22, 67.18, 57.34, 54.87.
(276) ##STR00061##
(277) Synthesis of GlcN.sub.36S T5b-7. 6-O-Sulfo-GlcN.sub.3 T5b-7 was synthesized from GlcN.sub.3 T5b-3 (300 mg, 1.46 mmol) in 54% yield (224 mg) and the procedures were similarly as described above for GlcNTFA6S T5b-6. .sup.1H NMR (600 MHz, D.sub.2O) 5.35 (d, J=2.9 Hz, 0.4H), 4.71 (d, J=8.4 Hz, 0.6H), 4.21-3.82 (m, 3H), 3.65-3.28 (m, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 95.31, 91.39, 74.32, 73.94, 71.55, 69.80, 69.61, 69.27, 67.15, 67.12, 66.85, 63.55.
(278) ##STR00062##
(279) One-pot three-enzyme synthesis of UDP-sugars T5b-9-T5b-13. This was carried out as shown in
(280) One-pot three-enzyme synthesis of UDP-GlcNAc3N.sub.3 was also conducted using GlcNAc3N.sub.3 as the staring sugar (See Table 5a) for reaction conditions). As shown in
(281) TABLE-US-00005 TABLE 5a Reaction conditions for the synthesis of UDP-GlcNAc3N.sub.3. GlcNAc3N.sub.3 (10 mM) Tris-HCl (pH 7.5) 100 mM MgCl.sub.2 10 mM ATP 20 mM UTP 20 mM NahK_ATCC15697 17 g.sup. PmGlmU 12.5 g PmPpA 23 g Total volume 20 L reaction time/Temp 18 hr/37 C.
(282) Uridine 5-diphospho-2-acetamido-2-Deoxy--D-glucopyranoside (UDP-GlcNAc, T5b-9). Yield, 81% (445 mg); white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.97 (d, J=8.4 Hz, 1H), 5.97-6.00 (m, 2H), 5.53 (dd, J=6.6, 3.0 Hz, 1H), 4.37-4.40 (m, 2H), 4.21-4.31 (m, 3H), 3.81-3.75 (m, 5H), 3.58 (t, J=9.0 Hz, 1H), 2.09 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 174.94, 166.39, 151.99, 141.82, 102.85, 94.68, 88.72, 83.40 (d, J=8.7 Hz), 73.96, 73.20, 71.13, 69.83, 65.18, 65.15, 60.53, 53.88 (d, J=8.4 Hz), 22.29. FIRMS (ESI) m/z calcd for C.sub.17H.sub.27N.sub.3O.sub.17P.sub.2(M+H) 608.0894, found 608.0906.
(283) Uridine 5-diphospho-2-deoxy-2-trifluoroacetamido--D-glucopyranoside (UDP-GlcNTFA, T5b-10). Yield, 97% (699 mg); white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.95 (d, J=7.8 Hz, 1H), 5.97-5.98 (m, 2H), 5.64 (dd, J=6.6, 3.0 Hz, 1H), 4.35-4.39 (m, 2H), 4.18-4.29 (m, 3H), 4.12 (d, J=10.8 Hz, 1H), 3.93-3.98 (m, 2H), 3.91 (dd, J=12.6, 1.8 Hz, 1H), 3.85 (dd, J=12.0, 4.2 Hz, 1H), 3.61 (t, J=9.0 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.39, 159.73 (d, J=37.5 Hz), 151.94, 141.83, 116.88 (d, J=284.6 Hz), 102.79, 93.91, 88.79, 83.22 (d, J=9.0 Hz), 73.92, 73.23, 70.35, 69.76, 69.68, 65.12, 60.42, 54.53 (d, J=8.9 Hz). FIRMS (ESI) m/z calcd for C.sub.17H.sub.24F.sub.3N.sub.3O.sub.17P.sub.2(M+H) 662.0611, found 662.0615.
(284) Uridine 5-diphospho-2-azido-2-deoxy--D-glucopyranoside (UDP-GlcN.sub.3, T5b-11). Yield, 54% (124 mg); white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.96 (d, J=8.4 Hz, 1H), 5.97-5.96 (m, 2H), 5.68 (dd, J=7.2, 3 Hz, 1H), 4.34-4.37 (m, 2H), 4.18-4.27 (m, 3H), 3.89-3.93 (m, 2H), 3.85 (dd, J=12.6, 2.4 Hz, 1H), 3.79 (dd, J=12.0, 4.2 Hz, 1H), 3.54 (t, J=9.6 Hz, 1H), 3.38 (d, J=10.2 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.39, 151.96, 141.84, 102.79, 94.60, 88.64, 83.34 (d, J=9 Hz), 73.91, 73.07, 70.85, 69.77, 69.49, 65.07, 62.93 (d, J=8.6 Hz), 60.29. HRMS (ESI) m/z calcd for C.sub.15H.sub.23N.sub.5O.sub.16P.sub.2(M+H) 633.0959, found 633.0960.
(285) Uridine 5-diphospho-2-acetamido-6-azido-2,6-dideoxy--D-glucopyranoside (UDP-GlcNAc6N.sub.3, T5b-12). Yield, 72% (462 mg); white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.93 (d, J=7.8 Hz, 1H), 5.96-5.94 (m, 2H), 5.15 (s, 1H), 4.32-4.36 (m, 2H), 4.17-4.24 (m, 3H), 4.00-4.04 (m, 2H), 3.79 (t, J=9.6 Hz, 1H), 3.72 (dd, J=13.2, 2.4 Hz, 1H), 3.55-3.62 (m, 2H), 2.06 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 174.86, 166.33, 151.86, 141.82, 102.76, 94.53, 88.92, 83.15 (d, J=8.9 Hz), 73.93, 71.85, 70.28, 70.28, 69.68, 65.16, 53.77 (d, J=7.4 Hz), 50.71, 22.22. HRMS (ESI) m/z calcd for C.sub.17H.sub.26N.sub.6O.sub.16P.sub.2(M+H) 592.0693, found 592.0698.
(286) Uridine 5-diphospho-2-acetamido-2-deoxy-6-O-sulfo--D-glucopyranoside (UDP-GlcNAc6S, T5b-13). Yield, 62% (70 mg); white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.96 (d, J=7.8 Hz, 1H), 5.97-5.99 (m, 2H), 5.55 (dd, J=7.2, 3.0 Hz, 1H), 4.35-4.38 (m, 3H), 4.26-4.30 (m, 3H), 4.18-4.22 (m, 1H), 4.12 (d, J=9.6 Hz, 1H), 4.04 (d, J=10.8 Hz, 1H), 3.84 (t, J=9.6 Hz, 1H), 3.68 (t, J=9.6 Hz, 1H), 2.09 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 174.84, 166.40, 151.93, 141.73, 102.76, 94.57, 88.72, 83.15 (d, J=9.3 Hz), 73.89, 70.83, 69.70, 69.04, 66.56, 65.16, 65.13, 53.67 (d, J=8.1 Hz), 22.17. HRMS (ESI) m/z calcd for C.sub.17H.sub.27N.sub.3O.sub.20P.sub.2S (M+H) 688.0462, found 688.0471.
(287) Chemical Derivatization of UDP-Sugars F5-2F5-8, and F5-10F5-15.
(288) Uridine 5-diphospho-2-amino-2-deoxy--D-glucopyranoside (UDP-GlcNH.sub.2, F5-2). UDP-GlcNTFA F5-1 (150 mg, 0.22 mmol) was dissolved in 25 mL of methanol and 5 mL of H.sub.2O. The pH of the solution was adjusted to 9.5 by adding K.sub.2CO.sub.3. After being vigorously stirred at r.t. for overnight, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=1:1:1, by volume) to afford UDP-GlcNH.sub.2 F5-2 as white solid in 98% yield (122 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.90 (d, J=7.8 Hz, 1H), 5.89-5.92 (m, 2H), 5.79 (dd, J=6.0, 3.0 Hz, 1H), 4.30-4.32 (m, 2H), 4.16-4.24 (m, 3H), 3.86-3.90 (m 2H), 3.81 (dd, J=12.6, 1.8 Hz, 1H), 3.77 (dd, J=12.6, 4.2 Hz, 1H), 3.52 (t, J=9.6 Hz, 1H), 3.33 (d, J=10.8 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.40, 151.93, 141.75, 102.71, 92.87, 88.74, 83.21 (d, J=9 Hz), 73.91, 73.39, 69.85, 69.69, 69.16, 65.23, 60.09, 54.27 (d, J=8.4 Hz). HRMS (ESI) m/z calcd for C.sub.15H.sub.25N.sub.3O.sub.16P.sub.2(M+H) 566.0788, found 566.0791.
(289) Uridine 5-diphospho-2-sulfoamino-2-deoxy--D-glucopyranoside (UDP-GlcNS, F5-3). UDP-GlcNH.sub.2 F5-2 (50 mg, 0.082 mmol) was dissolved in 30 mL of water. The pH of the solution was adjusted to 9.5 by adding 2 N NaOH (aq). Sulfur trioxide-pyridine complex (65 mg, 0.41 mmol) was added in three equal portions during 35 minutes intervals at room temperature, and the pH was maintained at 9.5 throughout the whole process using 2 N NaOH (aq). After being stirred at r.t. for overnight, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, concentrated, and purified using silica gel column (EtOAc:MeOH:H.sub.2O=3:2:1, by volume) to obtain the UDP-GlcNS F5-3 in 86% yield (46 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.90 (d, J=7.8 Hz, 1H), 5.92-5.93 (m, 2H), 5.71 (s, 1H), 4.31-4.33 (m, 2H), 4.16-4.23 (m, 3H), 3.73-3.86 (m, 3H), 3.66 (t, J=9.6 Hz, 1H), 3.51 (t, J=9.6 Hz, 1H), 3.24 (d, J=9.6 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.49, 152.13, 141.99, 103.04, 95.50, 88.86, 83.53 (J=8.9 Hz), 74.02, 73.06, 71.73, 69.98, 69.96, 65.38, 60.73, 58.11 (J=9.2 Hz). HRMS (ESI) m/z calcd for C.sub.15H.sub.25N.sub.3O.sub.19P.sub.2S (M+H) 646.0356, found 646.0373.
(290) Uridine 5-diphospho-2-hydroxyacetamido-2-deoxy--D-glucopyranoside (UDP-GlcNGc, F5-5). To a solution of UDP-GlcNH.sub.2 F5-2 (30 mg, 0.049 mmol) in CH.sub.3CNH.sub.2O (30 mL, 1:1, v/v) in the presence of NaHCO.sub.3 (40 mg, 0.49 mmol), the Acetoxyacetyl chloride (6.9 L, 0.098 mmol) in CH.sub.3CN (5 mL) was added. The reaction mixture was stirred for 4 hours at 0 C. and was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=5:2:1, by volume) to afford UDP-GlcNGcAc F5-4 in 95% yield (31 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.99 (d, J=7.8 Hz, 1H), 6.03-6.04 (m, 2H), 5.62 (dd, J=6.6, 3.6 Hz, 1H), 4.41-4.45 (m, 2H), 4.24-4.35 (m, 3H), 4.13 (d, J=10.2 Hz, 1H), 4.01 (d, J=7.8 Hz, 1H), 3.86-3.96 (m, 3H), 3.63 (t, J=9.6 Hz, 1H), 2.25 (s, 3H). UDP-GlcNGcAc F5-4 was dissolved in dry methanol (50 mL) containing analytic amount of sodium methoxide. The resulted mixture was stirred at r.t. for overnight. The reaction mixture was then neutralized with DOWEX HCR-W2 (H+) resin, filtered, and concentration to give product UDP-GlcNGc F5-5 in 98% yield (28 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.92 (d, J=7.8 Hz, 1H), 5.93-5.95 (m, 2H), 5.52 (dd, J=7.2, 3.0 Hz, 1H), 4.31-4.35 (m, 2H), 4.09-4.25 (m, 5H), 4.02 (d, J=10.2 Hz, 1H), 3.83-3.91 (m, 3H), 3.79 (dd, J=12.6, 4.2 Hz, 1H), 3.55 (t, J=9.6 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 175.47, 166.37, 151.92, 141.74, 101.73, 94.36, 88.53, 83.28 (d, J=8.4 Hz), 73.86, 73.09, 70.69, 69.71, 69.54, 65.05, 61.11, 60.36, 53.46 (d, J=7.7 Hz). HRMS (ESI) m/z calcd for C.sub.17H.sub.27N.sub.3O.sub.18P.sub.2(M+H) 624.0843, found 624.0847.
(291) Uridine 5-diphospho-2-azidoxyacetamido-2-deoxy--D-glucopyranoside (UDP-GlcNAz, F5-6). Sodium azide (62 mg, 0.98 mmol) was dissolved in 5 mL of distilled H.sub.2O and the mixture was cooled to 0 C. Bromoacetic acid (68 mg, 0.49 mmol) was then added over 10 min and the reaction was allowed to slowly warm up to r.t. for overnight. The reaction was acidified to pH 1.0 and extracted three times with 5 mL of diethyl ether. The organic portions were combined, dried over MgSO.sub.4 and concentrated. The crude mixture was dissolved in 10 mL of CH.sub.2Cl.sub.2 and two drops of DMF and cooled to 0 C. Oxalyl chloride (54 L, 0.64 mmol) was slowly added over 15 min using a syringe. The reaction was allowed to warm up to r.t. for overnight. The solvent was removed under reduced pressure to afford the crude oil azidoacetyl chloride. To a solution of UDP-GlcNH.sub.2 F5-2 (30 mg, 0.049 mmol) in CH.sub.3CNH.sub.2O (30 mL, 1:1, v/v) in the presence of NaHCO.sub.3 (40 mg, 0.49 mmol), the azidoacetyl chloride in CH.sub.3CN (5 mL) was added. The reaction mixture was stirred for 4 hours at 0 C. and was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=5:2:1, by volume) to afford UDP-GlcNAz F5-6 in 68% yield (22 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.92 (d, J=8.4 Hz, 1H), 5.91-5.94 (m, 2H), 5.49 (dd, J=7.2, 3.6 Hz, 1H), 4.30-4.36 (m, 2H), 4.00-4.24 (m, 6H), 3.75-3.89 (m, 4H), 3.53 (t, J=9.6 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 171.13, 166.41, 151.98, 141.86, 102.84, 94.59, 88.80, 83.34 (d, J=9.0 Hz), 73.94, 73.25, 71.02, 69.81, 69.66, 65.24, 60.51, 53.94 (d, J=9.0 Hz), 52.69, 51.80. HRMS (ESI) m/z calcd for C.sub.17H.sub.26N.sub.6O.sub.17P.sub.2(M+H) 649.0908, found 649.0917.
(292) Uridine 5-diphospho-2-phenylacetamido-2-deoxy--D-glucopyranoside (UDP-GlcNAcPh, F5-7). 2-Phenylacetyl acid (33 mg, 0.25 mmol) was dissolved in 10 mL of CH.sub.2Cl.sub.2 and two drops of DMF. The mixture was cooled to 0 C. Oxalyl chloride (28 L, 0.33 mmol) was slowly added over 15 min using a syringe. The reaction was allowed to warm up to r.t. for overnight. The solvent was then removed under reduced pressure to afford 2-phenylacetyl chloride as a light pink solid. To a solution of UDP-GlcNH.sub.2 F5-2 (30 mg, 0.049 mmol) in CH.sub.3CNH.sub.2O (30 mL, 1:1, v/v) in the presence of NaHCO.sub.3 (40 mg, 0.49 mmol), the 2-phenylacetyl chloride in CH.sub.3CN (5 mL) was added. The reaction mixture was stirred for 4 hours at 0 C. and was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=6:2:1, by volume) to afford white solid UDP-GlcNAcPh F5-7 in 79% yield (26 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.83 (d, J=8.4 Hz, 1H), 7.32-7.35 (m, 2H), 7.26-7.29 (m, 3H), 5.90 (d, J=3.6 Hz, 1H), 5.83 (d, J=7.8 Hz, 1H), 5.54 (dd, J=6.6, 3.0 Hz, 1H), 4.16-4.30 (m, 5H), 3.77-4.00 (m, 5H), 3.67 (s, 2H), 3.54 (t, J=9.6 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 175.33, 166.16, 151.75, 141.64, 135.13, 129.36, 128.90, 127.26, 102.74, 94.77, 88.80, 83.08 (d, J=9 Hz), 73.80, 73.25, 70.97, 69.74, 69.65, 65.07, 60.50, 53.89 (d, J=8.7 Hz), 42.21. HRMS (ESI) m/z calcd for C.sub.23H.sub.31N.sub.3O.sub.17P.sub.2(M+H) 684.1207, found 684.1215.
(293) Uridine 5-diphospho-2-(1,1-biphenyl-4-yl)acetamido-2-deoxy--D-glucopyranoside (UDP-GlcNAcPh.sub.2, F5-8). UDP-GlcNAcPh.sub.2F5-8 was synthesized from UDP-GlcNH.sub.2 F5-2 using a similar procedure as described above for UDP-GlcNAcPh F5-7g except that the reagent 2-phenylacetyl acid was replaced by 2-([1,1-biphenyl]-4-yl)acetic acid. UDP-GlcNAcPh.sub.2 F5-8 was obtained as a white solid in 82% yield (31 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.69 (d, J=8.4 Hz, 1H), 7.64 (d, J=8.4 Hz, 2H), 7.59 (d, J=7.2 Hz, 2H), 7.45-7.47 (m, 2H), 7.34-7.41 (m, 3H), 5.79 (d, J=4.2 Hz, 1H), 5.64 (d, J=7.2 Hz, 1H), 5.53 (dd, J=6.6, 3.0 Hz, 1H) 4.14-4.19 (m, 5H), 4.01 (d, J=10.2 Hz, 1H), 3.92 (d, J=9.6 Hz, 1H), 3.65-3.85 (m, 5H), 3.53 (t, J=9.0 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 175.19, 165.92, 151.44, 141.31, 140.08, 139.12, 134.51, 129.90, 129.16, 127.75, 127.14, 126.80, 102.49, 94.76, 88.77, 82.87 (d, J=8.6 Hz), 73.82, 73.22, 71.01, 69.70, 69.44, 64.89, 60.46, 53.88 (d, J=8.4 Hz), 41.80. HRMS (ESI) m/z calcd for C.sub.29H.sub.35N.sub.3O.sub.17P.sub.2(M+H) 760.1520, found 760.1534.
(294) Uridine 5-diphospho-2-acetamido-6-amino-2,6-dideoxy--D-glucopyranoside (UDP-GlcNAc6NH.sub.2, F5-10). UDP-GlcNAc6N.sub.3 (T5b-12 or F5-9)(100 mg, 0.16 mmol) was dissolved in MeOHH.sub.2O (10 mL, 1:1, v/v) and 20 mg of Pd/C was added. The mixture was shaken under H.sub.2 gas (4 Bar) for 1 hr, filtered, and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=3:2:1, by volume) to afford UDP-GlcNAc6NH.sub.2 F5-10 in 96% yield (93 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.90 (d, J=8.4 Hz, 1H), 5.89-5.93 (m, 2H), 5.48 (dd, J=6.6, 3.0 Hz, 1H), 4.30-4.32 (m, 2H), 4.20-4.23 (m, 2H), 4.08-4.15 (m, 2H), 3.99 (d, J=10.8 Hz, 1H), 3.77 (t, J=9.6 Hz, 1H), 3.45 (d, J=13.2 Hz, 1H), 3.40 (t, J=9.6 Hz, 1H), 3.11 (t, J=12.6 Hz, 1H), 2.02 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 174.94, 166.39, 151.96, 141.84, 102.79, 94.33, 88.82, 83.29 (J=9.0 Hz), 73.92, 71.82, 69.80, 69.28, 65.30, 53.64 (J=8.9 Hz), 40.70, 22.21. HRMS (ESI) m/z calcd for C.sub.17H.sub.28N.sub.4O.sub.16P.sub.2(M+H).sup. 607.1054, found 607.1068.
(295) Uridine 5-diphospho-2-acetamido-6-hydroxyacetamido-2,6-dideoxy--D-glucopyranoside (UDP-GlcNAc6NGc, F5-12). UDP-GlcNAc6NGcAc F5-11 was synthesized from UDP-GlcNAc6NH.sub.2 F5-10 using the same process as described above for UDP-GlcNAcNGcAc F5-4. UDP-GlcNAc6NGcAc F5-11 was obtained as a white solid in 91% yield (31 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.91 (d, J=7.8 Hz, 1H), 5.91-5.93 (m, 2H), 5.46 (dd, J=6.6, 3.0 Hz, 1H), 4.62 (s, 2H), 4.30-4.34 (m, 2H), 4.14-4.24 (m, 3H), 3.95 (m, 2H), 3.76 (t, J=9.0 Hz, 1H), 3.61 (dd, J=14.4, 6.0 Hz, 1H), 3.54 (dd, J=14.4, 2.4 Hz, 1H), 3.35 (dd, J=14.4, 4.2 Hz, 1H), 2.15 (s, 3H), 2.03 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 174.85, 173.43, 170.60, 166.44, 151.95, 141.74, 102.70, 94.40, 88.70, 83.16, 73.87, 71.33, 70.89, 70.68, 69.66, 65.05, 62.88, 53.67, 39.59, 22.14, 20.13. UDP-GlcNAc6NGc F5-12 was synthesized from UDP-GlcNAc6NGcAc F5-11 using the same process as described above for UDP-GlcNGc F5-5 and obtained as a white solid in 98% yield (29 mg). .sup.1H NMR (600 MHz, D.sub.2O) 8.09 (d, J=7.8 Hz, 1H), 6.11-6.13 (m, 2H), 5.66 (dd, J=6.6, 3.0 Hz, 1H), 4.50-4.53 (m, 2H), 4.33-4.43 (m, 3H), 4.26 (s, 2H), 4.14-4.16 (m, 2H), 3.95 (t, J=9.9 Hz, 1H), 3.82 (d, J=14.4 Hz, 1H), 3.73 (dd, J=13.8, 6 Hz, 1H), 3.56 (t, J=10.2 Hz, 1H), 2.22 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 175.55, 175.05, 166.60, 152.20, 141.97, 102.99, 94.62, 88.99, 83.50 (d, J=8.9 Hz), 74.06, 71.47, 71.06, 69.97, 65.33, 61.35, 53.98 (d, J=8.4 Hz), 39.76, 22.42. HRMS (ESI) m/z calcd for C.sub.19H.sub.30N.sub.4O.sub.18P.sub.2(M+H) 665.1109, found 665.1113.
(296) Uridine 5-diphospho-2-acetamido-6-azidoacetamido-2,6-dideoxy--D-glucopyranoside (UDP-GlcNAc6NAcN.sub.3, F5-13). UDP-GlcNAc6NAcN.sub.3(F5-13) was synthesized from UDP-GlcNAc6NH.sub.2 (F5-10) using the same process as described above for UDP-GlcNAcN.sub.3 (F5-6). UDP-GlcNAc6NAcN.sub.3 (F5-13) was obtained as a white solid in 61% yield (21 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.89 (d, J=7.8 Hz, 1H), 5.91 (m, 2H), 5.43 (dd, J=6.6, 3.0 Hz, 1H), 4.32-4.29 (m, 2H), 4.19-4.22 (m, 3H), 4.00 (s, 2H), 3.92-3.95 (m, 2H), 3.74 (t, J=10.2 Hz, 1H), 3.54 (s, 1H), 3.34 (t, J=9.6 Hz, 1H), 2.01 (s, 3H). .sup.13C NMR (150 MHz, D20) 174.85, 170.93, 166.40, 151.92, 141.75, 104.99, 102.71, 94.42, 88.71, 83.16 (J=8.9 Hz), 73.87, 71.27, 71.01, 70.71, 69.67, 65.10, 53.72 (J=8.1 Hz), 51.80, 39.92, 22.14. HRMS (ESI) m/z calcd for C.sub.19H.sub.29N.sub.7O.sub.17P.sub.2(M+H) 690.1173, found 690.1180.
(297) Uridine 5-diphospho-2-acetamido-6-phenylacetamido-2,6-dideoxy--D-glucopyranoside (UDP-GlcNAc6NAcPh, F5-14). UDP-GlcNAc6NAcPh F5-14 was synthesized from UDP-GlcNAc6NH.sub.2 F5-10 using the same way as described above for UDP-GlcNAcPh (F5-7). UDP-GlcNAc6NAcPh (F5-14) was obtained as a white solid in 86% yield (30 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.87 (d, J=8.4 Hz, 1H), 7.36-7.38 (m, 2H), 7.29-7.32 (m, 3H), 5.87-5.89 (m, 2H), 5.48 (dd, J=6.6, 2.4 Hz, 1H), 4.16-4.29 (m, 5H), 3.92-3.98 (m, 2H), 3.78 (t, J=9.6 Hz, 1H), 3.53-3.65 (m, 4H), 3.30 (t, J=9.6 Hz, 1H), 2.05 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 175.37, 174.89, 166.26, 151.75, 141.64, 135.34, 129.22, 129.05, 127.38, 102.66, 94.50, 88.93, 83.12 (J=8.6 Hz), 73.94, 71.48, 71.06, 70.60, 69.51, 64.99, 53.79 (J=8.3 Hz), 42.43, 40.01, 22.19. HRMS (ESI) m/z calcd for C.sub.25H.sub.34N.sub.4O.sub.17P.sub.2(M+H) 725.1473, found 725.1484.
(298) Uridine 5-diphospho-2-acetamido-6-(1,1-biphenyl-4-yl)-acetamido-2,6-dideoxy--D-glucopyranoside (UDP-GlcNAc6NAcPh.sub.2, F5-15). UDP-GlcNAc6NAcPh.sub.2 (F5-15) was synthesized from UDP-GlcNAc6NH.sub.2 using the same way as described above for UDP-GlcNAcPh.sub.2 (F5-8). UDP-GlcNAc6NAcPh.sub.2 (F5-15) was obtained as a white solid in 88% yield (35 mg). .sup.1H NMR (600 MHz, D.sub.2O) 7.75 (d, J=7.8 Hz, 1H), 7.63 (d, J=7.2 Hz, 2H), 7.60 (d, J=7.2 Hz, 2H), 7.44-7.45 (m, 2H), 7.34-7.45 (m, 3H), 5.77-5.80 (m, 2H), 5.44 (dd, J=7.2, 3.6 Hz, 1H), 4.03-4.18 (m, 5H), 3.89-3.96 (m, 2H), 3.75 (t, J=9.6 Hz, 1H), 3.49-3.63 (m, 4H), 3.28 (t, J=9.0 Hz, 1H), 2.01 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 175.17, 174.79, 166.28, 151.63, 141.34, 140.12, 139.31, 134.70, 129.74, 129.18, 127.75, 127.30, 126.88, 102.44, 94.39, 88.87, 82.62 (d, J=8.7 Hz), 73.93, 71.18, 70.54, 69.27, 64.80, 53.77 (d, J=8.4 Hz), 42.03, 40.16, 22.09. HRMS (ESI) m/z calcd for C.sub.31H.sub.38N.sub.4O.sub.17P.sub.2(M+H) 801.1785, found 801.1807.
(299) Results and Discussion
(300) As shown in
(301) As shown in Table 5b, the one-pot three-enzyme system (
(302) TABLE-US-00006 TABLE 5b Synthesis of UDP-GlcNAc and its derivatives using the one-pot three- enzyme system shown in FIG. 4. ND, not detected. Yields Substrates Products (%)
(303) Taking advantage of the substrate promiscuity of NahK_ATCC55813 and PmGlmU, UDP-GlcNAc and a number of its natural and non-natural derivatives were synthesized efficiently by the one-pot three-enzyme system illustrated in Scheme 1. However, the success of the approach relied on the substrate promiscuity of all enzymes used. In order to increase the size of the library of UDP-GlcNAc derivatives with various modifications that can be used to test the activity of diverse GlcNAc-transferases, we further carried out chemical diversification of chemoenzymatically-produced UDP-GlcNAc derivatives.
(304) The N-TFA group in UDP-GlcNTFA (T5b-10) as well as the N.sub.3 group in UDP-GlcN.sub.3 (T5b-11) UDP-GlcNAc6N.sub.3 (T5b-12), and UDP-GlcN.sub.36S (T5b-15) can be easily converted to a free amine, allowing further modifications to generate a diverse array of N-substituted UDP-GlcNAc derivatives. As shown in
Example 3
Preparation of UDP-GalNAc
(305) One-pot three-enzyme synthesis of uridine 5-diphospho-2-acetamido-2-deoxy--D-glacopyranoside (UDP-GalNAc). GalNAc (100 mg, 1.0 eq), ATP (1.2 eq.), and UTP (1.2 eq.) were dissolved in water in a 50 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.0) and MgCl.sub.2 (10 mM). After the addition of NanK_ATCC55813 (3.5 mg), PmGlmU (5 mg), and PmPpA (2.5 mg), water was added to bring the volume of the reaction mixture to 20 mL. The reaction was carried out by incubating the solution in an isotherm incubator at 37 C. for 24 h with gentle shaking. Product formation was monitored by TLC (EtOAc:MeOH:H.sub.2O=3:2:1 by volume) with p-anisaldehyde sugar staining. The reaction was stopped by adding the same volume of ice-cold ethanol and incubating at 4 C. for 30 min. The mixture was concentrated and passed through a BioGel P-2 gel filtration column to obtain the desired product. Silica gel column purification (EtOAc:MeOH:H.sub.2O=4:2:1) was applied for further purification to give pure target compound. Yield, 83% (228 mg); white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.93 (d, J=8.4 Hz, 1H), 5.94-5.96 (m, 2H), 5.55 (dd, J=6.6, 3.0 Hz, 1H), 4.27-4.36 (m, 2H), 4.22-4.27 (m, 3H), 4.16-4.18 (m, 2H), 4.02 (d, J=3.0 Hz, 1H), 3.95 (dd, J=10.8, 3.0 Hz, 1H), 3.71-3.78 (m, 2H), 2.06 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 175.05, 166.31, 151.85, 141.89, 102.82, 94.75, 88.70, 83.03 (d, J=8.6 Hz), 73.97, 72.32, 69.79, 68.50, 67.64, 65.14, 61.17, 49.95 (d, J=7.8 Hz), 22.24. HRMS (ESI) m/z calcd for C.sub.17H.sub.28N.sub.3O.sub.17P.sub.2 (M+H) 608.0894, found 608.0906.
Example 4
Preparation of UDP-Sugars Using Sugar-1-P Kinases, BLUSP, and PmPpA
(306) General methods for compound purification and characterization. Chemicals were purchased and used without further purification. .sup.1H NMR and .sup.13C NMR spectra were recorded on a Varian Mercury 600 NMR spectrometer. High resolution electrospray ionization (ESI) mass spectra were obtained in negative mode using Thermo Electron LTQ-Orbitrap mass spectrometer. Silica gel 60 (Sorbent Technologies) was used for flash column chromatography. Thin-layer chromatography (TLC) was performed on silica gel plates 60 GF254 (Sorbent Technologies) using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm2.5 cm) packed with BioGel P-2 Fine resins (Bio-Rad). GlcN.sub.3 (T6-9) (Lau K, Thon, V, Yu H, Ding L, Chen Y, Muthana M M, Wong D, Huang R, and Chen X. Chem. Commun. 2010, 46, 6066-6068), ManF (T6-11) (Burkart M D, Zhang Z, Hung S-C, and Wong C-H. J. Am. Chem. Soc. 1997, 119, 11743-11746; Cao H, Li Y, Lau K, Muthana S, Yu H, Cheng J, Chokhawala H A, Sugiarto G, Zhang L, and Chen X. Org. Biomol. Chem. 2009, 7, 5137-5145), GalN.sub.3 (T6-4) and ManN.sub.3 (T6-14) (Yu H, Yu H, Karpel R, cand Chen X. Bioorg. Med. Chem. 2004, 12, 6427-6435) were previously synthesized using reported methods. NahK_ATCC15697, EcGalK, SpGalK, and PmPpA were overexpressed as described previously.
(307) One-pot multienzyme synthesis of UDP-sugars. Monosaccharides and derivatives (30-100 mg, 1.0 eq.), ATP (1.2 eq.), and UTP (1.3 eq.) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.0) and MgCl.sub.2 (10 mM). After the addition of appropriate amount of NahK_ATCC15697, EcGalK, or SpGalK (1.3-4.5 mg), BLUSP (1.0-2.5 mg), and PmPpA (1.5-2.5 mg), millipore water was added to bring the total volume of the reaction mixture to 10 mL. The reaction was carried out by incubating the solution in an isotherm incubator for 24 hr at 37 C. with gentle shaking or without shaking. In the synthesis of UDP-Glc, commercially available Glc-1-P (55.2 mg), UTP (1.2 eq.), Tris-HCl buffer (100 mM, pH 8.0), and MgCl.sub.2 (10 mM) were used along with BLUSP (1 mg) and PmPpA (1.5 mg). The reaction was left for 2 hr at 37 C. in isotherm with gentle shaking. Product formation was monitored by TLC (EtOAc:MeOH:H.sub.2O:AcOH=5:3:3:0.3 by volume) with p-anisaldehyde sugar staining. The reaction was terminated by adding the same volume of ice-cold ethanol and incubating at 4 C. for 30 min followed by centrifugation remove the enzymes. The supernatant was collected and concentrated and passed through a BioGel P-2 gel filtration column to afford the product. Silica gel column purification (EtOAc:MeOH:H.sub.2O=7:3:2) was applied when necessary to achieve further purification.
(308) Uridine 5-diphospho--D-galactopyranoside (UDP-Gal, T6-16). 135 mg. Yield, 86%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.93 (d, J=8.4 Hz, 1H), 5.97-5.95 (m, 2H), 5.63 (dd, J=7.2, 3.6 Hz, 1H), 4.37-4.35 (m, 2H), 4.28-4.18 (m, 3H), 4.16 (t, J=6 Hz, 1H), 4.02 (d, J=3 Hz, 1H), 3.90 (dd, J=10.2, 3.6 Hz, 1H), 3.80 (dt, J=10.2, 3.3 Hz, 1H), 3.76-3.71 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 166.39, 151.96, 141.78, 102.80, 96.01 (d, J=6.6 Hz), 88.65, 83.32 (d, J=8.9 Hz), 73.93, 72.11, 69.78, 69.43, 69.24, 68.50 (d, J=7.8 Hz), 65.15 (d, J=5.0 Hz), 61.16. HRMS (ESI) m/z calcd for C.sub.15H.sub.24N.sub.2O.sub.17P.sub.2 (MH) 565.0472, found 565.0453.
(309) Uridine 5-diphospho--D-glucopyranoside (UDP-Glc, T6-21). 82 mg. Yield, 99%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.94 (d, J=8.4 Hz, 1H), 5.98-5.96 (m, 2H), 5.59 (dd, J=7.2, 3.6 Hz, 1H), 4.37-4.35 (m, 2H), 4.28-4.18 (m, 3H), 3.9-3.83 (m, 2H), 3.78-3.74 (m, 2H), 3.53 (dt, J=9.6, 3.3 Hz, 1H), 3.46 (t, J=9.6 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.20, 151.75, 141.52, 102.57, 95.51 (d, J=6.8 Hz), 88.35, 83.07 (d, J=8.9 Hz), 73.67, 72.72 (2C), 71.45 (d, J=8.4 Hz), 69.52, 69.05, 64.86 (d, J=5.6 Hz), 60.20. HRMS (ESI) m/z calcd for C.sub.15H.sub.24N.sub.2O.sub.17P.sub.2 (MH) 565.0472, found 565.0458.
(310) Uridine 5-diphospho-2-deoxy--D-glucopyranoside (UDP-2-deoxyGlc, T6-22). 96 mg. Yield, 56%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.95 (d, J=8.4 Hz, 1H), 5.96-5.95 (m, 2H), 5.70 (dd, J=7.2, 1.8 Hz, 1H), 4.36-4.33 (m, 2H), 4.27-4.16 (m, 3H), 4.0-3.95 (m, 1H), 3.86-3.75 (m, 3H), 3.39 (t, J=9.6 Hz, 1H), 2.28-2.24 (m, 1H), 1.74-1.68 (m, 1H), (150 MHz, D.sub.2O) 168.99, 154.54, 144.38, 105.38, 97.63 (d, J=5.7 Hz), 91.25, 85.86 (d, J=9.0 Hz), 76.51, 76.13, 73.33, 72.32, 70.46, 67.63 (d, J=5.0 Hz), 63.21, 40.18 (d, J=7.2 Hz), HRMS (ESI) m/z calcd for C.sub.15H.sub.24N.sub.2O.sub.16P.sub.2 (MH) 549.0523, found 549.0513.
(311) Uridine 5-diphospho-2-amino-2-deoxy--D-glucopyranoside (UDP-GlcNH.sub.2, T6-23). 56 mg. Yield, 43%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.93 (d, J=7.8 Hz, 1H), 5.97-5.94 (m, 2H), 5.82 (d, J=6.0 Hz, 1H), 4.36-4.34 (m, 2H), 4.28-4.17 (m, 3H), 3.92-3.90 (m 2H), 3.86 (dd, J=12.0, 2.4 Hz, 1H), 3.81 (dd, J=12.6, 4.2 Hz, 1H), 3.55 (t, J=9.9 Hz, 1H), 3.37 (d, J=10.8 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.40, 151.93, 141.75, 102.71, 92.87, 88.74, 83.21 (d, J=9 Hz), 73.91, 73.39, 69.85, 69.69, 69.16, 65.23, 60.09, 54.27 (d, J=8.4 Hz). HRMS (ESI) m/z calcd for C.sub.15H.sub.25N.sub.3O.sub.16P.sub.2 (MH) 564.0632, found 564.0619.
(312) Uridine 5-diphospho-2-azido-2-deoxy--D-glucopyranoside (UDP-GlcN.sub.3, T6-24). 88 mg, Yield, 61%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.95 (d, J=8.4 Hz, 1H), 5.96-5.95 (m, 2H), 5.67 (dd, J=7.2, 3 Hz, 1H), 4.36-4.33 (m, 2H), 4.27-4.18 (m, 3H), 3.93-3.88 (m, 2H), 3.85-3.76 (m, 2H), 3.53 (t, J=9.6 Hz, 1H), 3.38 (d, J=10.8 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.14, 151.75, 141.61, 102.79, 94.39 (d, J=4.5 Hz), 88.47, 83.48 (d, J=8.4 Hz), 73.68, 72.85, 70.61, 69.53, 69.24, 64.87, 62.71 (d, J=7.8 Hz), 60.05. HRMS (ESI) m/z calcd for C.sub.15H.sub.23N.sub.5O.sub.16P.sub.2 (MH) 590.0537, found 590.0524.
(313) Uridine 5-diphospho--D-mannopyranoside (UDP-Man, T6-26). 60 mg. Yield, 60%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.93 (d, J=8.4 Hz, 1H), 5.96-5.94 (m, 2H), 5.51 (d, J=7.2, 1H), 4.35-4.18 (m, 5H), 4.02 (m, 1H), 3.89-3.82 (m, 3H), 3.75 (dd, J=12, 4.8 Hz, 1H), 3.67 (t, J=9.9 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.40, 151.94, 141.77, 102.79, 96.64 (d, J=5.5), 88.70, 83.24 (d, J=8.7 Hz), 73.93, 73.91, 70.38 (d, J=9.3 Hz), 69.98, 69.74, 66.56, 65.15 (d, J=4.7 Hz), 60.92. HRMS (ESI) m/z calcd for C.sub.15H.sub.24N.sub.2O.sub.17P.sub.2 (MH) 565.0472, found 565.0467.
(314) Uridine 5-diphospho-2-fluoro-2-deoxy--D-mannopyranoside (UDP-ManF, T6-27). 142 mg. Yield, 92%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.94 (d, J=8.4 Hz, 1H), 5.97-5.95 (m, 2H), 5.70 (t, J=6.3 Hz, 1H), 4.39-4.35 (m, 2H), 4.36-4.33 (m, 2H), 4.28-4.16 (m, 3H), 4.00 (ddd, J=30.6, 9.6, 2.4 Hz, 1H), 3.88-3.86 (m, 2H), 3.79 (d, J=12.6, 4.8 Hz, 1H), 3.74 (t, J=9.9 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.42, 151.98, 141.80, 102.84, 93.75 (dd, J=31.2, 5.7 Hz), 89.75 (dd, J=173.6, 10.5 Hz), 88.75, 83.26 (d, J=9.0 Hz), 73.95, 73.84, 69.76, 69.32 (d, J=17.3 Hz), 66.46, 65.15 (d, J=5.1 Hz) 60.46. HRMS (ESI) m/z calcd for C.sub.15H.sub.23FN.sub.2O.sub.16P.sub.2 (MH) 567.0429, found 567.0426.
(315) Uridine 5-diphospho-2-azido-2-deoxy--D-mannopyranoside (UDP-ManN.sub.3, T6-29). 259 mg, Yield, 90%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.96 (d, J=8.4 Hz, 1H), 6.00-5.98 (m, 2H), 5.62 (d, J=7.2 Hz, 1H), 4.39-4.35 (m, 2H), 4.31-4.18 (m, 3H), 4.16-4.13 (m, 2H), 3.87-3.83 (m, 2H), 3.77 (dd, J=12.6, 4.8 Hz, 1H), 3.70 (t, J=9.6 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) 166.42, 151.97, 141.81, 102.84, 94.86 (d, J=5.7 Hz), 88.80, 83.24 (d, J=8.9 Hz), 73.96, 73.95, 70.09, 69.74, 66.49, 65.16 (d, J=5.0 Hz), 64.18 (d, J=9.5 Hz) 60.64. HRMS (ESI) m/z calcd for C.sub.15H.sub.23N.sub.5O.sub.16P.sub.2 (MH) 590.0537, found 590.0532.
(316) Uridine 5-diphospho-2-acetamido-2-deoxy--D-mannopyranoside (UDP-ManNAc, T6-30). Yield for two steps from UDP-ManN.sub.3 (T6-29), 79%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.96 (d, J=7.8 Hz, 1H), 5.98-5.95 (m, 2H), 5.44 (dd, J=7.8, 1.8 Hz, 1H), 4.43 (dd, J=4.8, 1.8 Hz, 1H), 4.37-4.34 (m, 2H), 4.28-4.22 (m, 2H), 4.19-4.15 (m, 1H), 4.11 (dd, J=10.2, 4.8 Hz, 1H), 3.90 (dt, J=10.2, 3.0 Hz, 1H), 3.85 (d, J=3.6 Hz, 1H), 3.62 (t, J=10.2 Hz, 1H), 2.03 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 175.59, 166.16, 151.75, 141.55, 102.57, 95.35, 88.23, 83.17 (d, J=8.9 Hz), 73.73, 73.20, 69.58, 68.72, 66.29, 64.82, 59.23, 52.94 (d, J=8.9 Hz), 21.85. HRMS (ESI) m/z calcd for C.sub.17H.sub.27N.sub.3O.sub.17P.sub.2(MH) 606.0737, found 606.0723.
(317) TABLE-US-00007 TABLE 6 Synthesis of UDP-monosaccharides using the one-pot three-enzyme system shown in FIG. 9. ND, not detected. Substrate Kinase Product Yield (%)
(318) We were able to identify at least one of these kinases for each monosaccharide that gave a yield higher than 58% for the formation of the corresponding monosaccharide-1-phosphate. The observed results from thin-layer chromotography (TLC) and capillary electrophoresis (CE) (Table 7) confirmed the previously reported activities of NahK, SpGalK, and EcGalK toward their respective substrates except for mannosamine (T6-13), a NahK substrate which was not previously tested.
(319) TABLE-US-00008 TABLE 7 Yields of the kinase reactions monitored by the conversion of ATP to ADP in capillary electrophoresis (CE) assays. Abbreviation: NA, not assayed. ATP Conversion (%) Substrate Kinase 1 hr 4 hr 24 hr No No <2 <5 11.1 T6-1 Gal SpGalK 92.2 NA NA T6-1 Gal EcGalK 90.3 NA NA T6-2 2-deoxyGal SpGalK 80.3 89.5 NA T6-2 2-deoxyGal EcGalK 78.5 87.6 NA T6-3 GalNH.sub.2 EcGalK 90.2 NA NA T6-4 GalN.sub.3 SpGalK 45.7 79.0 81.2 T6-5 GalNAc SpGalK 11.8 24.7 69.5 Glc EcGalK 8.2 13.0 66.4 Glc SpGalK 6.9 13.8 75.5 Glc NahK 10.3 18.6 82.2 T6-7 2-deoxyGlc NahK 36.8 69.6 79.4 T6-8 GlcNH.sub.2 NahK 11.9 28.0 67.1 T6-9 GlcN.sub.3 NahK 12.4 25.9 71.2 T6-10 GlcNAc NahK 72.6 84.6 85.5 T6-11 Man NahK 29.6 69.3 75.1 T6-12 Man2F NahK 57.9 67.9 78.2 T6-13 ManNH.sub.2 NahK 10.3 22.8 58.0 T6-14 ManN.sub.3 NahK 34.9 65.9 76.4 T6-15 ManNAc NahK 11.4 26.1 73.8
(320) The synthesis of all other UDP-sugars in Table 6 was carried out using the one-pot three-enzyme system shown in
(321) Although UDP-ManNH.sub.2 (T6-28) and UDP-ManNAc (T6-30) were not directly available from ManNH.sub.2 (T6-13) and ManNAc (T6-15), respectively, via the one-pot three-enzyme reaction shown in
Example 5
Synthesis of UDP-Uronic Acids Using AtGlcAK, BLUSP, and PmPpA
(322) Mass spectrometry analysis of one-pot multienzyme synthesis of UDP-GlcA, UDP-IdoA, and UDP-GalA. Enzymatic assays were carried out at in a total volume of 10 L in Tris-HCl buffer (100 mM, pH 7.5) containing GlcA (GalA, or IdoA) (10 mM), ATP (20 mM), MgCl.sub.2 (20 mM), and AtGlcAK (23 g). Reactions were allowed to proceed at 37 C. for 15 hr and monitored using thin-layer chromatographic analysis using n-PrOH:H.sub.2O:NH.sub.4OH=7:4:2 (by volume) as a developing solvent. p-Anisaldehyde sugar stain followed by heating the TLC plates on hot plate was used for visualizing compounds on the TLC plates. After 24 hr, BLUSP (5 g), PmPpA (5 g) and UTP (12 mM) were added to the reaction mixture. The reactions were allowed to proceed at 37 C. for another 24 hr. The reactions were then quenched with the same volume of 100% ethanol, centrifuged at 13000 rpm for 2 min, and the reaction mixtures were stored at 20 C.
(323) For LC-MS analysis, 2 L of each sample was diluted 100-fold and 8 L was injected to a Waters spherisorb ODS-2 column (5 m particles, 250 mm length, 4.6 mm I.D.). Each sample was eluted with 30% acetonitrile in H.sub.2O and detected by ESI-MS in the negative mode.
(324) AtGlcAK was shown to be active on GlcA, GalA, and IdoA by TLC and LC-MS analyses. One-pot three-enzyme strategy containing AtGlcAK, BLUSP, and PmPpA (
Example 6
Preparation of GlcNAc1-4GlcA Disaccharide Derivatives
(325) General methods for compound purification and characterization. Chemicals were purchased and used without further purification. .sup.1H NMR and .sup.13C NMR spectra were recorded on Varian VNMRS 600 MHz and Bruker Avance 800 MHz spectrometer. High resolution electrospray ionization (ESI) mass spectra were obtained at the Mass Spectrometry Facility in the University of California, Davis. Silica gel 60 (Sorbent Technologies) was used for flash column chromatography. Analytical thin-layer chromatography (Sorbent Technologies) was performed on silica gel plates using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm2.5 cm) packed with BioGel P-2 Fine resins. ATP, UTP, GlcNAc, Glc-1-P, NAD.sup.+, and glucuronolactone were purchased from Sigma. GlcNTFA, GlcNAc6N.sub.3, UDP-GlcNGc, UDP-GlcNAz, UDP-GlcNAc6NGc were synthesized as described previously. NanK_ATCC55813, PmGlmU and PmPpA were overexpressed as reported.
(326) Chemical synthesis of GlcA2AAMe. GlcA2AAMe was Synthesized as Outlined in
(327) Synthesis of F13-2. Glucuronolactone F13-1 (2.0 g, 11.3 mmol) was dissolved in dry MeOH (12 mL) under N.sub.2. To the solution, 20 mg of sodium methoxide was added. The reaction was stirred at room temperature for 3 hours, and then MeOH was removed in vacuo. The resulting syrup was further dried under high-vacuum. The above product was dissolved in pyridine (10 mL) and acetic anhydride (8 mL) under 0 C. and N.sub.2. The reaction was stirred from 0 C. to room temperature overnight. The mixture was concentrated and purified by flash column chromatography (Hexane:EtOAc:=1:1, by volume) to provide white solid F13-2 in 67% yield. -isomer: .sup.1H NMR (600 MHz, CDCl.sub.3) 5.76 (d, J=7.8 Hz, 1H), 5.30 (t, J=9.6 Hz, 1H), 5.25 (t, J=9.6 Hz, 1H), 5.13 (t, J=7.8 Hz, 1H), 4.17 (d, J=9.6 Hz, 1H), 3.73 (s, 3H), 2.10 (s, 3H), 2.03 (s, 6H), 2.02 (s, 3H). .sup.13C NMR (150 MHz, D.sub.2O) 170.13, 169.65, 169.53, 168.61, 167.37, 88.90, 70.51, 69.24, 69.07, 69.00, 53.17, 20.95, 20.79, 20.61, 20.55. -isomer: .sup.1H NMR (600 MHz, CDCl.sub.3) 6.39 (d, J=3.6 Hz, 1H), 5.51 (t, J=10.2 Hz, 1H), 5.22 (t, J=10.2 Hz, 1H), 5.12 (dd, J=10.2, 3.6 Hz, 1H), 4.41 (d, J=10.2 Hz, 1H), 3.74 (s, 3H), 2.15 (s, 3H), 2.04 (s, 3H), 2.03 (s, 3H), 2.01 (s, 3H). .sup.13C NMR (150 MHz, CDCl.sub.3) 170.04, 169.56, 169.32, 168.98, 166.95, 91.48, 73.11, 71.94, 70.27, 69.06, 53.18, 20.93, 20.72, 20.70, 20.63.
(328) Synthesis of methyl 2,3,4-tri-O-acetyl-D-glucopyranuronate F13-3. Methyl 1,2,3,4-tetra-O-acetyl-D-glucopyranuronate F13-2 (1.2 g, 3.2 mmol) was dissolved in dry DMF (10 mL) under N.sub.2. To the solution, benzylamine (0.42 mL, 3.8 mmol) was added. The mixture was stirred at r.t. for 16 hours. The solvent was removed under reduced pressure and the residue was purified by flash chromatography (Hexane:EtOAc:=1:2, by volume) to afford a white solid F13c in 84% yield. .sup.1H NMR (600 MHz, CDCl.sub.3) 5.50-5.55 (m, 1H), 5.11-5.27 (m, 1H), 4.85-4.91 (m, 1H), 5.39-4.56 (m, 2H), 3.70-3.72 (m, 3H), 1.99-2.05 (m, 9H). .sup.13C NMR (150 MHz, CDCl.sub.3) 170.68, 170.45, 170.34, 170.30, 169.94, 169.81, 168.77, 167.83, 95.59, 90.36, 72.98, 72.66, 71.81, 70.97, 69.73, 69.61, 69.34, 68.12, 53.21, 53.11, 20.85, 20.84, 20.77, 20.70, 20.66, 20.65.
(329) Synthesis of methyl 2,3,4-tetra-O-acetyl-1-O-(3-chloropropyl)--D-glucopyranuronate F13-5. Methyl 2,3,4-tri-O-acetyl-D-glucopyranuronate F13-3 (800 mg, 2.4 mmol) was dissolved in 8 mL dichloromethane. Trichloroacetonitrile (1.3 mL, 12 mmol) was added under N.sub.2. After cooling to 0 C., 1,8-diazabicyclo[5.4.0]undee-7-ene (1,8-DBU) was added in a drop-wise manner until the color of sodium changes to brown. The reaction mixture was allowed to stir for 1 h and the mixture was concentrated to afford a sticky dark brown residue. The flash column chromatography (Hexane:EtOAc=3:2, by volume) gives an off-white product F13-4 in 88% yield. To the mixture of S4 (200 mg, 0.42 mmol) and MS 4A, 8 mL dichloromethane was added, followed by 3-chloropropanol (0.25 mL, 2.1 mmol). The mixture was stirred for 30 min at room temperature under N.sub.2. After cooling to 0 C., boron trifluoride ether complex (0.06 mL, 0.42 mmol) was added drop-wisely. The reaction was stirred at 0 C. for 3 hours. After the TLC showed the reaction is completed, the mixture was filtered and the filtrate was washed with saturated NaHCO.sub.3. The organic layer was evaporated to give a crude residue which was purified by silica gel chromatography (Hexane:EtOAc:=3:2, by volume) to provide the product F13-5 in 64% yield. .sup.1H NMR (600 MHz, CDCl.sub.3) 5.17-5.28 (m, 2H), 4.97-5.00 (dd, J=9.6, 7.8 Hz, 1H), 4.53-4.54 (d, J=7.8 Hz, 1H), 4.02-4.04 (d, J=9.6 Hz, 1H), 3.99-4.01 (dd, J=9.6, 4.8 Hz, 1H), 3.27 (s, 3H), 3.66-3.70 (m, 1H), 3.57-3.59 (m, 2H), 2.05-2.09 (m, 1H), 2.04 (s, 3H), 2.01 (s, 3H), 2.00 (s, 3H), 1.91-1.95 (m 1H). .sup.13C NMR (150 MHz, CDCl.sub.3) 170.30, 169.59, 169.52, 167.37, 101.21, 72.78, 72.14, 71.33, 69.62, 66.79, 53.13, 41.48, 32.29, 20.83, 20.82, 20.71.
(330) Synthesis of methyl 2,3,4-tetra-O-acetyl-1-O-(3-azidoopropyl)--D-glucopyranuronate F13-6. Methyl 2,3,4-tetra-O-acetyl-1-O-(3-chloropropyl)--D-glucopyranuronate F13-5 (412 mg, 1.0 mmol) was dissolved in 10 mL of DMF. To the solution, sodium azide (325 mg, 5.0 mmol) was added. The reaction was stirred at 65 C. overnight. The solvent was removed under reduced pressure and the residue was purified by flash chromatography (Hexane:EtOAc=3:2, v/v) to afford a white solid in 92% yield. .sup.1H NMR (600 MHz, CDCl.sub.3) 5.19-5.27 (m, 2H), 4.99-5.02 (t, J=7.8 Hz, 1H), 4.54-4.55 (d, J=7.8 Hz, 1H), 4.02-4.04 (d, J=9.6 Hz, 1H), 3.94-3.95 (m, 1H), 3.75 (s, 3H), 3.58-3.62 (m, 1H), 3.32-3.39 (m, 2H), 2.04 (s, 3H), 2.01 (s, 3H), 1.78-1.89 (m 2H). .sup.13C NMR (150 MHz, CDCl.sub.3) 170.27, 169.53, 169.40, 167.34, 101.01, 72.82, 72.23, 71.39, 69.60, 66.92, 53.09, 48.10, 29.11, 20.81, 20.79, 20.68.
(331) Synthesis of 1-O-(3-azidoopropyl)--D-glucopyranuronic acid F13-7. Methyl 2,3,4-tetra-O-acetyl-1-O-(3-azidoopropyl)--D-glucopyranuronate F13-6 (350 mg, 0.84 mmol) was dissolved in 5 mL MeOH. To the solution, sodium methoxide was added until the pH go to 9.5. The reaction was stirred at room temperature for 1 hr. After the TLC showed the reaction is completed, potassium hydroxide (60 mg, 2.52 mmol) and 10 mL water was added. After stirred at r.t. for 3 hours, the mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=6:2:1, by volume) to afford white solid F13-7 in 79% yield. .sup.1H NMR (600 MHz, D.sub.2O) 4.45-4.47 (d, J=7.8 Hz, 1H), 3.95-3.99 (m, 1H), 3.81-3.82 (d, J=9.0 Hz, 1H), 3.71-3.75 (m, 1H), 3.49-3.54 (m, 2H), 3.42-3.45 (t, J=6.6 Hz, 2H), 3.28-3.31 (t, J=8.4 Hz, 1H), 1.86-1.91 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.17, 102.36, 75.91, 75.64, 73.06, 71.86, 67.57, 48.05, 28.39.
(332) Synthesis of GlcA2AAMe (F13-8). 1-O-(3-Azidoopropyl)--D-glucopyranuronic acid F13-7 (100 mg, 0.44 mmol) was dissolved in 10 mL MeOH and 20 mg of Pd/C was added. The mixture was shaken under H.sub.2 gas (4 Bar) for 1 h, filtered, and concentrated. The residue was further dried in high-vacuum. To a solution of the amine residue in 10 mL of DMF-MeOH (1:1, v/v), dry triethylamine (61 L) was added under N.sub.2. Then 2-(methoxycarbonyl) succinanilic acid NHS ester.sup.3 (2AA-OSu, 306 mg, 0.88 mmol) was added at 0 C. The reaction mixture was stirred at room temperature for overnight. The reaction mixture was concentrated and the residue was purified by silica gel chromatography (EtOAc:MeOH:H.sub.2O=8:2:1, by volume) to afford white solid GlcA2AAMe (F13-8) in 83% yield. .sup.1H NMR (600 MHz, D.sub.2O) 7.88-7.89 (d, J=8.4 Hz, 1H), 7.79-7.80 (d, J=7.8 Hz, 1H), 7.48-7.51 (t, J=7.8 Hz, 1H), 7.12-7.15 (t, J=7.8 Hz, 1H), 4.27-4.29 (d, J=7.8 Hz, 1H), 3.83-3.86 (m, 1H), 3.81 (s, 3H), 3.58-3.60 (d, J=9.6 Hz, 1H), 3.53-3.57 (m, 1H), 3.40-3.47 (m, 2H), 3.24-3.30 (m, 2H), 3.18-3.22 (m, 1H), 2.61-2.64 (t, J=7.2 Hz, 2H), 2.52-2.54 (t, J=7.2 Hz, 2H), 1.72-1.77 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.17, 174.18, 172.66, 168.75, 137.89, 134.16, 130.81, 124.41, 121.83, 118.36, 101.96, 75.66, 75.46, 72.83, 71.68, 67.35, 52.63, 36.04, 32.61, 30.83, 28.23.
(333) One-pot four-enzyme synthesis of disaccharides F18a-F18c. As shown in
(334) GlcNAc1-4GlcA2AAMe F18-1. Yield: 95%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.95-7.96 (d, J=8.4 Hz, 1H), 7.81-7.83 (d, J=8.4 Hz, 1H), 7.61-7.64 (t, J=7.8 Hz, 1H), 7.29-7.32 (t, J=8.4 Hz, 1H), 5.38-5.39 (d, J=3.6 Hz, 1H), 4.32-4.33 (d, J=7.8 Hz, 1H), 3.89 (s, 3H), 3.79-3.88 (m, 4H), 3.70-3.73 (m, 4H), 3.60-3.63 (m, 1H), 3.55-3.58 (m, 1H), 3.45-3.48 (t, J=9.6 Hz, 1H), 3.20-3.32 (m, 3H), 2.73-2.75 (t, J=6.6 Hz, 2H), 2.58-2.61 (t, J=7.2 Hz, 2H), 2.04 (s, 3H), 1.73-1.78 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.15, 174.61, 174.51, 173.61, 169.24, 137.16, 134.12, 130.99, 125.45, 123.57, 121.10, 102.21, 96.98, 76.96, 76.69, 75.90, 73.56, 72.01, 70.86, 69.80, 67.58, 60.22, 53.83, 52.93, 36.23, 32.59, 31.20, 28.40, 22.06. HRMS (ESI) m/z calcd for C.sub.29H.sub.42N.sub.3O.sub.16 (M+H) 688.2560, found 688.2563.
(335) GlcNTFA1-4GlcA2AAMe F18-2. Yield: 84%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.95-7.97 (d, J=7.8 Hz, 1H), 7.88-7.89 (d, J=7.8 Hz, 1H), 7.62-7.65 (t, J=7.8 Hz, 1H), 7.30-7.32 (t, J=7.8 Hz, 1H), 5.50-5.51 (d, J=3.6 Hz, 1H), 4.34-4.35 (d, J=7.8 Hz, 1H), 4.02-4.04 (dd, J=10.8, 4.2 Hz, 1H), 3.91 (s, 3H), 3.83-3.88 (m, 4H), 3.75-3.77 (m, 3H), 3.63-3.66 (m, 1H), 3.57-3.61 (m, 1H), 3.51-3.55 (t, J=9.6 Hz, 1H), 3.23-3.34 (m, 3H), 2.74-2.76 (t, J=6.6 Hz, 2H), 2.61-2.63 (t, J=7.2 Hz, 2H), 1.77-1.81 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.15, 174.63, 173.50, 169.26, 159.45 (q, J=37.6 Hz), 137.49, 134.28, 131.09, 125.33, 123.27, 120.52, 117.02 (q, J=284.7 Hz), 102.29, 96.51, 76.90, 76.73, 76.13, 73.61, 72.21, 70.40, 69.85, 67.73, 60.32, 54.54, 53.00, 36.34, 32.75, 31.26, 28.51. HRMS (ESI) m/z calcd for C.sub.29H.sub.39F.sub.3N.sub.3O.sub.16 (M+H) 742.2277, found 742.2284.
(336) GlcNAc6N.sub.31-4GlcA2AAMe F18-3. Yield: 89%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.97-7.98 (d, J=7.8 Hz, 1H), 7.82-7.84 (d, J=8.4 Hz, 1H), 7.63-7.66 (t, J=7.2 Hz, 1H), 7.32-7.34 (t, J=7.2 Hz, 1H), 5.40-5.41 (d, J=3.6 Hz, 1H), 4.34-4.35 (d, J=7.8 Hz, 1H), 3.91 (s, 3H), 3.83-3.90 (m, 3H), 3.70-3.73 (m, 3H), 3.57-3.63 (m, 4H), 3.47-3.51 (t, J=9.6 Hz, 1H), 3.22-3.33 (m, 3H), 2.74-2.77 (t, J=6.6 Hz, 2H), 2.60-2.62 (t, J=7.2 Hz, 2H), 2.05 (s, 3H), 1.75-1.79 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.06, 174.64, 174.53, 173.69, 169.28, 137.07, 134.10, 130.99, 125.54, 123.75, 121.38, 102.21, 97.07, 76.88, 76.80, 76.04, 73.57, 70.85, 70.65, 70.44, 67.60, 53.76, 52.94, 50.62, 36.26, 32.58, 31.23, 28.41, 22.07. HRMS (ESI) m/z calcd for C.sub.29H.sub.41N.sub.6O.sub.15 (M+H) 713.2625, found 713.2630.
(337) Chemical derivatization of GlcNTFA1-4GlcA2AAMe (F18-2) to form disaccharide GlcNH.sub.21-4GlcA2AA (F24-9). Disaccharide GlcNTFA1-4GlcA2AAMe (F18-2) (20 mg, 0.027 mmol) was dissolved in 8 mL of H.sub.2O. The pH of the solution was adjusted to 10 by adding 1 N NaOH. After being vigorously stirred at r.t. for 1.5 hr, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=3:2:1, by volume) to obtain a white solid GlcNH.sub.21-4GlcA2AA (F24-9) in 86% yield. .sup.1H NMR (600 MHz, D.sub.2O) 8.14-8.15 (d, J=8.4 Hz, 1H), 7.87-7.88 (d, J=7.8 Hz, 1H), 7.49-7.51 (t, J=7.8 Hz, 1H), 7.20-7.22 (t, J=6.6 Hz, 1H), 5.65-5.66 (d, J=3.0 Hz, 1H), 4.26-4.27 (d, J=7.8 Hz, 1H), 3.72-3.85 (m, 8H), 3.66-3.67 (t, J=8.4 Hz, 1H), 3.46-3.52 (m, 2H), 3.20-3.35 (m, 3H), 2.74-2.76 (t, J=6.6 Hz, 2H), 2.61-2.63 (t, J=6.6 Hz, 2H), 1.73-1.74 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.15, 174.77, 174.68, 173.01, 137.67, 131.91, 130.82, 125.32, 124.25, 120.95, 102.28, 97.77, 76.77, 76.51, 76.32, 73.27, 72.32, 69.60, 67.61, 61.37, 60.24, 54.95, 36.21, 33.50, 31.57, 28.43. HRMS (ESI) m/z calcd for C.sub.26H.sub.38N.sub.3O.sub.15 (M+H) 632.2303, found 632.2321.
(338) PmHS2-catalyzed synthesis of disaccharides F18-4F186. As shown in
(339) GlcNGc1-4GlcA2AAMe F18-4. Yield: 92%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.97-7.98 (d, J=7.8 Hz, 1H), 7.81-7.82 (d, J=8.4 Hz, 1H), 7.62-7.65 (t, J=7.2 Hz, 1H), 7.31-7.34 (t, J=8.4 Hz, 1H), 5.39-5.40 (d, J=3.6 Hz, 1H), 4.32-4.33 (d, J=7.8 Hz, 1H), 4.13 (s, 2H), 3.94-3.96 (dd, J=10.8, 4.2 Hz, 1H), 3.90 (s, 3H), 3.77-3.86 (m, 4H), 3.71-3.75 (m, 3H), 3.61-3.64 (m, 1H), 3.55-3.59 (m, 1H), 3.48-3.51 (t, J=9.6 Hz, 1H), 3.20-3.30 (m, 3H), 2.74-2.76 (t, J=6.6 Hz, 2H), 2.59-2.61 (t, J=7.2 Hz, 2H), 1.74-1.78 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.18, 175.12, 174.62, 173.67, 169.26, 137.05, 134.08, 130.97, 125.52, 123.72, 121.35, 102.19, 97.05, 76.93, 76.66, 76.03, 73.48, 72.06, 70.81, 69.72, 67.57, 61.03, 60.17, 53.45, 52.92, 36.22, 32.56, 31.20, 28.38. HRMS (ESI) m/z calcd for C.sub.29H.sub.42N.sub.3O.sub.17 (M+H) 704.2509, found 704.2516.
(340) GlcNAz1-4GlcA2AAMe F18-5. Yield: 91%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.97-7.99 (d, J=7.8 Hz, 1H), 7.82-7.83 (d, J=7.8 Hz, 1H), 7.64-7.66 (t, J=7.2 Hz, 1H), 7.33-7.35 (t, J=7.8 Hz, 1H), 5.41-5.42 (d, J=3.6 Hz, 1H), 4.33-4.34 (d, J=7.8 Hz, 1H), 4.08 (s, 2H), 3.95-3.97 (dd, J=7.8, 3.6 Hz, 1H), 3.91 (s, 3H), 3.82-3.86 (m, 1H), 3.73-3.80 (m, 6H), 3.62-3.65 (m, 1H), 3.56-3.60 (m, 1H), 3.48-3.51 (t, J=9.0 Hz, 1H), 3.22-3.33 (m, 3H), 2.75-2.77 (t, J=6.6 Hz, 2H), 2.60-2.62 (t, J=6.6 Hz, 2H), 1.75-1.79 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.15, 174.64, 173.71, 170.83, 169.28, 137.04, 134.09, 130.98, 125.56, 123.77, 121.44, 102.21, 96.88, 76.90, 76.70, 75.99, 73.52, 72.06, 70.72, 69.77, 67.60, 60.20, 53.87, 52.93, 51.93, 36.24, 32.57, 31.23, 28.40. HRMS (ESI) m/z calcd for C.sub.29H.sub.41N.sub.6O.sub.16 (M+H) 729.2574, found 729.2582.
(341) GlcNAc6NGc1-4GlcA2AAMe F18-6. Yield: 74%; white foam. .sup.1H NMR (600 MHz, D.sub.2O) 7.98-7.99 (d, J=7.8 Hz, 1H), 7.82-7.83 (d, J=7.8 Hz, 1H), 7.64-7.66 (t, J=7.8 Hz, 1H), 7.33-7.35 (t, J=7.8 Hz, 1H), 5.31-5.32 (d, J=3.6 Hz, 1H), 4.33-4.35 (d, J=8.4 Hz, 1H), 4.12 (s, 2H), 3.91 (s, 3H), 3.81-3.90 (m, 4H), 3.68-3.74 (m, 3H), 3.56-3.63 (m, 3H), 3.50-3.53 (dd, J=13.8, 2.4 Hz, 1H), 3.22-3.32 (m, 3H), 2.76-2.78 (t, J=6.6 Hz, 2H), 2.60-2.63 (t, J=7.2 Hz, 2H), 2.04 (s, 3H), 1.75-1.79 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 175.48, 175.29, 174.65, 174.55, 173.71, 169.28, 137.03, 134.09, 130.99, 125.57, 123.81, 121.48, 102.16, 97.49, 77.08, 76.86, 76.73, 73.57, 71.51, 70.72, 70.51, 67.57, 61.18, 53.77, 52.94, 39.62, 36.24, 32.57, 31.24, 28.41, 22.08. HRMS (ESI) m/z calcd for C.sub.31H.sub.45N.sub.4O.sub.17 (M+H) 745.2780, found 745.2787.
Example 7
Preparation of Trisaccharide Derivatives
(342) Small scale one-pot three-enzyme synthesis of trisaccharides F20-1F20-6 by HPLC and MALDI-TOF MS analysis. As shown in
(343) TABLE-US-00009 TABLE 8 HPLC and MALDI-TOF MS analysis data for the synthesis of trisaccharides F20-1-F20-6 Starting Retention Product Retention Cal. Mass Measured Mass* Material Time (min) (Yield) Time (min) M + Na.sup.+ M + Na.sup.+H.sup.+ M + 2Na.sup.+2H.sup.+ M + 3Na.sup.+3H.sup.+ Compound 8.8 Compound 4.7 885.2627 885.4562 907.4189 929.2829 F18-1 F20-1 (100%) Compound 13.5 Compound 4.8 940.2423 939.3854 961.3454 983.3108 F18-2 F20-2 (72%) Compound 9.3 Compound 3.9 911.277 910.4507 932.4137 954.3776 F18-3 F20-3 (100%) Compound 8.1 Compound 4.9 902.2655 901.4351 923.3950 945.3587 F18-4 F20-4 (75%) Compound 10.5 Compound 4.8 927.2719 926.4009 948.3610 970.3205 F18-5 F20-5 (95%) Compound 9.2 Compound 5.1 943.2920 942.4578 964.4117 F18-6 F20f (14%) *Measured values represent M + Na.sup.+, M + 2Na.sup.+H.sup.+, M + 3Na.sup.+2H.sup.+.
(344) Preparative-scale preparation of trisaccharide GlcA1-4GlcNTFA1-4GlcA2AAMe F20-2 in a one-pot three-enzyme system as shown in
(345) Preparative-scale preparation of trisaccharide GlcA1-4GlcNH.sub.21-4GlcA2AA (F24-11) in a one-pot three-enzyme system as shown in
Example 8
Preparation of Tetrasaccharides
(346) One-pot four-enzyme synthesis of tetrasaccharide GlcNAc6N.sub.31-4GlcA1-4GlcNTFA1-4GlcA2AAMe F21-1. Trisaccharide GlcA1-4GlcNTFA1-4GlcA2AAMe F20-2 (30 mg, 1 eq.), GlcNAc6N.sub.3 (1.5 eq.), ATP (1.8 eq.), and UTP (1.8 eq.) were dissolved in water in a 15 mL centrifuge tube containing IVIES buffer (100 mM, pH 6.5) and MgCl.sub.2 (10 mM). After the addition of appropriate amount of NanK_ATCC55813 (2.5 mg), PmGlmU (3 mg), PmPpA (1.5 mg), and PmHS2 (4 mg), water was added to bring the volume of the reaction mixture to 6.5 mL. The reaction was carried out by incubating the solution in an isotherm incubator for 18 h at 37 C. with gentle shaking. Product formation was monitored by TLC (EtOAc:MeOH:H.sub.2O=4:2:1 by volume) with p-anisaldehyde sugar staining. The reaction was stopped by adding the same volume of ice-cold ethanol and incubating at 4 C. for 30 min. The mixture was concentrated and passed through a BioGel P-2 gel filtration column to obtain the desired product. The tetrasaccharide was further purified by silica gel column chromatography (EtOAc:MeOH:H.sub.2O=5:2:1) to obtain white solid tetrasaccharide GlcNAc6N.sub.31-4GlcA1-4GlcNTFA1-4GlcA2AAMe F21-1 in 93% yield. .sup.1H NMR (600 MHz, D.sub.2O) 7.94-7.96 (d, J=7.8 Hz, 1H), 7.81-7.83 (d, J=8.4 Hz, 1H), 7.60-7.63 (t, J=7.8 Hz, 1H), 7.29-7.31 (t, J=7.2 Hz, 1H), 5.43-5.44 (d, J=3.6 Hz, 1H), 5.40-5.41 (d, J=4.2 Hz, 1H), 4.47-4.49 (d, J=7.8 Hz, 1H), 4.29-4.31 (d, J=8.4 Hz, 1H), 3.93-4.00 (m, 2H), 3.88-3.90 (m, 4H), 3.78-3.86 (m, 6H), 3.66-3.75 (m, 6H), 3.61-3.62 (d, J=2.4 Hz, 2H), 3.57-3.60 (m, 1H), 3.53-3.56 (m, 1H), 3.45-3.48 (t, J=9.0 Hz, 1H), 3.34-3.36 (t, J=7.8 Hz, 1H), 3.19-3.30 (m, 3H), 2.72-2.74 (t, J=6.6 Hz, 2H), 2.57-2.60 (t, J=6.6 Hz, 2H), 2.03 (s, 3H), 1.72-1.76 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 174.85, 174.78, 174.36, 174.29, 173.36, 169.00, 159.08 (q, J=284.4 Hz), 136.91, 133.88, 130.75, 125.20, 123.30, 120.83, 116.67 (q, J=37.7 Hz), 102.29, 101.93, 96.83, 96.00, 78.08, 76.57, 76.46, 76.30, 76.28, 76.01, 75.77, 73.36, 73.29, 70.65, 70.55, 70.35, 70.22, 68.47, 67.35, 59.17, 53.76, 53.47, 52.67, 50.38, 35.98, 32.35, 30.95, 28.15, 21.79. HRMS (ESI) m/z calcd for C.sub.43H.sub.59F.sub.3N.sub.7O.sub.26 (M+H) 1146.3462, found 1146.3478.
(347) Synthesis of tetrasaccharide GlcNAc6N.sub.31-4GlcA1-4GlcNH.sub.21-4GlcA2AA F22-1. Compound GlcNAc6N.sub.31-4GlcA1-4GlcNTFA1-4GlcA2AAMe F21-1 (30 mg, 0.029 mmol) was dissolved in 8 mL of H.sub.2O. The pH of the solution was adjusted to 10 by adding 1 N NaOH. After being vigorously stirred at r.t. for 1.5 hr, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered and concentrated. The residue was purified by flash column chromatography (EtOAc:MeOH:H.sub.2O=4:2:1, by volume) to obtain a white solid GlcNAc6N.sub.31-4GlcA1-4GlcNH.sub.21-4GlcA2AA F22-1 in 81% yield. .sup.1H NMR (600 MHz, D.sub.2O) 8.12-8.13 (d, J=7.8 Hz, 1H), 7.85-7.87 (d, J=7.8 Hz, 1H), 7.48-7.50 (t, J=7.2 Hz, 1H), 7.20-7.22 (t, J=7.8 Hz, 1H), 5.59-5.60 (d, J=3.6 Hz, 1H), 5.41-5.40 (d, J=4.2 Hz, 1H), 4.45-4.47 (d, J=7.8 Hz, 1H), 4.27-4.28 (d, J=7.8 Hz, 1H), 3.88-3.94 (m, 2H), 3.79-3.88 (m, 6H), 3.66-3.78 (m, 8H), 3.62-3.64 (m, 2H), 3.46-3.52 (m, 2H), 3.34-3.37 (t, J=7.8 Hz, 1H), 3.19-3.33 (m, 3H), 2.73-2.75 (t, J=6.6 Hz, 2H), 2.60-2.62 (t, J=6.6 Hz, 2H), 2.03 (s, 3H), 1.71-1.75 (m, 2H). .sup.13C NMR (150 MHz, D.sub.2O) 174.89, 174.87, 174.67, 174.47, 174.29, 172.74, 137.25, 131.59, 130.48, 125.10, 124.00, 120.70, 102.27, 101.92, 96.84, 95.32, 77.32, 76.22, 76.15, 76.10, 76.07, 75.79, 73.38, 73.03, 70.90, 70.65, 70.34, 70.20, 68.24, 68.22, 67.30, 58.92, 53.82, 53.45, 50.38, 35.90, 33.19, 31.28, 28.10, 21.77. HRMS (ESI) m/z calcd for C.sub.40H.sub.58N.sub.7O.sub.25 (M+H) 1036.3482, found 1036.3497.
(348) Synthesis of tetrasaccharide GlcNAc6N.sub.31-4GlcA1-4GlcNS1-4GlcA2AA F22-2. Compound GlcNAc6N.sub.31-4GlcA1-4GlcNH.sub.21-4GlcA2AA F22-1 (20 mg, 0.018 mmol) was dissolved in 10 mL of H.sub.2O. The pH of the solution was adjusted to 9.5 by adding 2 N NaOH (aq). Sulfur trioxide-pyridine complex (58 mg, 0.36 mmol) was added in three equal portions during 35 minutes intervals at room temperature, and the pH was maintained at 9.5 throughout the whole process using 2 N NaOH (aq). After being stirred at r.t. for 24 hr, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, concentrated. The process has been repeated for three times and purified using silica gel column (EtOAc:MeOH:H.sub.2O=5:2:1, by volume) to obtain a light yellow solid GlcNAc6N.sub.31-4GlcA1-4GlcNS1-4GlcA2AA F22-2 in 70% yield. .sup.1H NMR (800 MHz, D.sub.2O) 8.13-8.14 (d, J=8.0 Hz, 1H), 7.87-7.88 (d, J=7.2 Hz, 1H), 7.52-7.50 (t, J=8.0 Hz, 1H), 7.22-7.24 (t, J=7.2 Hz, 1H), 5.60-5.61 (d, J=4.0 Hz, 1H), 5.42-5.43 (d, J=3.2 Hz, 1H), 4.50-4.51 (d, J=8.0 Hz, 1H), 4.34-4.35 (d, J=8.0 Hz, 1H), 3.86-3.92 (m, 3H), 3.80-3.83 (m, 4H), 3.73-3.79 (m, 4H), 3.68-3.72 (m, 4H), 3.64-3.65 (d, J=3.2 Hz, 2H), 3.56-3.53 (m, 1H), 3.48-3.50 (t, J=9.6 Hz, 1H), 3.36-3.39 (t, J=8.0 Hz, 1H), 3.19-3.28 (m, 4H), 2.75-2.77 (t, J=7.2 Hz, 2H), 2.62-2.63 (t, J=7.2 Hz, 2H), 2.04 (s, 3H), 1.75-1.77 (m, 1H). .sup.13C NMR (200 MHz, D.sub.2O) 174.89, 174.51, 174.32, 174.30, 172.82, 172.78, 137.13, 131.55, 130.41, 125.21, 124.02, 120.77, 102.11, 101.88, 96.88, 96.79, 77.70, 76.48, 76.29, 76.15, 76.11, 75.77, 73.28, 72.51, 70.58, 70.30, 70.21, 70.15, 69.38, 67.25, 59.16, 57.45, 53.43, 50.30, 35.89, 33.09, 31.19, 28.09, 21.73. FIRMS (ESI) m/z calcd for C.sub.40H.sub.58N.sub.7O.sub.28S (M+H) 1116.3051, found 1116.3076.
(349) Synthesis of tetrasaccharide GlcNAc6NH.sub.21-4GlcA1-4GlcNS1-4GlcA2AA F22-3. Compound GlcNAc6N.sub.31-4GlcA1-4GlcNS1-4GlcA2AA F22-2 (17 mg, 0.015 mmol) was dissolved in 10 mL H.sub.2O/MeOH (1:1) and 20 mg of Pd/C was added. The mixture was shaken under H.sub.2 gas (4 Bar) for 1 hr, filtered, and concentrated to produce F22-3 as a white solid in quantitative yield. .sup.1H NMR (800 MHz, D.sub.2O) 8.04-8.05 (d, J=8.0 Hz, 1H), 8.02-8.03 (d, J=8.0 Hz, 1H), 7.64-7.67 (t, J=8.0 Hz, 1H), 7.32-7.34 (t, J=7.2 Hz, 1H), 5.56-5.57 (d, J=4.0 Hz, 1H), 5.34-5.35 (d, J=4.0 Hz, 1H), 4.56-4.57 (d, J=8.0 Hz, 1H), 4.34-4.35 (d, J=8.0 Hz, 1H), 3.92-3.95 (m, 3H), 3.88-3.90 (dd, J=12.0, Hz, 2.4H), 3.76-4.84 (m, 4H), 3.68-3.75 (m, 4H), 3.55-3.58 (m, 1H), 3.42-3.45 (dd, J=13.6, 3.2 Hz, 1H), 3.35-3.38 (m, 2H), 3.30-3.32 (m, 2H), 3.19-3.27 (m, 4H), 3.12-3.15 (dd, J=12.8, 8.8 Hz, 1H), 2.77-2.79 (t, J=6.4 Hz, 1H), 2.61-2.62 (t, J=6.4 Hz, 1H), 2.05 (s, 3H), 1.75-1.78 (m, 2H). .sup.13C NMR (200 MHz, D.sub.2O) 174.77, 174.47, 174.42, 173.26, 172.64, 170.76, 137.73, 133.92, 131.18, 127.27, 124.85, 122.56, 102.18, 102.87, 97.64, 97.48, 77.66, 77.32, 76.56, 75.76, 75.73, 75.70, 74.58, 73.42, 72.45, 71.70, 70.65, 70.08, 69.22, 68.16, 67.53, 59.22, 57.60, 53.33, 46.57, 40.22, 35.88, 31.12, 28.13, 21.78. FIRMS (ESI) m/z calcd for C.sub.40H.sub.60N.sub.5O.sub.285 (M+H) 1090.3146, found 1190.3171.
(350) Synthesis of tetrasaccharide GlcNAc6NS1-4GlcA1-4GlcNS1-4GlcA2AA F22-4. Compound GlcNAc6NH.sub.21-4GlcA1-4GlcNS1-4GlcA2AA F22-3 (14 mg, 0.013 mmol) was dissolved in 5 mL of H.sub.2O. The pH of the solution was adjusted to 9.5 by adding 2 N NaOH. Sulfur trioxide-pyridine complex (30 mg, 0.18 mmol) was added in three equal portions during 1 hr intervals at rt. The pH was maintained at 9.5 throughout the whole process by adding 2 N NaOH. After being stirred at r.t. for overnight, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, concentrated. The process has been repeated for three times and purified by preparative HPLC using C18 column to give white solid GlcNAc6NS1-4GlcA1-4GlcNS1-4GlcA2AA F22-4 in 65% yield. .sup.1H NMR (800 MHz, D.sub.2O) 8.06-8.07 (d, J=8.0 Hz, 1H), 8.03-8.04 (d, J=8.0 Hz, 1H), 7.66-7.68 (t, J=7.2 Hz, 1H), 7.33-7.34 (d, J=7.2 Hz, 1H), 5.54-5.55 (d, J=3.2 Hz, 1H), 5.35-5.36 (d, J=3.2 Hz, 1H), 4.61-4.62 (d, J=8.0 Hz, 1H), 4.34-4.35 (d, J=8.0 Hz, 1H), 4.11-4.12 (d, J=9.6 Hz, 1H), 3.81-3.93 (m, 4H), 3.73-3.81 (m, 5H), 3.64-3.71 (m, 5H), 3.55-3.58 (m, 1H), 3.50-3.53 (t, J=9.6 Hz, 1H), 3.39-3.41 (t, J=8.0 Hz, 1H), 3.28-3.33 (m, 3H), 3.21-3.27 (m, 3H), 2.77-2.79 (t, J=7.2 Hz, 2H), 2.61-2.62 (t, J=6.4 Hz, 2H), 2.05 (s, 3H), 1.75-1.78 (m, 2H). .sup.13C NMR (200 MHz, D.sub.2O) 174.48, 174.34, 173.25, 171.88, 171.81, 170.41, 137.88, 134.18, 131.28, 127.18, 124.87, 122.59, 102.27, 102.04, 97.78, 97.46, 77.88, 76.83, 76.46, 75.65, 75.49, 73.91, 73.88, 73.14, 72.41, 70.83, 70.69, 70.46, 70.13, 69.14, 67.62, 59.21, 59.15, 57.67, 53.42, 43.29, 35.85, 32.71, 31.09, 28.13, 21.81. FIRMS (ESI) m/z calcd for C.sub.40H.sub.60N.sub.5O.sub.31S.sub.2 (M+H) 1170.2714, found 1170.2730.
(351) Alternative route for synthesizing tetrasaccharide F22-4 from F21-1. Compound GlcNAc6N.sub.31-4GlcA1-4GlcNH.sub.21-4GlcA2AAMe F21-1 (10 mg, 0.009 mmol) was dissolved in 5 mL of H.sub.2O/MeOH (1:1) and 5 mg of Pd/C was added. The mixture was shaken under H.sub.2 gas (4 Bar) for 1 hr, filtered and concentrated to provide GlcNAc6NH.sub.21-4GlcA1-4GlcNH.sub.21-4GlcA2AA. The residue was dissolved in 5 mL of H.sub.2O. The pH of the solution was adjusted to 9.5 by adding 2 N NaOH. Sulfur trioxide-pyridine complex (15 mg, 0.09 mmol) was added in three equal portions during 1 h intervals at rt. The pH was maintained at 9.5 throughout the whole process by adding 2 N NaOH. After being stirred at r.t. for overnight, the reaction mixture was neutralized with DOWEX HCR-W2 (H.sup.+) resin, filtered, and concentrated to give a mixture of GlcNAc6NS1-4GlcA1-4GlcNH.sub.21-4GlcA2AA, GlcNAc6NH.sub.21-4GlcA1-4GlcNS1-4GlcA2AA (F22-3), and GlcNAc6NS1-4GlcA1-4GlcNS1-4GlcA2AA (F22-4) which can be separated by HPLC using a C18 column.
(352) Synthesis of GlcNS1-4GlcA1-4GlcNS1-4GlcA2AA. The synthesis was conducted as outlined in
(353) Trisaccharide GlcA1-4GlcNTFA1-4GlcA2AAMe (Compound F14-1 or F20-2,
(354) GlcNTFA1-4GlcA1-4GlcNTFA1-4GlcA2AAMe (Compound F14-2,
(355) Results and Discussion
(356) As shown in
(357) The fourth enzyme is a heparosan synthase 2 cloned from Pasteurella multocida strain P-1059 (PmHS2) for the formation of 1-4 linkage. PmHS2 is a bifunctional enzyme which demonstrates 1-4GlcNAc and 1-4GlcA transferase activity. It not only uses UDP-GlcNAc as donor, transferring GlcNAc to GlcA to form 1-4 linkage, but also transfers GlcA from donor UDP-GlcA to acceptor GlcNAc to form 1-4 linkage. Although PmHS2 has been shown to be able to synthesize heparosan polysaccharides, its donor and acceptor specificity has not been investigated in detail.
(358) Prior to applying the one-pot three-enzyme system shown in
(359) As shown in
(360) Acceptor specificity of the 1-4GlcA transferase activity of PmHS2 was also explored in one-pot three-enzyme system, as shown in
(361) Preparative-scale synthesis of trisaccharide F20-2 was also achieved. The removal of TFA group was significantly reduced when the pH of the reaction mixture was change for 7.5 to 7.0, and the yield increased to 87% from 72%. Trisaccharide F20-2 was used as the starting material for the synthesis of the tetrasaccharide F21-1 (
(362) The N-TFA group as well as the N.sub.3 group can be easily converted to a free amine, allowing sequential sulfation to generate a diverse array of HS tetrasaccharides. As shown in
Example 9
Preparation of GlcA-TEG-PABA-Biotin
(363) The synthesis was conducted as outlined in
(364) 2-(2-(2-Tosylethoxy)ethoxy)ethanol. Compound F15-1 (51 grams) was dissolved in 10 mL of water containing 2.2 grams of NaOH. The reaction mixture was cooled in an ice bath. To the reaction mixture tosyl chloride (6.5 g, 34.1 mmol) in 80 mL of THF was added drop-wisely in 1 hr period. The reaction was left in ice bath off for 2 hr. The reaction was worked up with 150 mL of DCM and 150 mL of cold water. The organic layer was collected and saved. The aqueous layer was extracted twice with DCM (150 mL) and the organic layers were collected and washed twice with water (200 mL). The organic portions were combined, dried with magnesium sulfate, and rotovoped to provide crude 2-(2-(2-tosylethoxy)ethoxy)ethanol (9.684 grams, 93% yield).
(365) Compound F15-2. 2-(2-(2-Tosylethoxy)ethoxy)ethanol (9.684 g, 31.8 mmol) was dissolved in 25 mL of DMF. Sodium azide (10.34 g, 159.1 mmol) was added to the reaction solution. The reaction was left for 3 h at 80 C. The reaction mixture was worked up with EtOAc/water. The organic layer was collected and dried over magnesium sulfate and purified by silica gel column (Hexane:EtOAc=2:1-0:1) to produce compound F15-2 (4.96 g, 89% yield).
(366) Azidotriethylene glycol-Boc. Compound F15-2 (2.334, 13.3 mmol) was dissolved in 40 mL of DMF and cooled in ice bath. Sodium hydride 50% immersed in mineral oil (959 mg, 19.9 mmol) was added slowly. The reaction was allowed to sit for 20 minutes followed by addition of t-butyl bromoacetate (3.93 mL, 39.9 mmol). The reaction was left for four hours and extracted with ethylacetate and water. The organics were dried over magnesium sulfate and purified by silica gel column (Hexane:EtOAc=5:1-1:1) to afford azidotriethylene glycol-Boc (1.54 g; Yield: 40%; clear oil). .sup.1H NMR (600 MHz, CDCl.sub.3) 4.01 (s, 2H), 3.71-3.65 (m, 10H), 3.38-3.36 (t, J=4.5 Hz, 1H), 1.45 (s, 9H), .sup.13C NMR (150 MHz, CDCl.sub.3) 169.75, 81.61, 70.83, 70.79, 70.78, 70.76, 70.13, 69.15, 50.79, 28.21.
(367) Compound F15-3. Azidotriethylene glycol-Boc (1.19 g, 4.1 mmol) was dissolved in 15 mL of ethyl acetate and of Pd/C catalyst (240 mg) was added under hydrogen gas in a double balloon. Reaction was stirred until reaction was completed as monitored by TLC. The reaction mixture was filtered over celite and the filtrate was rotovaped to afford crude compound F15-3. Yield: quant; clear oil.
(368) Compound F15-5. D-Biotin F15-4 (538 mg, 2.2 mmol) was dissolved in 10 mL of hot DMF. The solution was allowed to cool to room temperature and HATU (838 mg, 2.2 mmol) was added and allowed to preactivate for 15 minutes. To The reaction mixture diisopropylethylamine (0.968 mL, 2.4 mmol) and para-amino benzoic acid (335 mg, 2.4 mmol) were added. Reaction was allowed to react for 24 hr in which then 70 mL of dichloromethane was added to precipitate the product. The precipitate was collected via suction filtration and washed three times with ethyl acetate (50 mL) to attain NMR pure compound F15-5 (687 mg, Yield: 86%; white solid). .sup.1H NMR (600 MHz, DMSO) 10.19 (s, NH), 7.88-7.86 (d, J=8.4 Hz, 2H), 7.71-7.69 (d, J=9.0 Hz, 2H), 6.46 (s, NH), 6.38 (s, NH), 4.32-4.29 (m, 1H), 4.15-4.12 (m, 1H), 3.13-3.10 (m, 1H), 2.83-2.80 (dd, J=12.6 Hz, 5.4 Hz, 1H), 2.59-2.57 (d, J=12.6, 1H), 2.36-2.33 (t, J=7.5 Hz, 2H), 1.67-1.34 (m, 6H). .sup.13C NMR (150 MHz, DMSO) 171.75, 166.97, 162.77, 143.35, 130.38, 124.90, 118.26, 61.07, 59.22, 55.40 39.94, 36.33, 28.23, 28.11, 24.99.
(369) Compound F15-6. Compound F15-5 (1.116 g, 3.1 mmol) was dissolved in 15 mL of DMF. carbonyldiimidazole (547 mg, 3.4 mmol) was added to reaction mixture and allowed to preactivate for 40 minutes followed by the addition of compound F15-3 (977 mg, 3.7 mmol) in 5 mL of DMF. The reaction was left at room temperature for 40 hours and was passed through silica gel column (DCM:MeOH:NH.sub.4OH=9:1:0.1-1:1:0.1) to afford F15-6 (738 mg; Yield: 40%; yellow flakes). .sup.1H NMR (600 MHz, DMSO) 10.13 (s, NH), 8.40 (m, NH), 7.89-7.77 (d, J=8.4 Hz, 2H), 7.65-7.64 (d, J=9.0 Hz, 2H), 6.45 (s, NH), 6.38 (s, NH), 4.32-4.30 (m, 1H), 4.15-4.13 (m, 1H), 3.95 (s, 2H) 3.53-3.50 (m, 10H), 3.40-3.38 (m, 2H), 3.13-3.10 (m, 1H), 2.83-2.80 (dd, J=12.6 Hz, 4.8 Hz, 1H), 2.59-2.57 (d, J=12.6, 1H), 2.34-2.31 (t, J=7.2 Hz, 2H), 1.67-1.34 (m, 15H). .sup.13C NMR (150 MHz, DMSO) 171.86, 169.57, 166.07, 163.03, 141.91, 128.64, 128.06, 118.18, 80.89 70.0, 69.85, 69.83, 69.75, 69.1, 68.26, 61.28, 59.42, 55.56, 40.00, 39.25, 36.43, 28.42, 28.25, 27.90 25.19.
(370) Compound F15-7. Compound F15-6 (701 mg) was dissolved in 7 mL mixture of DCM/TFA(2:1) and was left for 3 hr. The crude product was passed through silica gel column (DCM:MeOH:NH.sub.4OH=7:3:0.1-0:1:0.1) to afford the free acid (562 mg, 88% yield). The free acid (150 mg, 0.27 mmol) and N-hydroxy succamide (32 mg, 0.3 mmol) were dissolved in hot DMF. The reaction mixture was cooled to room temperature and N,N-dicyclohexylcarbodiimide (67 mg, 0.35 mmol) was added and left for 18 h. the reaction mixture was filtrate over celite and the filtrate was rotovaped and the triturated with diethyl ether and collected by suction filtration to afford crude compound F15-7 (172 mg; Yield: 98%; white solid).
(371) Glucoronic acid--propylamine (200 mg, 0.79 mmol) (obtained by reduction from compound F13-7) and compound F15-7 (672 mg, 1.03 mmol) were dissolved in dry methanol (15 mL) and stirred overnight. The reaction mixture was rotpavoped and purified by silica gel column (DCM:MeOH:NH.sub.4OH=7:3:0.1-0:1:0.1) to provide GlcA-TEG-PABA-biotin (F15-8) (192 mg; Yield: 31%; white foam). .sup.1H NMR (600 MHz, D.sub.2O) 7.74-7.73 (d, J=7.8 Hz, 2H), 7.56-7.54 (d, J=9.0 Hz, 1H), 4.56-4.54 (m, 1H), 4.39-4.38 (d, J=7.8, 1H), 4.36-4.34 (m, 1H), 3.92 (s, 2H) 3.91-3.88 (m, 1H), 3.71-3.47 (m, 18H), 3.37-3.35 (t, J=6.3 Hz, 2H), 2.94-2.91 (dd, J=12.6 Hz, 4.8 Hz, 1H), 2.74-2.72 (d, J=12.0, 1H), 2.39-2.36 (t, J=7.5 Hz, 2H), 1.80-1.38 (m, 8H), .sup.13C NMR (150 MHz, D.sub.2O) 175.60, 175.21, 172.09, 169.54, 165.15, 140.69, 129.21, 128.16, 120.29, 102.43, 102.02, 75.95, 75.47, 72.90, 72.87, 71.76, 70.19, 69.36, 68.74, 67.50, 61.98, 60.15, 55.29, 39.63, 39.45 36.29, 35.79, 28.37, 28.13, 27.96, 27.67, 24.93.
Example 10
Preparation of GlcA1-4GlcNAc Disaccharide Derivatives
(372) PmHS2 acceptor substrate specificities using UDP-GlcA as a donor substrate and - and -linked GlcNAc derivatives as acceptors were studied. Conversion to the disaccharide products was estimated by LCMS and TLC analysis as outlined in Table 9 below.
(373) TABLE-US-00010 TABLE 9 Reaction conditions and yields for the formation of GlcA-GlcNAc dissacharide derivatives. Acceptor GlcNAc2AA GlcNAcMU GlcNAcProN.sub.3 GlcNAcProN.sub.3 Conditions (5 mM) (5 mM) (10 mM) (10 mM) MES (0.1M pH 6.5) 100 mM 100 mM 100 mM 100 mM MnCl.sub.2 10 mM 10 mM 10 mM 10 mM UDP-GlcA 6 mM 6 mM 12 mM 12 mM PmHS2 0.55 g.sup. 0.55 g.sup. 0.55 g.sup. 0.55 g.sup. Total volume 10 L 10 L 10 L 10 L Reaction time/Temp 19 h/37 C. 19 h/37 C. 19 h/37 C. 19 h/37 C. Product (% yield) 33% based on 57% based on 30% based on TLC 60% based on TLC HPLC (UV) HPLC (UV)
(374) As shown in
Example 11
Inhibition Assays of Monosaccharides, Disaccharides, Trisaccharides, and Tetrasaccharides
(375) Materials. Recombinant human fibroblast growth factors FGF-1, FGF-2, FGF-4, and anti-human FGF-1, FGF-2, FGF-4 were purchased from PeproTech Inc (Rocky Hill, N.J.). Heparin-biotin was from Sigma (St. Louis, Mo.). Low molecular weight heparin (LMWH) was bought from AMS Biotechnology (Lake Forest, Calif.). Alexa Fluor 488 goat anti-rabbit IgG (H+L) was from Invitrogen (Carlsbad, Calif.). 384-Well NeutrAvidin-coated plates for the sialidase assays were from Fisher Biotech.
(376) Methods. All assays were carried out in duplicate in 384-well NeutrAvidin coated plates. Heparin-biotin (20 L, 2 M) was added to each well and the plate was incubated at 4 C. for overnight. The plate was washed with 3 rounds of 1PBS buffer containing 0.05% Tween-20 and blocked with 1% BSA (50 L for each well) and incubated at r.t. for 30 min. After the plate was washed three times with 1PBS buffer containing 0.05% Tween-20, each set of duplicate wells were added 20 L of human FGF-1, FGF-2, or FGF-4 (1 M) with or without premixing with LMWH (22 nM or 0.1 M), monosaccharide, or oligosaccharides (100 M or 1 mM) and the plate was incubate at r.t. for 1 hr. After washing three times with 1PBS buffer containing 0.05% Tween-20, anti-human FGF-1, FGF-2 or FGF-4 (20 L) was added and the plate was incubated at r.t. for 1 hr. After the plate was washed three times with 1PBS buffer containing 0.05% Tween-20, Alexa Fluor 488 goat anti-rabbit IgG (H+L) (20 L) was added and the plate was incubated at r.t. for 1 hr. After washed three times with 1PBS buffer containing 0.05% Tween-20 and once with water, the fluorescent signals of wells in the plate were measured using a microtiter plate reader.
(377) Results. LMWH was used as a control sample for testing the inhibitory activities of sixteen compounds including seven monosaccharides, two disaccharides, two trisaccharides, and five tetrasaccharides (see
(378) TABLE-US-00011 TABLE 10 Percentage inhibition of compounds F24-1-F24-16 (1 mM) against the binding of human FGF-1, FGF-2, and FGF-4 to heparin-biotin immobilized on NeutrAvidin-coated plates. Com- FGF-1 (% FGF-2 (% FGF-4 (% pounds Structures inhibition) inhibition) inhibition) F24-1 GlcA 65 68 54 F24-11 GlcA1-4GlcNH.sub.21- 76 4GlcA2AA F24-13 GlcNAc6N.sub.31-4GlcA1- 62 4GlcNH.sub.21-4GlcA2AA F24-15 GlcNAc6NH.sub.21-4GlcA1- 68 43 4GlcNS1-4GlcA2AA F24-16 GlcNAc6NS1-4GlcA1- 58 55 4GlcNS1-4GlcA2AA
Example 12
Substrate Specificity of KfiA and PmHS2
(379) Materials and Methods
(380) PmHS2, KfiA, and related fusion proteins were expressed, purified, and characterized as described in Example 1. Reactions with UDP-sugars were carried out in duplicate at 37 C. in MES (100 mM, pH 6.5) containing UDP-GlcNAc or one of its derivatives (1 mM), GlcA2AA (1 mM), MnCl.sub.2 (10 mM) and KfiA (2.8 g l.sup.1) or PmHS2 (1.1 g l.sup.1) for 24 h. The reaction mixtures were stopped by adding ice-cold 10% (v/v) acetonitrile to make 100-fold dilutions and the mixtures were analyzed by HPLC as described for the pH profile.
(381) Results
(382) Substrate specificity of the GlcNAcT activities of MBP-KfiA-his.sub.6 and his.sub.6-PmHS2. As shown in
(383) UDP-GlcNAc derivatives with a bulky N-diphenylacetyl group at C2 (33-6) or C6 (33-15) or with a C6-N-phenyl acetyl substitution (33-14) were not suitable donor substrates for either MBP-KfiAHis.sub.6 or the 1-4GlcNAcT activity of His.sub.6-PmHS2. It seems that the N-acyl groups at C2 of UDP-GlcNAc derivatives are quite important for recognition by His.sub.6-PmHS2 as donor substrates. For example, UDP-GlcN.sub.3 (33-7) with a C2-azido group substitution and UDP-GlcNH.sub.2 (33-8) with a C2-amino group substitution were not acceptable donor substrates by MBP-KfiA-His.sub.6 or the 1-4GlcNAcT activity of His.sub.6-PmHS2. In addition, N-sulfation at C2 (33-9) or O-sulfation at C6 (33-16) also block the activities of both MBP-KfiA-His.sub.6 and His.sub.6-PmHS2. UDP-Gal (33-19), UDPManNAc (33-20), UDP-mannose (33-22) and their derivatives (33-21 and 33-23) were not tolerable substrate for either enzymes.
Example 13
Preparation of UDP-Uronic Acid Compounds Using a One-Pot Multi-Enzyme System
(384) Materials. The cDNA library of Arabidopsis thaliana was purchased from AMS Biotechnology (Lake Forest, Calif., USA). Restriction enzymes including NdeI and BamHI were purchased from New England BioLabs (Beverly, Mass., USA). Vector pET22b+ was purchased from Novagen (EMD Biosciences Inc., Madison, Wis., USA). Herculase-enhanced DNA polymerase was purchased from Stratagene (La Jolla, Calif., USA). T4 DNA ligase and 1 kb DNA ladder were from Promega (Madison, Wis., USA). Ni.sup.2+-nitrilotriacetic acid (NTA) agarose, QIAprep spin miniprep kit and QIAquick gel extraction kit were purchased from Qiagen (Valencia, Calif., USA). Bicinchoninic acid (BCA) protein assay kit was from Pierce Biotechnology, Inc. (Rockford, Ill., USA). Escherichia coli DH5< electrocompetent cells and BL21 (DE3) chemically competent cells were purchased from Invitrogen (Carlsbad, Calif., USA).
(385) Galactose (Gal), N-Acetylgalactosamine (GalNAc), N-Acetylglucosamine (GlcNAc), Mannose (Man), N-Acetylmannosamine (ManNAc), Xylose (Xyl) were purchased from Sigma Aldrich (Saint Louis, Mo., USA). GalNAc/ProN.sub.3 were chemically synthesized in the group.
(386) Cloning. To clone full length Arabidopsis thaliana glucuronokinase (EC 2.7.1.43) (AtGlcAK) (encoded by gene GLCAK1, DNA GenBank accession number: NM_111030, locus tag: AT3G01640; protein GenBank accession number: NP_566144) into pET22b+, forward primer used was 5 ACGCGTCGACATGGATCCGAATTCCACGG 3 (SEQ ID NO:44) (SalI restriction site is bold and underlined) and reverse primer was 5 CCGCTCGAGT AAGGTCTGAATGTCAGAATCATTC 33 (SEQ ID NO: 45) (XhoI restriction site is bold and underlined). Polymerase chain reaction (PCR) were performed in 50 L total volume containing 200 ng of cDNA library, 0.2 M of forward and reverse primers, 5 L of 5 Herculase II buffer, dNTP mixture (0.2 mM), and 5 U of Herculase II DNA polymerase. The reaction was performed at an annealing temperature of 58 C. for 32 cycles. The PCR products were digested with SalI and XhoI, purified, and ligated at 16 C. overnight with pET22b+ vector predigested with SalI and XhoI. The ligated product was transformed into electrocompetent E. coli DH5 cells. Selected clones were grown for minipreps and positive clones were verified by restriction mapping and DNA sequencing performed by Davis Sequencing Facility.
(387) Protein expression and purification. The plasmid containing GLCAK1 was transformed into E. coli BL21 (DE3) chemically competent cells for protein expression. E. coli cells harboring the pET22b-AtGlcAK plasmid were cultured in LB medium (10 g/L tryptone, 5 g/L yeast extract, and 10 g/L NaCl) with ampicillin (100 g/mL) at 37 C. with rigorous shaking at 250 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, N.J.) until the OD.sub.600 nm of the culture reached 0.8-1.0. Overexpression of the targeted proteins was achieved by adding 0.15 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) followed by incubation at 18 C. for 20 h with rigorous shaking at 250 rpm.
(388) His.sub.6-tagged (SEQ ID NO: 22) protein was purified from cell lysate using Ni.sup.2+-NTA affinity column. To obtain cell lysate, cells were harvested by centrifugation at 4,000 rpm (Sorvall) at 4 C. for 2 h. The cell pellet was resuspended in lysis buffer (pH 8.0, 100 mM Tris-HCl containing 0.1% Triton X-100). Lysozyme (100 g/mL) and DNase I (5 g/mL) were added to the cell suspension. The mixture was incubated at 37 C. for 1 h with vigorous shaking (200 rpm). Cell lysate was obtained as the supernatant by centrifugation at 12,000 rpm (Sorvall) at 4 C. for 20 min. Purification was performed by loading the supernatant onto a Ni.sup.2+-NTA column pre-equilibrated with 10 column volumes of binding buffer (5 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The column was washed with 10 column volumes of binding buffer and 10 column volumes of washing buffer (40 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). Protein of interest was eluted with Tris-HCl (pH 7.5, 50 mM) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzyme were collected and dialyzed against Tris-HCl buffer (pH 7.5, 25 mM) containing 10% glycerol and 0.25 M NaCl. Dialyzed proteins were stored at 4 C. Alternatively, fractions containing purified enzyme were dialyzed against Tris-HCl buffer (pH 7.5, 25 mM) and freeze dried.
(389) pH profile. Typical enzymatic assays for pH profile studies were performed in a total volume of 20 L containing GlcA (10 mM), ATP (10 mM), MgCl.sub.2 (20 mM) and AtGlcAK (412 ng) in various buffers (200 mM) with pH varying from 5.0 to 10.0. All reactions were allowed to proceed for 15 min at 37 C. The reaction mixture was quenched by boiling water bath for 1 min followed by adding 20 L of ice cold 95% (v/v) ethanol. The samples were then centrifuged at 13,000 rpm for 2 min, and kept on ice until analyzed by a Beckman Coulter P/ACE MDQ Capillary Electrophoresis (CE) system equipped with a UV detector. A 50 cm capillary tubing (75 m I.D., Beckman Coulter) was used. Assays were run at 25 kV with 25 mM sodium borate buffer (pH 9.8) for 22 min. Percent conversions were calculated from the ratios of ATP and ADP, which were determined by UV absorbance at 254 nm. All assays were carried out in duplicate, and standard deviations were used to represent errors.
(390) Effects of metal ions and EDTA. EDTA (5 mM), 20 mM of Various Divalent metal salts (CaCl.sub.2, CoCl.sub.2, CuSO.sub.4, MnCl.sub.2, ZnCl.sub.2) were mixed in a MOPS buffer (pH 7.5, 100 mM) to analyze their effects on the kinase activity of AtGlcAK (412 ng) in 20 L total volume containing 10 mM of ATP and GlcA. Reaction without EDTA or metal ions was used as a control. Reactions were quenched and assayed using the same method as those for pH profile. All reactions were performed in duplicate, and standard deviations were used to represent errors.
(391) Substrate specificity assays. Substrate specificity assays were performed under two conditions: low enzyme concentration assays are performed in 20 L reaction mixture containing 10 mM ATP, 10 mM sugar substrate, 20 mM MgCl.sub.2, 100 mM MOPS pH 7.5 and 412 ng AtGlcAK at 37 C. for 15 min, while high enzyme concentration assays are performed in 20 L reaction mixture containing 10 mM ATP, 10 mM sugar substrate, 20 mM MgCl.sub.2, 100 mM MOPS pH 7.5 and 2.1 g AtGlcAK at 37 C. for 60 min. The reactions were quenched and assayed with the same method as those for pH profile. All reactions were performed in duplicates.
(392) Kinetics assays. Kinetic parameters of GlcA were assayed in duplicate in reaction mixture of 20 L containing 100 mM MES buffer (pH 7.5), 20 mM of MgCl.sub.2, 10 mM of ATP, different concentration of GlcA (0.5, 1.0, 2.0, and 5.0 mM, 10 mM and 20 mM), and AtGlcAK (206 ng). All reactions were allowed to proceed at 37 C. for 15 min. Reaction with no GlcA was used as negative control. The apparent kinetic parameters were obtained by fitting the experimental data (average values of duplicate assays) into the Michaelis-Menten equation using Grafit 5.0.
(393) Kinetic parameters of ATP were assayed in duplicate in reaction mixture of 20 L containing 100 mM IVIES buffer (pH 7.5), 20 mM of MgCl.sub.2, 10 mM of GlcA, different concentration of ATP (0.5, 1.0, 2.0, and 5.0 mM, 10 mM and 20 mM), and AtGlcAK (206 ng). All reactions were allowed to proceed at 37 C. for 15 min. Reaction with no GlcA was used as negative control. The apparent kinetic parameters were obtained by fitting the experimental data (average values of duplicate assays) into the Michaelis-Menten equation using Grafit 5.0.
(394) All assays were performed in a Beckman Coulter P/ACE MDQ Capillary Electrophoresis System (Fullerton, Calif., USA) equipped with a UV detector. Reactions were stopped by adding 25 L of ice-cold ethanol, centrifuged at 13,000 rpm for 2 min, and kept on ice until aliquots of 15 L were transferred into micro sample vials and subjected to CE analysis. ATP samples with higher concentrations are further diluted before injection. An eCAP Capillary Tubing (50 cm effective length, 75 m I.D., 375 m O.D.) from Beckman Coulter was used to separate ATP and ADP in a 25 mM sodium borate buffer (pH 9.8) under 25 kV voltages. Sample injections were achieved by pressurizing sample vial to 0.5 psi for 6 sec. Separations were achieved within 22 min and percent conversions were calculated from the ratios of sugar nucleotides and nucleotide triphosphates, which were determined by UV absorbance at 254 nm.
(395) LC-MS analysis of AtGlcAK activity. The product formation was monitored by LC-MS using a LC-2010AXL High Performance Liquid Chromatography (HPLC) system linked with a LCMS-2020 mass spectrometer (Shimadzu Scientific instrument Inc., Columbia, Md.). Liquid nitrogen was used as nitrogen gas source. A Shimadzu C18 column (5 m particle size, 4.6 mm50 mm) was used to clean up the reaction. Mobile phase consists of 30% acetonitrile (ACN) in water. The flow rate was set at 0.8 ml/min. Each run was set for 6 minutes and mass spectrometer was set to scan the range from 190 to 600 Da per second.
(396) Results
(397) Cloning, expression and purification of AtGlcAK. Full length Arabidopsis thaliana glucuronokinase (EC 2.7.1.43) (AtGlcAK) was amplified from the cDNA library of Arabidopsis thaliana, cloned in pET15b vector, and expressed as an N-His.sub.6-tagged (SEQ ID NO: 22) fusion protein. Positive clones were verified by restriction mapping and DNA sequencing performed by Davis Sequencing Facility. The DNA sequence of the insert matched to the reported GlcAK1 gene.
(398) N-terminal His.sub.6-tagged (SEQ ID NO: 22) protein was overexpressed in E. coli BL21 (DE3) using Luria-Bertani (LB) media. The recombinant protein was then purified from cell lysate using Ni.sup.2+-NTA affinity column. According to SDS-PAGE analysis, the recombinant protein of around 42 kDa (calculated molecular mass 42.2 kDa) can be obtained effectively in high purity. The fractions containing the purified enzyme were collected and dialyzed against Tris-HCl buffer (pH 7.5, 20 mM) containing 30% glycerol. Dialyzed proteins were stored at 20 C. Alternatively, fractions containing purified enzyme were dialyzed against Tris-HCl buffer (pH 7.5, 20 mM) and lyophilized. On average, 65 mg of purified protein was obtained from 1 liter of cell culture.
(399) pH profile. A pH profile study of AtGlcAK was performed on a capillary electrophoresis (CE) system using Glucuronic acid (GlcA) and ATP as substrate. The reaction mixture also contains MgCl.sub.2 (20 mM). UV absorbance at 254 nm was used for quantification. Percentage conversions of ATP to ADP were used to represent the progress of the reaction. AtGlcAK has a relatively narrow pH range (
(400) EDTA and metal effects. Metal dependence of AtGlcAK was assayed following a similar assay method (
(401) Substrate specificity of AtGlcAK. Substrate specificity of AtGlcAK was assayed using a capillary electrophoresis (CE) system, using ATP and a variety of monosaccharides (Table 11). It is very obvious that the carboxylic acid at C6 of the sugar substrate is critical for binding to the AtGlcAK. Only those acidic monosaccharides can be phosphorylated by AtGlcAK with detectable yields.
(402) TABLE-US-00012 TABLE 11 Substrate specificity of AtGlcAK Percentage conversion of ATP (%) Low enzyme Conc. High enzyme Conc. (412 ng in 20 L, 15 min, (2.1 g in 20 L, 60 min, Substrate 37 C.) 37 C.) GlcA 61.5 N.A. GalA 6.2 15.3 IdoA N.D. N.D. Glc N.D. <5 Gal N.D. N.D. Man N.D. N.D. Xyl N.D. <5 Ara N.D. N.D. N.A.: Not Assayed; N.D. Not Detected.
(403) Kinetics assays of AtGlcAK. Kinetic studies for the glucuronokinase activity of AtGlcAK with GlcA have been performed (Table 12). The enzyme amount was adjusted so that with 10 mM of ATP and GlcA, at 15 min the reaction rate was still in its linear range and the ATP conversion was relatively high. The reaction rate started to slow down after 20 min (
(404) TABLE-US-00013 TABLE 12 Kinetic parameters of AtGlcAK k.sub.cat (s.sup.1) K.sub.m (mM) k.sub.cat/K.sub.m (mM.sup.1s.sup.1) ATP 26.8 1.1 24.4 GlcA 25.4 1.3 19.5
(405) LC-MS analysis of AtGlcAK activity. The AtGlcAK kinase activity was confirmed by LC-MS under negative mode. The peak of 273.05 represents [MH], whereas the peak of 295.05 represents [M+Na2H] of the product. The reaction did not go to completion with a 1:1 ratio of ATP:GlcA. Complete conversion can be achieved with an excess amount of ATP.
(406) Preparative synthesis of oligosaccharides using AtGlcAK. The GlcA-1-P generated from AtGlcAK was used by a UDP-sugar pyrophosphorylase (BLUSP) in a one-pot multiple-enzyme to form UDP-GlcA, which is then used as substrate by a chondroitin synthase from Pasteurella multocida (PmCS), a hyaluronan synthase from Pasteurella multocida (PmHAS), or a heparosan synthase from Pasteurella multocida (PmHS2). PmCS is a polymerase which catalyzes the alternating addition of GlcA1-3 and GalNAc1-4 onto an oligosaccharide chain. GlcA1-3GalNAcProN.sub.3, a disaccharide derivative, was generated by Pasteurella multocida chondroitin sulfate (PmCS)-catalyzed reaction using GalNAcProN.sub.3 as an acceptor using a one-pot four-enzyme system containing AtGlcAK, BLUSP, Pasteurella multocida inorganic phosphatase (PmPpA), and PmCS. PmHAS is a polymerase which catalyzes the alternating addition of GlcA1-3 and GlcNAc1-4 onto an oligosaccharide chain. Similar to that described for the PmCS-catalyzed reaction, GlcA1-3GlcNAcProN.sub.3, a disaccharide derivative, was generated by Pasteurella multocida hyaluronan synthase (PmHAS)-catalyzed reaction using GlcNAcProN.sub.3 as an acceptor using a one-pot four-enzyme system containing AtGlcAK, BLUSP, Pasteurella multocida inorganic phosphatase (PmPpA), and PmHAS. Similarly, GlcA1-4GlcNAc1-4GlcAProN.sub.3 trisaccharide was produced by a one-pot four-enzyme system containing AtGlcAK, BLUSP, PmPpA, and the 1-4-glucuronyltransferase (1-4-GlcAT) activity of Pasteurella multocida heparosan synthase 2 (PmHS2)-catalyzed reaction using GlcNAc1-4GlcAProN.sub.3 as an acceptor. These demonstrated the important application of AtGlcAK in one-pot multienzyme chemoenzymatic synthetic schemes for synthesizing GlcA-containing compounds and possibly for other uronic acid-containing structures.
Example 14
Synthesis and Biological Activity of Novel Disialyl Hexasaccharides
(407) As discussed above, HMOs have the potential for important therapeutic uses. Most of the HMO-related studies reported so far, however, used mixtures of HMOs and thus the key active components of HMOs are not clear. Also except for a few, the functions of individual HMOs are not well understood. This is mainly due to the lack of access to pure oligosaccharides in amount large enough for research, preclinical, and clinical studies. The present invention provides efficient enzymatic methods for obtaining biologically important HMOs and derivatives.
(408) DSLNT contains two sialic acid residues: one is linked to the terminal galactose (Gal) residue via an 2-3-sialyl linkage; the other is linked to the internal N-acetylglucosamine (GlcNAc) residue via an 2-6-sialyl linkage. Despite recent advances in the development of chemical methods for synthesizing sialic acid-containing structures, sialosides remain to be challenging targets for chemical synthesis due to the intrinsic structural feature of sialic acids (e.g. steric hindered anomeric carbon with an electron-withdrawing carboxyl group in the sialic acid which lowers the glycosylation efficiency and the lack of a neighbouring participating group that disallow the control of the stereospecificity in the formation of sialyl bonds). Therefore, chemical synthesis of DSLNT in a free oligosaccharide oligosaccharide form has so far not been reported although a glycosyl ceramide containing the same glycan portion was reported by the Kiso group. Furthermore, despite the identification of the activity of an 2-6-sialyltransferase that catalyzes the formation of the 2-6-linked sialic acid on the internal GlcNAc residue in DSLNT (e.g. in the livers of various animals and human as well as in human placenta, bovine mammary gland, human milk, and human mammary tumor although at a lower level), the gene for the enzyme has yet to be determined. Therefore, it is currently unfeasible to obtain the desired 2-6-sialyltransferase in large amount via cloning to allow enzymatic synthesis of DSLNT in large scale.
(409) One feasible strategy is to identify compounds that have similar or better effects than DSLNT in treating NEC but can be easily obtained synthetically. Here, we report a novel synthetic 2-6-linked disialyllacto-N-neotetraose (DSLNnT) obtained by sequential one-pot multienzyme (OPME) reactions which shows potent effect in preventing NEC in neonatal rats. The compound is readily available and can be produced in large amount for potential therapeutic application in treating NEC in preterm infants.
(410) Materials and Methods
(411) General methods. Chemicals were purchased and used without further purification. .sup.1H NMR (800 MHz) and .sup.13C NMR (200 MHz) spectra were recorded on a Bruker Avance-800 NMR spectrometer. High resolution electrospray ionization (ESI) mass spectra were obtained using Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility in the University of California, Davis. Silica gel 60 (200-425 mesh, Fisher Chemical) was used for flash column chromatography. Thin-layer chromatography (TLC) was performed on silica gel plates using anisaldehyde sugar stain or 5% sulfuric acid in ethanol stain for detection. Gel filtration chromatography was performed with a column (100 cm2.5 cm) packed with Bio-Gel P-2 Fine resins.
(412) One-pot four-enzyme preparative-scale synthesis of Lc.sub.3 trisaccharide GlcNAc1-3Gal1-4Glc. To prepare the trisaccharide, a reaction mixture in Tris-HCl buffer (100 mM, pH 8.0) in a total volume of 65 mL containing lactose (0.90 g, 2.63 mmol), N-acetylglucosamine (GlcNAc, 0.756 g, 3.42 mmol), adenosine 5-triphosphate (ATP, 1.88 g, 3.42 mmol), uridine 5-triphosphate (UTP, 1.99 g, 3.42 mmol), MgCl.sub.2 (20 mM). NahK (19.0 mg), PmGlmU (8.0 mg), NmLgtA (6.0 mg), and PmPpA (4.0 mg) was incubated in a shaker at 37 C. for 48 hrs. The product formation was monitored by TLC (EtOAc:MeOH:H.sub.2O:HOAc=4:2:1:0.2 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. To stop the reaction, the reaction mixture was added with same volume (65 mL) of ethanol and incubated at 4 C. for 30 min. After centrifugation, the supernatant was concentrated and passed through a Bio Gel P-2 gel filtration column (water was used as an eluent). The fractions containing the product were collected, concentrated, and further purified by silica gel column (EtOAc:MeOH:H.sub.2O=5:2:1 by volume) to provide Lc.sub.3 trisaccharide GlcNAc1-3Gal1-4Glc (1.36 g, 95%). .sup.1H NMR (800 MHz, D.sub.2O) 5.19 (d, J=4.0 Hz, 0.4H), 4.66 (d, J=8.0 Hz, 0.4H), 4.65 (d, J=8.0 Hz, 0.6H), 4.64 (d, J=8.0 Hz, 0.6H), 4.41 (d, J=8.0 Hz, 1H), 4.12 (d, J=3.2 Hz, 1H), 3.93-3.24 (m, 17H), 2.01 (s, 3H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 174.87, 102.84, 102.75, 95.66, 81.87, 78.21, 75.57, 74.80, 74.71, 74.20, 73.71, 73.49, 70.03, 69.92, 68.26, 60.88, 60.41, 60.01, 56.58, 22.09. HRMS (ESI) m/z calculated for C.sub.20H.sub.36NO.sub.16 (M+H) 546.2034, found 546.2026.
(413) One-pot four-enzyme preparative-scale synthesis of LNnT Gal1-4GlcNAc1-3Gal1-4Glc. To prepare LNnT, a reaction mixture in Tris-HCl buffer (100 mM, pH 8.0) in a total volume of 80 mL containing Lc.sub.3 trisaccharide (1.0 g, 1.83 mmol), galactose (0.43 g, 2.38 mmol), ATP (1.40 g, 2.38 mmol), UTP (1.58 g, 2.38 mmol), MgCl.sub.2 (20 mM), EcGalK (20.0 mg), BLUSP (20.0 mg), NmLgtB (15.0 mg), and PmPpA (20 mg) was incubated in a shaker at 37 C. for 30 hrs. The product formation was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=5:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, the reaction mixture was added with the same volume (80 mL) of ethanol and incubated at 4 C. for 30 min. The precipitates were removed by centrifugation and the supernatant was concentrated and purified by a Bio-Gel P-2 gel column (water was used as an eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=5:3:1.5 by volume) to produce LNnT Gal1-4GlcNAc1-3Gal1-4Glc (1.19 g, 92%). .sup.1H NMR (800 MHz, D.sub.2O) 5.17 (d, J=4.0 Hz, 0.4H), 4.66 (d, J=8.0 Hz, 0.4H), 4.65 (d, J=8.0 Hz, 0.6H), 4.61 (d, J=8.0 Hz, 0.6H), 4.43 (d, J=7.2 Hz, 1H), 4.38 (d, J=8.0 Hz, 1H), 4.11 (d, J=3.2 Hz, 1H), 3.91-3.87 (m, 2H), 3.84-3.22 (m, 21H), 1.98 (s, 3H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 174.83, 102.79, 102.76, 102.73, 95.61, 81.82, 78.21, 78.11, 75.52 (2C), 74.76, 74.66, 74.22, 73.65, 73.42 (2C), 70.99, 69.88, 68.24, 68.22, 60.85, 60.84, 60.34, 59.93, 56.52, 22.03. HRMS (ESI) m/z calculated for C.sub.26H.sub.45NO.sub.21Na (M+Na) 730.2382, found 730.2379.
(414) One-pot two-enzyme preparative-scale synthesis of hexasaccharide DSLNnT Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc. To prepare DSLNnT, a reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 10 mL containing LNnT (131 mg, 0.19 mmol), Neu5Ac (143 mg, 0.46 mmol), CTP (260 mg, 0.46 mmol), MgCl.sub.2 (20 mM), NmCSS (3.0 mg), and Pd2,6ST (2.0 mg) was incubated in a shaker at 37 C. for 36 hrs. The reaction was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=4:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, the reaction mixture was added with the same volume (10 mL) of ethanol and incubated at 4 C. for 30 min. The precipitates were removed by centrifugation and the supernatant was concentrated and purified by a Bio Gel P-2 gel column (water was used as an eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=4:3:2 by volume) to produce Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc hexasaccharide (236 mg, 99%). .sup.1H NMR (800 MHz, D.sub.2O) 5.20 (d, J=4.0 Hz, 0.5H), 4.69 (d, J=8.0 Hz, 1H), 4.65 (d, J=8.0 Hz, 0.5H), 4.42 (d, J=8.0 Hz, 1H), 4.41 (d, J=8.0 Hz, 1H), 4.17 (d, J=2.4 Hz, 1H), 3.99-3.28 (m, 37H), 2.68 (dd, J=4.8 and 12.8 Hz, 1H), 2.64 (dd, J=4.8 and 12.8 Hz, 1H), 2.03 (s, 3H), 2.01 (s, 6H), 1.73-1.69 (m, 2H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 175.01 (3C), 173.66, 173.59, 103.65, 103.35, 102.74, 100.38, 100.23, 95.70, 82.29, 80.69, 79.76, 74.76, 74.72, 74.36, 73.80, 73.77, 73.37, 72.64 (2C), 72.62, 72.50, 71.86, 71.81, 70.83, 69.76, 68.50 (2C), 68.47 (3C), 68.32, 63.37, 63.23, 62.53 (2C), 60.23, 60.05, 54.83 (2C), 51.79, 51.69, 40.17 (2C), 22.38, 21.15, 21.12. HRMS (ESI) m/z calculated for C.sub.48H.sub.78N.sub.3O.sub.37 (MH) 1288.4314, found 1288.4305.
(415) One-pot two-enzyme preparative-scale synthesis of pentasaccharide 3-sLNnT Neu5Ac2-3Gal1-4GlcNAc1-3Gal1-4Glc.To prepare the pentasaccharide, a reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 8 mL containing LNnT (100 mg, 0.14 mmol), Neu5Ac (65 mg, 0.21 mmol), CTP (119 mg, 0.21 mmol), MgCl.sub.2 (20 mM), NmCSS (2.0 mg), and PmST1 M144D (1.5 mg) was incubated in a shaker at 37 C. for 48 hrs. The reaction was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=4:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, the reaction mixture was added with the same volume (8 mL) of ethanol and incubated at 4 C. for 30 min. The precipitates were removed by centrifugation and the supernatant was concentrated and purified by a Bio-Gel P-2 gel column (water was used as an eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=5:3:2 by volume) to produce Neu5Ac2-3Gal1-4GlcNAc1-3Gal1-4Glc (138 mg, 98%). .sup.1H NMR (800 MHz, D.sub.2O) 5.16 (d, J=3.2 Hz, 0.4H), 4.65 (d, J=8.0 Hz, 0.4H), 4.64 (d, J=8.0 Hz, 0.6H), 4.60 (d, J=8.0 Hz, 0.6H), 4.50 (d, J=8.0 Hz, 1H), 4.38 (d, J=8.0 Hz, 1H), 4.10 (d, J=3.2 Hz, 1H), 4.06 (dd, J=3.2 and 9.6 Hz, 1H), 3.91-3.21 (m, 29H), 2.70 (dd, J=4.8 and 12.8 Hz, 1H), 1.97 (s, 6H), 1.74 (t, J=12.0 Hz, 1H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 174.86, 174.77, 173.76, 102.78, 102.69, 102.38, 99.65, 95.59, 81.90, 78.08, 77.77, 75.29, 75.00, 74.73, 74.37, 74.17, 73.59, 72.70, 71.96, 71.60, 71.22, 70.93, 69.81, 69.21, 68.20, 67.88, 67.28, 62.37, 60.87, 59.85, 59.72, 59.61, 56.03, 51.58, 39.92, 22.02, 21.89. FIRMS (ESI) m/z calculated for C.sub.37H.sub.6, N.sub.2O.sub.29 (MH) 997.3360, found 997.3364.
(416) Human milk oligosaccharides (HMOs) and galactooligosaccharides (GOS). Human milk was obtained from 36 healthy volunteers recruited at the UCSD Medical Center, San Diego, Calif., after approval by the University's Institute Review Board. Human milk oligosaccharides (HMOs) were isolated from human milk as previously described. GOS syrup (Vivinal, dry matter 75%) was kindly provided by Friesland Campina Domo, The Netherlands.
(417) Rat studies. The efficacy of the synthesized glycans against necrotizing enterocolitis was tested in the same neonatal rat model as previously described for DSLNT. Briefly, pregnant time-dated Sprague-Dawley rats were induced at term and immediately randomized into one of the different study groups. Animals in the dam-fed group (DF) remained with the dam. All other animals were separated from the dam, housed in a temperature- and humidity-controlled incubator and orally gavaged with a special rodent formula (0.2 mL) twice daily. All animals, dam-fed and gavaged, were exposed to 10 min of hypoxia (5% O.sub.2, 95% N.sub.2) thrice daily in a modular chamber. All animals were sacrificed 96 hours post-partum, and 0.5 cm of the terminal ileum prepared for H&E staining per standard protocols and scored blindly based on morphological changes that included epithelial sloughing, villus edema, infiltration of neutrophils, apoptosis of villus enterocytes, crypt hyperplasia and misaligned nuclei in the epithelium. If at least one pathology sign was observed, a score of 0.5-1.5 was assigned depending on severity. Two or three signs together resulted in a score of 2-3. The maximum score of 4 was given in case of complete obliteration of the epithelium with or without intestinal perforation. Pathology scores were plotted for each animal and the mean calculated per group. Differences between the groups were calculated by 1 way ANOVA with Kruskal-Wallis test and Dunn's Multiple Comparison test. Significance was defined as a P value of less than 0.05.
(418) Results
(419) A general process for sequential one-pot multi-enzyme (OPME) reactions is shown in
(420) To obtain lacto-N-neotetraose (LNnT), a common human milk tetrasaccharide (38-3), Lc.sub.3 trisaccharide GlcNAc1-3Gal1-4Glc (38-2) (
(421) Taking advantage of a promiscuous Bifidobacterium longum UDP-sugar pyrophosphorylase (BLUSP) which can produce uridine 5-diphosphate galactose (UDP-Gal) directly from UTP and galactose-1-phosphate (Gal-1-P), LNnT Gal1-4GlcNAc1-3Gal1-4Glc (38-3) was synthesized from Lc.sub.3 trisaccharide (38-2) and a simple galactose (Gal) in an excellent yield (92%) using a one-pot four-enzyme Gal activation and transfer reaction containing Escherichia coli galactokinase (EcGalK), BLUSP, PmPpA, and Neisseria meningitidis 1-4-galactosyltransferase (NmLgtB). This is an improved and a more direct and effective system compared to our previously reported OPME 1-4-galactosylation process which involved the formation of UDP-glucose (UDP-Glc) from glucose-1-phosphate (Glc-1-P) followed by C4-epimerization to produce UDP-Gal indirectly.
(422) Sialylation of LNnT can be achieved by sialyltransferase (SiaT)-catalyzed reaction with in situ generation of sugar nucleotide donor CMP-sialic acid catalyzed by a CMP-sialic acid synthetase (CSS). For the synthesis of sialosides containing the most common sialic acid form, N-acetylneuraminic acid (Neu5Ac), the one-pot two-enzyme sialylation system is sufficient and the application of a sialic acid aldolase to generate Neu5Ac from its six-carbon precursor N-acetylmannosamine (ManNAc) is not necessary as the commercial prices for Neu5Ac and ManNAc are similar.
(423) Initial sialylation of LNnT using Neu5Ac in a one-pot two-enzyme sialic acid activation and transfer system containing Neisseria meningitidis CMP-sialic acid synthetase (NmCSS) and Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST) with an Neu5Ac to LNnT ratio of 1.5 to 1 produced an unexpected mixture of mono-sialylated and disialyl LNnT (DSLNnT) which were difficult to separate. Increasing the Neu5Ac to LNnT ratio to 2.4 to 1 led to the complete formation of DSLNnT hexasaccharide Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc (38-4) with an excellent yield (99%). Nuclear magnetic resonance (NMR) data confirmed that Pd2,6ST does not only add a Neu5Ac 2-6-linked to the terminal Gal, it also adds an 2-6-linked Neu5Ac to the internal Gal residue in LNnT. As shown in Table 1, the attachment of Neu5Ac to the C-6 of the internal Gal (Gal.sup.II) and the terminal Gal (Gal.sup.IV) in LNnT results in significant downfield shifts of the substituted carbons (a downfield shift of 2.39 ppm for the C-6 of Gal.sup.II and a downfield shift of 2.52 ppm for the C-6 of Gal.sup.IV in DSLNnT. There are obvious interactions of the Neu5Ac residues and GlcNAc.sup.III and Glc.sup.I which result in a significant downfield shift of 2.58 ppm for the C-4 of GlcNAc.sup.II and a downfield shift of 1.55 ppm for the C-4 of Glc.sup.I. These unusual chemical shift changes seen in Neu5Ac2-6Gal sialosides are in accordance with those observed for the glycans with same or similar structural element. To our knowledge, this property of adding multiple Neu5Ac residues to both terminal and internal Gal by Pd2,6ST has never been discovered before and the obtained DSLNnT is a new structure that has never been synthesized.
(424) TABLE-US-00014 TABLE 13 .sup.13C NMR chemical shifts for compound Gal1-4Glc (Lac), GlcNAc1- 3Gal1-4Glc (Lc.sub.3 glycan), Gal1-4GlcNAc1-3Gal1-4Glc (LNnT; 38-3), and Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2- 6)Gal1-4Glc (DSLNnT; 38-4). VI IV III V II I Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc Carbon Lc.sub.3 Sugar Unit atoms Lac glycan LNnT DSLNnT -D-Glc.sup.I 1 95.64 95.66 95.61 95.70 2 73.70 73.71 73.65 73.37 3 74.26 74.20 74.22 74.36 4 78.19 78.21 78.21 79.76 5 74.69 74.71 74.76 74.76 6 59.78 60.01 60.34 60.23 -D-Gal.sup.II(1-4) 1 102.79 102.84 102.76 103.35 2 70.86 70.03 69.88 69.76 3 72.42 81.87 81.82 82.29 4 68.46 68.26 68.22 68.32 5 75.25 74.80 75.52 73.77 6 60.94 60.88 60.84 63.23 -D-GlcNAc.sup.III(1-3) 1 102.75 102.73 102.74 2 56.58 56.52 54.83 3 73.49 73.42 72.50 4 69.92 78.11 80.69 5 75.57 74.66 74.72 6 60.41 59.93 60.05 CO 174.87 174.83 175.01 CH.sub.3 22.09 22.03 22.38 -D-Gal.sup.IV(1-4) 1 102.79 103.65 2 70.99 70.83 3 73.42 72.62 4 68.24 68.47 5 75.52 73.80 6 60.85 63.37 -D-Neu5Ac.sup.V(2-6) 1 173.59 2 100.38 3 40.17 4 68.47 5 51.69 6 72.64 7 68.50 8 71.86 9 62.53 CO 175.01 CH.sub.3 22.12 -D-Neu5Ac.sup.VI(2-6) 1 173.66 2 100.23 3 40.17 4 68.47 5 51.79 6 72.64 7 68.50 8 71.81 9 62.53 CO 175.01 CH.sub.3 22.15
(425) As DSLNnT resembles some structural features of DSLNT, we hypothesized that the newly obtained DSLNnT may also have NEC preventing activity. As a control, monosialyl pentasaccharide 3-sialyl LNnT (3-sLNnT) was synthesized from LNnT using a one-pot two-enzyme sialic acid activation and transfer system similar to that described above for DSLNnT except that a different sialyltransferase was used. A single-site mutant of Pasteurella multocida multifunctional 2-3-sialyltransferase (PmST1 M144D) was used to form an 2-3-sialyl linkage instead of the 2-6-sialyl linkages in DSLNnT described above. In addition, unlike Pd2,6ST-catalyzed sialylation reaction which could add either one or two 2-6-linked sialic acid residues to LNnT, PmST1 M144D-catalyzed sialylation reaction only added one 2-3-linked sialic acid residue to the terminal Gal in LNnT. The application of the PmST1 M144D mutant instead of wild-type PmST1 avoids the product hydrolysis by the 2-3-sialidase activity of the wild-type enzyme, thus improves the yield of the one-pot two-enzyme 2-3-sialylation reaction. Indeed, an excellent yield (98%) was achieved without the need of close monitor of the reaction process or to stop the reaction promptly.
(426) The efficacy of DSLNnT or 3-sLNnT in protecting against NEC was tested in the same neonatal rat model that had been used previously to show the NEC protection effect of DSLNT. Since DSLNT was not available, a mixture of human milk oligosaccharides (HMOs) isolated from pooled human milk was used as a positive intervention control instead. A galactooligosaccharides (GOS) sample, shown to be ineffective in preventing NEC, was used as negative intervention control. As shown in
(427) These results show that similar to DSLNT, DSLNnT reduces pathology scores in an NEC neonatal rat model. Both DSLNT and DSLNnT are disialyl hexasaccharides but with noticeable structural differences. First of all, DSLNT is a disialyl type I glycan whose core tetrasaccharide has a Gal residue 1-3-linked to Lc.sub.3 trisaccharide, while DSLNnT is a disialyl type II glycan whose core tetrasaccharide has a Gal residue 1-4-linked to the Lc.sub.3 trisaccharide. Secondly, although both have a Neu5Ac 2-6-linked to an internal monosaccharide, the internal monosaccharide is GlcNAc in DSLNT while a Gal in DSLNnT. Thirdly, the outermost Neu5Ac is linked to the penultimate Gal in an 2-3-linkage in DSLNT but an 2-6-linkage in DSLNnT. These structural differences of DSLNT and DSLNnT and their similarity in protecting neonatal rats from NEC indicate that the negatively charged disialyl component is important for the NEC preventing effect while the tetrasaccharide scaffold (type I or type II) does not seem to be important. The importance of disialyl component is further supported by the lacking of NEC preventing effect by monosialyl pentasaccharides such as LSTb shown previously and 3-sLNnT shown here.
(428) As DSLNnT is synthetically readily available, it has the potential to be used for treating NEC in preterm infants. The sequential OPME systems described here allow the use of inexpensive and simple disaccharide and monosaccharides to synthesize desired complex oligosaccharides with high efficiency and selectivity. These are efficient approaches that can be used to obtain DSLNnT in amounts large enough for pre-clinical and clinical applications.
(429) The novel synthetic disialyllacto-N-neotetraose (DSLNnT) can protect neonatal rats from NEC. Unlike the NEC-preventing DSLNT previously identified from human milk which is not easily obtainable by either purification or synthesis, the newly identified DSLNnT is readily available by enzymatic synthesis. Highly efficient one-pot multienzyme GlcNAcylation, galactosylation, and sialylation systems for the high-yield synthesis of DSLNnT have been established. The readily available DSLNnT is a good therapeutic candidate for treating NEC in preterm infants.
Example 15
Synthesis of Other Novel Disialyl Oligosaccharides
Compound 15.2a: Neu5Ac2-3(Neu5Ac2-6)Gal1-4Glc
(430) Neu5Ac2-3Gal1-4Glc (GM3, 83 mg, 0.13 mmol), Neu5Ac (61 mg, 0.20 mmol), and CTP (113 mg, 0.20 mmol) were dissolved in Tris-HCl buffer (5 mL, pH 8.5) containing MgCl.sub.2 (20 mM), N. meningitidis CMP-sialic acid synthetase (NmCSS, 1.7 mg), and Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST, 2.1 mg). The reaction was carried out by incubating the reaction mixture in an incubator shaker at 37 C. for 24 hrs. The reaction was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=4:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, to the reaction mixture was added the same volume (5 mL) of EtOH, and the mixture was incubated at 4 C. for 30 min. The precipitates were removed by centrifugation and the supernatant was concentrated and purified by a Bio-Gel P-2 gel column (water was used as eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=4:2:1 by volume) and finally by Bio-Gel P-2 column (eluted with H.sub.2O) to provide Neu5Ac2-3(Neu5Ac2-6)Gal1-4Glc tetrasaccharide (112 mg, 93%). .sup.1H NMR (600 MHz, D.sub.2O) 5.24 (d, J=3.6 Hz, 0.4H), 4.69 (d, J=7.8 Hz, 0.6H), 4.53 (d, J=7.8 Hz, 1H), 4.15-4.13 (m, 1H), 4.00-3.96 (m, 3H), 3.91-3.62 (m, 9H), 3.72-3.32 (m, 13H), 2.77 (dd, J=4.2 and 12.0 Hz, 1H), 2.72 (dd, J=4.2 and 12.0 Hz, 1H), 2.05 (s, 6H), 1.82 (t, J=12.0 Hz, 1H), 1.76 (t, J=12.0 Hz, 1H). .sup.13C NMR (150 MHz, D.sub.2O) -isomer: 174.90, 174.79, 173.73, 173.38, 102.87, 100.19, 99.90, 95.59, 79.67, 79.56, 75.18, 74.57, 74.52, 73.63, 73.42, 72.78, 72.41, 71.65, 71.62, 69.16, 68.33, 68.32, 68.02, 67.52, 63.45, 62.57, 62.50, 60.20, 51.69, 51.58, 39.98, 39.40, 21.98, 21.96. HRMS (ESI) m/z calculated for C.sub.34H.sub.56N.sub.2O.sub.27 (MH) 924.3070, found 924.3060.
Compound 15.2b: Neu5Ac2-8Neu5Ac2-3Gal1-4Glc
(431) Neu5Ac2-3Gal1-4Glc (GM3, 200 mg, 0.32 mmol), Neu5Ac (107 mg, 0.35 mmol), and CTP (197 mg, 0.35 mmol) were dissolved in Tris-HCl buffer (15 mL, pH 8.5) containing MgCl.sub.2 (20 mM), NmCSS (3.8 mg), and Campylobacter jejuni 2-8-sialyltransferase (CstII, 3.0 mg). The reaction was carried out by incubating the reaction mixture in an incubator shaker at 37 C. for 20 hrs. The reaction was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=4:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, to the reaction mixture was added the same volume (15 mL) of EtOH, and the mixture was incubated at 4 C. for 30 min. The precipitates were removed by the centrifuge and the supernatant was concentrated and purified by a Bio-Gel P-2 gel column (water was used as eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=5:3:2 by volume) and finally Bio-Gel P-2 column (eluted with H.sub.2O) to provide Neu5Ac2-8Neu5Ac2-3Gal1-4Glc tetrasaccharide (239 mg, 82%). .sup.1H NMR (800 MHz, D.sub.2O) 5.22 (d, J=3.2 Hz, 0.3H), 4.66 (d, J=8.0 Hz, 0.7H), 4.52 (d, J=7.2 Hz, 1H), 4.18-4.08 (m, 3H), 3.98-3.95 (m, 2H), 3.91-3.29 (m, 21H), 2.77 (dd, J=4.8 and 12.8 Hz, 1H), 2.67 (dd, J=4.8 and 12.8 Hz, 1H), 2.07 (s, 3H), 2.03 (s, 3H), 1.74 (t, J=12.0 Hz, 2H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 174.89, 174.88, 173.40, 173.26, 102.58, 100.42, 100.09, 95.71, 78.09, 77.98, 77.83, 75.34, 75.11, 74.72, 74.17, 73.90, 72.54, 71.69, 71.08, 69.17, 68.37, 68.00, 67.81, 67.39, 62.49, 61.46, 61.99, 59.89, 51.18, 51.66, 40.38, 39.61, 22.23, 21.96. FIRMS (ESI) m/z calculated for C.sub.34H.sub.56N.sub.2O.sub.27 (MH) 924.3070, found 924.3071.
Compound 15.11: Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc (DSLNnT)
(432) To prepare DSLNnT, a reaction mixture in a total volume of 10 mL in Tris-HCl buffer (100 mM, pH 8.5) containing LNnT (131 mg, 0.19 mmol), Neu5Ac (143 mg, 0.46 mmol), CTP (260 mg, 0.46 mmol), MgCl.sub.2 (20 mM), NmCSS (3.0 mg), and Pd2,6ST (2.0 mg) was incubated in a shaker at 37 C. for 36 hrs. The reaction was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=4:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, the reaction mixture was added with the same volume (10 mL) of ethanol and incubated at 4 C. for 30 min. The precipitates were removed by centrifugation and the supernatant was concentrated and purified by a Bio Gel P-2 gel column (water was used as an eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=4:3:2 by volume) and finally Bio-Gel P-2 column (eluted with H.sub.2O) to produce Neu5Ac2-6Gal1-4GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc hexasaccharide (236 mg, 99%). .sup.1H NMR (800 MHz, D.sub.2O) 5.20 (d, J=4.0 Hz, 0.5H), 4.69 (d, J=8.0 Hz, 1H), 4.65 (d, J=8.0 Hz, 0.5H), 4.42 (d, J=8.0 Hz, 1H), 4.41 (d, J=8.0 Hz, 1H), 4.17 (d, J=2.4 Hz, 1H), 3.99-3.28 (m, 37H), 2.68 (dd, J=4.8 and 12.8 Hz, 1H), 2.64 (dd, J=4.8 and 12.8 Hz, 1H), 2.03 (s, 3H), 2.01 (s, 6H), 1.73-1.69 (m, 2H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 175.01 (3C), 173.66, 173.59, 103.65, 103.35, 102.74, 100.38, 100.23, 95.70, 82.29, 80.69, 79.76, 74.76, 74.72, 74.36, 73.80, 73.77, 73.37, 72.64 (2C), 72.62, 72.50, 71.86, 71.81, 70.83, 69.76, 68.50 (2C), 68.47 (3C), 68.32, 63.37, 63.23, 62.53 (2C), 60.23, 60.05, 54.83 (2C), 51.79, 51.69, 40.17 (2C), 22.38, 21.15, 21.12. FIRMS (ESI) m/z calculated for C.sub.48H.sub.78N.sub.3O.sub.37 (MH) 1288.4314, found 1288.4305.
Compound 15.12: Neu5Ac2-6Gal1-3GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc (DSLNT)
(433) Gal1-3GlcNAc1-3Gal1-4Glc (LNT, 150 mg, 0.21 mmol), Neu5Ac (169 mg, 0.55 mmol), and CTP (307 mg, 0.55 mmol) were dissolved in Tris-HCl buffer (10 mL, pH 8.5) containing MgCl.sub.2 (20 mM), NmCSS (4.0 mg), and Pd2,6ST (3.0 mg). The reaction was carried out by incubating the reaction mixture in an incubator shaker at 37 C. for 36 hrs. The reaction was monitored by TLC (n-PrOH:H.sub.2O:NH.sub.4OH=4:2:1 by volume and detected by p-anisaldehyde sugar stain) and mass spectrometry. When an optimal yield was achieved, to the reaction mixture was added the same volume (10 mL) of EtOH and the mixture was incubated at 4 C. for 30 min. The precipitates were removed by centrifugation and the supernatant was concentrated and purified by a Bio-Gel P-2 gel column (water was used as eluent). Further purification was achieved by silica gel chromatography (EtOAc:MeOH:H.sub.2O=4:3:2 by volume) and finally Bio-Gel P-2 column (eluted with H.sub.2O) to provide Neu5Ac2-6Gal1-3GlcNAc1-3(Neu5Ac2-6)Gal1-4Glc hexasaccharide (268 mg, 98%). .sup.1H NMR (600 MHz, D.sub.2O) 5.24 (d, J=3.6 Hz, 0.4H), 4.74 (d, J=8.4 Hz, 1H), 4.68 (d, J=8.4 Hz, 0.6H), 4.44 (d, J=7.8 Hz, 1H), 4.40 (d, J=7.8 Hz, 1H), 4.19 (d, J=3.8 Hz, 1H), 4.00-3.31 (m, 37H), 2.73-2.70 (m, 2H), 2.04 (s, 6H), 2.03 (s, 3H), 1.75 (t, J=12.0 Hz, 1H), 1.71 (t, J=12.0 Hz, 1H). .sup.13C NMR (200 MHz, D.sub.2O) -isomer: 174.86, 174.83 (2C), 173.42 (2C), 103.80, 103.14, 102.51, 100.19, 100.07, 95.56, 83.58, 81.98, 79.57, 75.19, 74.58, 74.54, 73.62, 73.49, 73.21, 72.43, 72.38, 72.29, 71.74, 71.68, 70.45, 69.88, 69.66, 68.61, 68.38, 68.31, 68.29, 68.20, 68.08, 63.41, 63.39, 62.56 (2C), 60.58, 60.17, 54.37, 51.74, 51.70, 40.07, 40.02, 22.15, 21.98 (2C). FIRMS (ESI) m/z calculated for C.sub.48H.sub.78N.sub.3O.sub.37 (MH) 1288.4314, found 1288.4290.
Compound 15.18: Neu5Ac2-3(Neu5Ac2-6)Gal1-9Kdn
(434) Neu5Ac2-3Gal1-9Kdn was prepared first by following the general one-pot two-enzyme 2-3-sialylation system described above from Gal1-9Kdn (101 mg, 0.22 mmol) in Tris-HCl buffer (100 mM, pH 8.5) containing Neu5Ac (109 mg, 0.33 mmol), CTP (188 mg, 0.33 mmol), MgCl.sub.2 (20 mM), NmCSS (0.8 mg), and PmST1 (0.04 mg). The reaction was incubated at 37 C. for 3 h with shaking (120 rpm). The crude product was purified by Bio-Gel P-2 gel filtration to afford the sialoside product Neu5Ac2-3Gal1-9Kdn (148 mg, 89%). .sup.1H NMR (600 MHz, D.sub.2O): 4.33 (d, 1 H, J=7.8 Hz, H-1), 4.00 (dd, 1 H, J=1.8 and 10.8 Hz), 3.93 (dd, 1 H, J=3.6 and 11.2 Hz), 3.82-3.65 (m, 9 H), 3.60-3.39 (m, 9 H), 2.58 (dd, 1 H, J=4.2 and 12.6 Hz, H-3eq), 2.01 (dd, 1 H, J=4.8 and 13.2 Hz, H-3eq), 1.85 (s, 3 H, CH3), 1.62 (t, 1 H, J=12.0 Hz, H-3ax), 1.60 (t, 1 H, J=12.0 Hz, H-3ax). .sup.13C NMR (75 MHz, D.sub.2O): 176.29, 175.17, 173.95, 103.28, 99.93, 96.35, 75.87, 75.07, 73.02, 71.93, 71.90, 71.86, 71.61, 70.44, 69.64, 69.50, 69.15, 68.48, 68.25, 67.97, 67.67, 62.75, 61.13, 59.50, 51.84, 39.82, 39.14, 22.22. HRMS (ESI) calcd. for C.sub.26H.sub.41NNaO.sub.22 (MNa), 742.2018, found 742.2001.
(435) Neu5Ac2-3(Neu5Ac2-6)Gal1-9Kdn was then prepared from Neu5Ac2-3Gal1-9Kdn (130 mg, 0.17 mmol) in Tris-HCl buffer (100 mM, pH 8.5) containing Neu5Ac (84 mg, 0.25 mmol), CTP (143 mg, 0.25 mmol), MgCl.sub.2 (20 mM), NmCSS (0.8 mg), and Pd2,6ST (0.2 mg). The reaction was incubated at 37 C. for 12 hrs with shaking (120 rpm). The crude product was purified by Bio-Gel P-2 gel filtration to afford the sialoside product (159 mg, 87%). .sup.1H NMR (600 MHz, D.sub.2O): 4.33 (d, 1 H, J=7.8 Hz, H-1), 3.99 (m, 1 H), 3.94 (dd, 1 H, J=3.0 and 9.6 Hz), 3.83-3.59 (m, 13 H), 3.56-3.38 (m, 12 H), 2.59-2.53 (m, 2 H, H-3eq, H-3eq), 2.00 (dd, 1 H, J=4.8 and 13.2 Hz, H-3eq), 1.85 (s, 6 H, 2CH.sub.3), 1.64-1.57 (m, 2 H, H-3ax, H-3ax), 1.52 (t, 1 H, J=12.0 Hz, H-3ax). .sup.13C NMR (75 MHz, D.sub.2O): 177.12, 175.16 (2C), 173.94, 173.60, 103.26, 100.64, 100.13, 96.62, 75.66, 73.40, 73.02, 72.78, 71.96, 71.90, 71.87, 71.55, 70.59, 69.49, 69.44, 69.27, 68.56, 68.49, 68.47, 68.28, 67.79, 63.57, 62.85, 62.78, 61.03, 52.04, 51.84, 40.31, 39.73, 39.32, 22.27 (2C). FIRMS (ESI) calcd. for C.sub.37H.sub.57N.sub.2Na.sub.2O.sub.30 (M-Na) 1055.2792, found 1055.2853.
DNA and Protein Sequences for Genes and Enzymes
(436) TABLE-US-00015 DNAsequenceofNahK_ATCC15697(Note:Thesequencesfor His.sub.6-tagareunderlined) (SEQIDNO:1) ATGAACAACACCAATGAAGCCCTGTTCGACGTCGCTTCGCACTTCGCGCTGGAAGGCACCGT CGACAGCATCGAACCATACGGAGACGGCCATATCAACACCACCTATCTGGTGACCACGGACG GCCCCCGCTACATCCTCCAACGGATGAACACCGGCATCTTCCCCGATACGGTGAATCTGATG CGCAATGTCGAGCTGGTCACCTCCACTCTCAAGGCTCAGGGCAAAGAGACGCTGGACATCGT GCGCACCACCTCCGGCGACACCTGGGCCGAGATCGACGGCGGCGCATGGCGCGTCTACAAGT TCATCGAACACACCATGTCATACAACCTCGTGCCGAACCCGGACGTGTTCCGCGAAGCCGGC AGGGCGTTCGGTGATTTCCAGAACTTCCTGTCCGGGTTCGACGCCAACCAGCTGACCGAGAC CATCGCCCACTTCCACGACACCCCGCACCGCTTCGAGGACTTCAAGAAGGCGCTCGCCGCGG ACGAGCTCGGGCGTGCCGCCGGGTGCGGCCCGGAGATCGAGTTCTATCTGAGTCACGCCGAC CAGTACGCCGTCGTGATGGATGGGCTCAGGGATGGTTCGATCCCGCTGCGCGTGACCCACAA CGACACCAAACTCAACAACATCCTCATGGATGCCACCACCGGCAAGGCCCGTGCGATCATCG ATCTAGACACCATCATGCCGGGGTCCATGCTCTTCGACTTCGGCGATTCCATCCGTTTCGGC GCGTCCACGGCCTTGGAGGATGAGCGGGATCTGGACAAGGTGCATTTCAGCACCGAGCTGTT CCGCGCCTACACGGAAGGCTTCGTGGGCGAACTACGCGACAGCATCACCGCGCGCGAGGCCG AACTGCTGCCGTTCAGCGGCAACCTGCTCACCATGGAATGCGGCATGCGCTTTCTCGCCGAC TACCTGGAAGGCGACGTCTACTTCGCCACCAAGTACCCCGAGCATAACCTGGTGCGCTCCCG CACCCAGATCAAGCTCGTGAGGGAGATGGAGCAGCGAGCCGATGAGACCCGCGCCATCGTGG CCGACGTCATGGAGTCGACCAAGCTCGAGCACCACCACCACCACCACTGA ProteinsequenceofNahK_ATCC15697(Note:Thesequencesfor His.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:2) MNNTNEALFDVASHFALEGTVDSIEPYGDGHINTTYLVTTDGPRYILQRMNTGIFPDTVNLM RNVELVTSTLKAQGKETLDIVRTTSGDTWAEIDGGAWRVYKFIEHTMSYNLVPNPDVFREAG RAFGDFQNFLSGFDANQLTETIAHFHDTPHRFEDFKKALAADELGRAAGCGPEIEFYLSHAD QYAVVMDGLRDGSIPLRVTHNDTKLNNILMDATTGKARAIIDLDTIMPGSMLFDFGDSIRFG ASTALEDERDLDKVHFSTELFRAYTEGFVGELRDSITAREAELLPFSGNLLTMECGMRFLAD YLEGDVYFATKYPEHNLVRSRTQIKLVREMEQRADETRAIVADVMESTKLEHHHHHH DNAsequenceofNahK_ATCC55813(Note:Thesequencesfor His.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:3) ATGACCGAAAGCAATGAAGTTTTATTCGGCATCGCCTCGCATTTTGCGCTGGAAGGTGCCGT GACCGGTATCGAACCTTACGGAGACGGCCACATCAACACCACCTATCTGGTGACCACGGACG GCCCCCGCTACATCCTCCAGCAGATGAACACCAGCATCTTCCCCGATACGGTGAATCTGATG CGCAATGTCGAACTGGTCACCTCCACTCTCAAGGCTCAGGGCAAAGAGACGCTGGACATTGT GCCCACCACCTCAGGCGCCACCTGGGCCGAGATCGATGGCGGCGCATGGCGCGTCTACAAGT TCATCGAACACACCGTGTCCTACAACCTCGTGCCGAACCCGGACGTGTTCCGCGAAGCCGGC AGCGCATTCGGCGACTTCCAGAACTTCCTGTCCGAATTCGACGCCAGCCAGCTGACCGAAAC CATCGCCCACTTCCACGACACCCCGCATCGTTTCGAGGACTTCAAGGCCGCCCTCGCCGCGG ACAAGCTCGGCCGCGCCGCCGCATGCCAGCCGGAAATCGACTTCTATCTGAGTCACGCCGAC CAGTATGCCGTCGTGATGGATGGGCTCAGGGACGGTTCGATTCCGCTGCGCGTGACCCACAA TGACACCAAGCTCAACAACATCCTCATGGACGCCACCACCGGCAAGGCGCGTGCGATCATCG ATCTCGACACCATCATGCCCGGCTCCATGCTGTTCGACTTCGGCGATTCCATACGCTTTGGT GCGTCCACTGCTCTGGAAGACGAAAAGGACCTCAGCAAGGTGCATTTCAGCACCGAGCTGTT CCGCGCCTACACGGAAGGCTTCGTGGGCGAACTACGCGGCAGCATCACCGCGCGCGAGGCCG AACTGCTGCCGTTCAGCGGCAACCTGCTCACCATGGAATGCGGCATGCGCTTTCTCGCCGAC TACTTGGAAGGCGATATCTACTTTGCCACCAAGTACCCCGAGCATAATCTGGTGCGCACCCG CACCCAGATCAAACTCGTGCAGGAGATGGAGCAGAAGGCCAGTGAAACCCACGCCATCGTAG CCGACATCATGGAGGCTGCCAGGCTCGAGCACCACCACCACCACCACTGA ProteinsequenceofNahK_ATCC55813(Note:Thesequencesfor His.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:4) MTESNEVLFGIASHFALEGAVTGIEPYGDGHINTTYLVTTDGPRYILQQMNTSIFPDTVNLM RNVELVTSTLKAQGKETLDIVPTTSGATWAEIDGGAWRVYKFIEHTVSYNLVPNPDVFREAG SAFGDFQNFLSEFDASQLTETIAHFHDTPHRFEDFKAALAADKLGRAAACQPEIDFYLSHAD QYAVVMDGLRDGSIPLRVTHNDTKLNNILMDATTGKARAIIDLDTIMPGSMLFDFGDSIRFG ASTALEDEKDLSKVHFSTELFRAYTEGFVGELRGSITAREAELLPFSGNLLTMECGMRFLAD YLEGDIYFATKYPEHNLVRTRTQIKLVQEMEQKASETHAIVADIMEAARLEHHHHHH DNAsequenceofAtGlcAK(Note:Italicsectionsofthe sequencesarefrompET15bvectorandprimer). (SEQIDNO:5) ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATAT GGATCCGAATTCCACGGTTTCCGGCGATGGTCAGGCGACGGCGGCGATAGAGCATCGGTCCT TCGCTCGGATCGGATTTCTCGGAAACCCGAGCGATGTATACTTCGGGCGAACCATATCATTG ACCATCGGAAACTTCTGGGCATCCGTGAAGCTGGAGCCATCGGAGCATCTCGTAATCAAGCC TCATCCATTCCATGATCTCGTCCAGTTCACCTCTCTCGACCATCTCCTGAATCGTTTGCAAA ATGAAGGATACTACGGTGGGGTAAGGTTGCTAATGGCGATATGTAAAGTATTCCGTAACTAT TGCAAAGAGAATGACATTCAACTTCACCAAGCCAACTTCTCTCTTTCTTATGATACCAATAT CCCTAGGCAGACAGGGCTTTCGGGTTCTAGTGCCATCGTATCCGCTGCCCTTAACTGCCTTC TCGACTTCTACAATGTCAGGCATTTGATCAAAGTACAAGTCCGCCCTAACATTGTTCTCAGT GCTGAGAAAGAACTTGGCATTGTTGCTGGTCTTCAGGACAGGGTTGCTCAGGTCTATGGTGG TCTTGTTCACATGGATTTTAGCAAGGAGCACATGGATAAATTGGGGCATGGGATTTACACTC CTATGGATATCAGTCTCCTCCCTCCTCTGCATCTCATCTATGCTGAGAATCCGAGCGACTCA GGGAAGGTACATAGTATGGTTCGGCAAAGATGGTTAGACGGTGATGAGTTTATAATCTCATC AATGAAAGAAGTCGGAAGTCTAGCAGAAGAAGGTCGAACTGCATTACTCAACAAGGACCATT CCAAACTTGTGGAACTCATGAACCTTAATTTCGACATTCGGAGGCGGATGTTTGGGGATGAA TGCTTAGGAGCAATGAACATGGAGATGGTGGAAGTAGCAAGGAGGGTTGGTGCAGCCTCAAA GTTCACTGGAAGTGGAGGAGCAGTGGTGGTTTTCTGCCCTGAAGGTCCATCTCAGGTGAAAC TTCTGGAAGAAGAATGCAGGAAAGCGGGATTTACGCTTCAGCCGGTAAAAATTGCGCCTTCA TGTTTGAATGATTCTGACATTCAGACCTTATGA ProteinsequenceofAtGlcAK(Note:Italicsectionsofthe sequencesarefrompET15bvectorandprimer.N-terminal His.sub.6-tag(SEQIDNO:22)isunderlinedintheprotein sequence) (SEQIDNO:6) MGSSHHHHHHSSGLVPRGSHMDPNSTVSGDGQATAAIEHRSFARIGFLGNPSDVYFGRTISL TIGNFWASVKLEPSEHLVIKPHPFHDLVQFTSLDHLLNRLQNEGYYGGVRLLMAICKVFRNY CKENDIQLHQANFSLSYDTNIPRQTGLSGSSAIVSAALNCLLDFYNVRHLIKVQVRPNIVLS AEKELGIVAGLQDRVAQVYGGLVHMDFSKEHMDKLGHGIYTPMDISLLPPLHLIYAENPSDS GKVHSMVRQRWLDGDEFIISSMKEVGSLAEEGRTALLNKDHSKLVELMNLNFDIRRRMFGDE CLGAMNMEMVEVARRVGAASKFTGSGGAVVVFCPEGPSQVKLLEEECRKAGFTLQPVKIAPS CLNDSDIQTL DNAsequenceofHis.sub.6-PmGlmU(Note:Italicsectionsofthe sequencesarefrompET15bvectorandprimer) (SEQIDNO:7) ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATAT GAAAGAGAAAGCATTAAGTATCGTGATTTTAGCGGCAGGTAAAGGGACGCGGATGTATTCTG ATTTACCAAAAGTGCTACATAAAATTGCCGGAAAACCGATGGTAAAACATGTGATCGATACG GTGAAATCCATTCATGCAAAAAATATCCATTTAGTGTATGGACATGGTGGGGAAGTGATGCA AACTCGCTTGCAAGATGAACCTGTGAATTGGGTOTTACAAGCCGAGCAATTAGGTACGGGGC ATGCTATGCAGCAAGCAGCCCCGTTTTTTGCAGATGATGAAAATATTTTGATGCTTTATGGT GATGGACCATTAATTACTGCGAAAACCTTACAAACATTAATTGCGGCAAAACCTGAACATGG TATTGCATTATTGACCGTCGTATTAGATGACCCAACTGGTTATGGGCGTATTGTGCGTGAAA ATGGCAATGTGGTGGCGATTGTGGAACAAAAAGATGCCAATGCAGAGCAATTAAAAATCCAA GAAATTAACACAGGCTTGTTAGTGGCAGACGGTAAAAGTTTGAAAAAATGGTTATCACAGTT AACCAACAACAATGCACAGGGAGAATATTATATTACGGATGTGATCGCCTTAGCGAATCAAG ACGGTTGCCAAGTAGTGGCGGTACAAGCCAGTAACTTTATGGAAGTAGAGGGCGTGAATAAC CGTCAGCAATTAGCGCGTTTAGAGCGTTATTATCAGCGCAAACAAGCAGACAATTTATTATT GGCTGGGGTGGCATTAGCGGATCCTGAGCGTTTTGATTTACGCGGGGAACTAAGCCATGGGA AAGACGTGCAAATTGATGTGAACGTGATTATCGAGGGCAAAGTCAGCTTAGGTCACCGAGTT AAAATTGGAGCAGGTTGTGTGTTAAAAAATTGCCAGATTGGTGATGATGTAGAAATTAAACC TTATTCTGTGTTGGAAGAGGCGATTGTTGGACAAGCTGCGCAAATTGGACCCTTCTCTCGTT TGCGTCCGGGGGCTGCATTAGCCGACAACACTCATATTGGTAATTTCGTTGAAATTAAGAAA GCGCATATTGGGACAGGCTCGAAAGTAAACCATTTAAGTTATGTGGGAGATGCCGAAGTCGG GATGCAATGTAATATTGGTGCCGGCGTGATCACTTGTAACTATGATGGCGCAAATAAATTTA AGACCATTATTGGTGATAATGTGTTTGTAGGGTCTGATGTACAACTCGTGGCACCGGTTACC ATCGAAACGGGTGCAACCATTGGTGCGGGGACTACGGTGACCAAAGATGTGGCTTGTGATGA GTTAGTGATTTCACGTGTTCCTCAACGTCATATTCAAGGTTGGCAACGCCCTACTAAACAAA CGAAAAAGTAA ProteinsequenceofHis.sub.6-PmGlmU(Note:Italicsectionsofthe sequencesarefrompET15bvectorandprimer.N-terminal His.sub.6-tag(SEQIDNO:22)isunderlinedintheprotein sequence) (SEQIDNO:8) MGSSHHHHHHSSGLVPRGSHMKEKALSIVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDT VKSIHAKNIHLVYGHGGEVMQTRLQDEPVNWVLQAEQLGTGHAMQQAAPFFADDENILMLYG DGPLITAKTLQTLIAAKPEHGIALLTVVLDDPTGYGRIVRENGNVVAIVEQKDANAEQLKIQ EINTGLLVADGKSLKKWLSQLTNNNAQGEYYITDVIALANQDGCQVVAVQASNFMEVEGVNN RQQLARLERYYQRKQADNLLLAGVALADPERFDLRGELSHGKDVQIDVNVIIEGKVSLGHRV KIGAGCVLKNCQIGDDVEIKPYSVLEEAIVGQAAQIGPFSRLRPGAALADNTHIGNFVEIKK AHIGTGSKVNHLSYVGDAEVGMQCNIGAGVITCNYDGANKFKTIIGDNVFVGSDVQLVAPVT IETGATIGAGTTVTKDVACDELVISRVPQRHIQGWQRPTKQTKK DNAsequenceofHis.sub.6-BLUSP(Note:ThesequencesforHis.sub.6-tag (SEQIDNO:22)areunderlined) (SEQIDNO:9) ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATAT GACAGAAATAAACGATAAGGCCCAACTGGATATCGCCGCCGCCGGCGACACCGACGCCGTTA CCTCGGACACCCCCGAAGAAACCGTAAACACCCCCGAAGTGGATGAGACTTTCGAGCTTTCG GCCGCCAAGATGCGCGAGCATGGCATGAGCGAAACCGCCATCAACCAGTTCCACCATTTGTA TGACGTATGGCGCCATGAAGAAGCCTCCAGCTGGATTCGTGAGGACGACATCGAGCCGCTTG GCCACGTGCCCAGCTTCCACGACGTCTATGAGACCATCAACCACGACAAGGCCGTGGACGCC TTCGCCAAGACCGCATTCCTCAAGCTCAATGGCGGTCTGGGCACCTCCATGGGATTAGACAA GGCCAAGTCGCTGTTGCCGGTGCGTAGGCACAAGGCCAAGCAGATGCGCTTCATCGACATCA TCATCGGTCAGGTGCTTACCGCTCGCACCCGCCTGAACGTCGAACTGCCGCTGACGTTCATG AACTCCTTCCACACTTCGGCGGACACGATGAAGGTGCTCAAGCATCATCGCAAGTTCAGTCA GCATGACGTGCCGATGGAAATCATCCAGCATCAGGAACCCAAGCTCGTGGCCGCCACCGGCG AACCTGTGAGCTACCCTGCGAACCCGGAGCTGGAATGGTGCCCGCCCGGCCACGGCGACCTG TTCTCCACCATCTGGGAGTCTGGTCTGCTTGACGTATTGGAGGAGCGCGGCTTCAAGTATCT GTTCATCTCCAATTCCGACAATCTCGGTGCGCGCGCCTCGCGTACGTTGGCCCAGCACTTCG AAAACACAGGTGCCCCGTTTATGGCTGAAGTGGCCATCCGCACCAAGGCCGATCGCAAGGGC GGCCATATTGTACGAGACAAGGCCACTGGTCGCCTAATACTGCGTGAAATGAGCCAGGTCCA TCCGGACGATAAGGAAGCGGCCCAAGACATCACCAAGCATCCTTACTTCAACACCAACTCAA TCTGGGTTCGCATCGACGCTTTGAAAGACAAGCTCGCCGAATGCGATGGTGTGTTGCCGTTG CCGGTGATTCGTAACAAAAAGACCGTGAATCCCACGGACCCGGATTCCGAACAGGTGATTCA GCTGGAAACCGCCATGGGCGCCGCAATCGGTCTGTTCAACGGTTCTATCTGCGTCCAAGTGG ATCGTATGCGCTTCCTTCCGGTGAAAACCACCAATGATTTGTTCATTATGCGTTCCGATCGA TTCCACCTGACGGACACGTATGAGATGGAAGACGGCAATTACATCTTCCCGAACGTCGAACT TGATCCGCGATACTACAAGAACATCCACGATTTCGACGAACGGTTCCCCTACGCCGTGCCAT CTTTGGCCGCAGCCAACTCGGTTTCCATTCAGGGCGACTGGACATTCGGACGTGACGTCATG ATGTTCGCCGACGCCAAACTGGAAGATAAAGGCGAGCCAAGCTATGTGCCGAACGGCGAATA CGTTGGTCCGCAAGGCATCGAACCGGACGATTGGGTGTGA ProteinsequenceofHis.sub.6-BLUSP(Note:ThesequencesforHis.sub.6-tag (SEQIDNO:22)areunderlined) (SEQIDNO:10) MGSSHHHHHHSSGLVPRGSHMTEINDKAQLDIAAAGDTDAVTSDTPEETVNTPEVDETFELS AAKMREHGMSETAINQFHHLYDVWRHEEASSWIREDDIEPLGHVPSFHDVYETINHDKAVDA FAKTAFLKLNGGLGTSMGLDKAKSLLPVRRHKAKQMRFIDIIIGQVLTARTRLNVELPLTFM NSFHTSADTMKVLKHHRKFSQHDVPMEIIQHQEPKLVAATGEPVSYPANPELEWCPPGHGDL FSTIWESGLLDVLEERGFKYLFISNSDNLGARASRTLAQHFENTGAPFMAEVAIRTKADRKG GHIVRDKATGRLILREMSQVHPDDKEAAQDITKHPYFNTNSIWVRIDALKDKLAECDGVLPL PVIRNKKTVNPTDPDSEQVIQLETAMGAAIGLFNGSICVQVDRMRFLPVKTTNDLFIMRSDR FHLTDTYEMEDGNYIFPNVELDPRYYKNIHDFDERFPYAVPSLAAANSVSIQGDWTFGRDVM MFADAKLEDKGEPSYVPNGEYVGPQGIEPDDWV DNAsequenceofPmUgd-His.sub.6(Note:ThesequencesforHis.sub.6-tag (SEQIDNO:22)areunderlined) (SEQIDNO:11) ATGAAGAAAATTACAATTGCTGGGGCTGGCTATGTTGGTTTATCCAATGCAGTATTATTAGC TCAACACCACAATGTGATCTTATTAGATATTGATCAAAATAAAGTTGATTTAATTAATAATA AAAAATCGCCCATCACAGATAAAGAAATCGAAGATTTCTTACAAAATAAATCACTGACAATG ATGGCAACAACAGATAAAGAAGTGGCATTAAAAAACGCAGACTTTGTCATCATCGCAACGCC AACAGACTATAATACCGAAACAGGTTATTTTAATACATCCACTGTTGAAGCTGTCATTGAAC AAACCCTTTCAATCAATCCACAAGCAACGATTATTATAAAATCAACGATTCCCGTTGGTTTT ACCGAAAAAATGCGTGAGAAATTTCATACCAAGAACATTATTTTTTCTCCTGAGTTTTTAAG AGAAGGAAAAGCACTTCATGACAATTTGTTTCCAAGCAGAATTATTGTTGGCAGTACTTCTT ATCAAGCAAAAGTATTTGCCGATATGTTGACACAGTGTGCCAGAAAAAAAGATGTAACTGTT TTATTTACACACAATACTGAGGCTGAAGCTGTTAAATTATTTGCAAATACGTATCTCGCAAT GCGAGTTGCCTTTTTTAATGAATTAGATACTTATGCGAGTCTTCACCATTTAAATACAAAAG ACATTATCAATGGTATTTCTACTGATCCTCGCATTGGTACACACTACAATAACCCAAGTTTC GGCTATGGCGGTTATTGTTTACCCAAAGACACTAAACAGTTACTGGCTAACTATGCTGACGT ACCTCAAAATCTCATTGAAGCCATTGTCAAATCTAATGAAACCAGAAAACGTTTCATTACTC ATGATGTATTAAATAAGAAACCTAAAACTGTTGGTATTTATCGTTTAATCATGAAGTCAGGT TCTGATAACTTCAGAGCTTCTGCTATTCTCGATATTATGCCGCATCTCAAAGAAAACGGTGT TGAGATTGTGATTTATGAGCCAACCTTAAATCAACAGGCATTTGAGGACTACCCCGTTATTA ATCAACTCTCTGAATTTATTAATCGCTCTGATGTCATTCTCGCTAATCGTTCTGAGCCAGAT TTAAATCAATGTTCCCATAAAATCTATACAAGAGATATTTTTGGCGGTGATGCTCTCGAGCA CCACCACCACCACCACTGA ProteinsequenceofPmUgd-His.sub.6(Note:Thesequencesfor His.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:12) MKKITIAGAGYVGLSNAVLLAQHHNVILLDIDQNKVDLINNKKSPITDKEIEDFLQNKSLTM MATTDKEVALKNADFVIIATPTDYNTETGYFNTSTVEAVIEQTLSINPQATIIIKSTIPVGF TEKMREKFHTKNIIFSPEFLREGKALHDNLFPSRIIVGSTSYQAKVFADMLTQCARKKDVTV LFTHNTEAEAVKLFANTYLAMRVAFFNELDTYASLHHLNTKDIINGISTDPRIGTHYNNPSF GYGGYCLPKDTKQLLANYADVPQNLIEAIVKSNETRKRFITHDVLNKKPKTVGIYRLIMKSG SDNFRASAILDIMPHLKENGVEIVIYEPTLNQQAFEDYPVINQLSEFINRSDVILANRSEPD LNQCSHKIYTRDIFGGDALEHHHHHH DNAsequenceofMBP-PmHS1-His.sub.6(Note:Italicsectionsofthe sequencesarefrompMAL-c4Xvectorandprimer.Thesequences forHis.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:13) CTCGGGATCGAGGGAAGGATTTCAGAATTCGGATCCATGAGCTTATTTAAACGTGCTACTGA GCTATTTAAGTCAGGAAACTATAAAGATGCACTAACTCTATATGAAAATATAGCTAAAATTT ATGGTTCAGAAAGCCTTGTTAAATATAATATTGATATATGTAAAAAAAATATAACACAATCA AAAAGTAATAAAATAGAAGAAGATAATATTTCTGGAGAAAACAAATTTTCAGTATCAATAAA AGATCTATATAACGAAATAAGCAATAGTGAATTAGGGATTACAAAAGAAAGACTAGGAGCCC CCCCTCTAGTCAGTATTATAATGACTTCTCATAATACAGAAAAATTCATTGAAGCCTCAATT AATTCACTATTATTGCAAACATACAATAACTTAGAAGTTATCGTTGTAGATGATTATAGCAC AGATAAAACATTTCAGATCGCATCCAGAATAGCAAACTCTACAAGTAAAGTAAAAACATTCC GATTAAACTCAAATCTAGGGACATACTTTGCGAAAAATACAGGAATTTTAAAGTCTAAAGGA GATATTATTTTCTTTCAGGATAGCGATGATGTATGTCACCATGAAAGAATCGAAAGATGTGT TAATGCATTATTATCGAATAAAGATAATATAGCTGTTAGATGTGCATATTCTAGAATAAATC TAGAAACACAAAATATAATAAAAGTTAATGATAATAAATACAAATTAGGATTAATAACTTTA GGCGTTTATAGAAAAGTATTTAATGAAATTGGTTTTTTTAACTGCACAACCAAAGCATCGGA TGATGAATTTTATCATAGAATAATTAAATACTATGGTAAAAATAGGATAAATAACTTATTTC TACCACTGTATTATAACACAATGCGTGAAGATTCATTATTTTCTGATATGGTTGAGTGGGTA GATGAAAATAATATAAAGCAAAAAACCTCTGATGCTAGACAAAATTATCTCCATGAATTCCA AAAAATACACAATGAAAGGAAATTAAATGAATTAAAAGAGATTTTTAGCTTTCCTAGAATTC ATGACGCCTTACCTATATCAAAAGAAATGAGTAAGCTCAGCAACCCTAAAATTCCTGTTTAT ATAAATATATGCTCAATACCTTCAAGAATAAAACAACTTCAATACACTATTGGAGTACTAAA AAACCAATGCGATCATTTTCATATTTATCTTGATGGATATCCAGAAGTACCTGATTTTATAA AAAAACTAGGGAATAAAGCGACCGTTATTAATTGTCAAAACAAAAATGAGTCTATTAGAGAT AATGGAAAGTTTATTCTATTAGAAAAACTTATAAAGGAAAATAAAGATGGATATTATATAAC TTGTGATGATGATATCCGGTATCCTGCTGACTACATAAACACTATGATAAAAAAAATTAATA AATACAATGATAAAGCAGCAATTGGATTACATGGTGTTATATTCCCAAGTAGAGTCAACAAG TATTTTTCATCAGACAGAATTGTCTATAATTTTCAAAAACCTTTAGAAAATGATACTGCTGT AAATATATTAGGAACTGGAACTGTTGCCTTTAGAGTATCTATTTTTAATAAATTTTCTCTAT CTGATTTTGAGCATCCTGGCATGGTAGATATCTATTTTTCTATACTATGTAAGAAAAACAAT ATACTCCAAGTTTGTATATCACGACCATCGAATTGGCTAACAGAAGATAACAAAAACACTGA GACCTTATTTCATGAATTCCAAAATAGAGATGAAATACAAAGTAAACTCATTATTTCAAACA ACCCTTGGGGATACTCAAGTATATATCCATTATTAAATAATAATGCTAATTATTCTGAACTT ATTCCGTGTTTATCTTTTTATAACGAGCATCATCATCATCATCACTAA ProteinsequenceofMBP-PmHS1-His.sub.6(Note:Italicsectionsof thesequencesarefrompMAL-c4Xvectorandprimer.The sequencesforHis.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:14) LGIEGRISEFGSMSLFKRATELFKSGNYKDALTLYENIAKIYGSESLVKYNIDICKKNITQS KSNKIEEDNISGENKFSVSIKDLYNEISNSELGITKERLGAPPLVSIIMTSHNTEKFIEASI NSLLLOTYNNLEVIVVDDYSTDKTFQIASRIANSTSKVKTFRLNSNLGTYFAKNTGILKSKG DIIEFODSDDVCHHERIERCVNALLSNKDNIAVRCAYSRINLETQNIIKVNDNKYKLGLITL GVYRKVFNEIGFFNCTTKASDDEFYHRIIKYYGKNRINNLFLPLYYNTMREDSLFSDMVEWV DENNIKQKTSDARQNYLHEFQKIHNERKLNELKEIFSFPRIHDALPISKEMSKLSNPKIPVY INICSIPSRIKQLQYTIGVLKNQCDHFHIYLDGYPEVPDFIKKLGNKATVINCQNKNESIRD NGKFILLEKLIKENKDGYYITCDDDIRYPADYINTMIKKINKYNDKAAIGLHGVIFPSRVNK YESSDRIVYNFOKPLENDTAVNILGTGTVAFRVSIENKESLSDFEHPGMVDIYESILCKKNN ILQVCISRPSNWLTEDNKNTETLFHEFONRDEIQSKLIIaNNPWGYSSIYPLLNNNANYSEL IPCLSFYNEHHHHHH DNAsequenceofHis.sub.6-PmHS2(Note:Italicsectionsofthe sequencesarefrompET15bvectorandprimer.Thesequencesfor His.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:15) ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATAT GAAGGGAAAAAAAGAGATGACTCAAAAACAAATGACTAAAAATCCACCCCAACATGAAAAAG AAAATGAACTCAACACCTTTCAAAATAAAATTGATAGTCTAAAAACAACTTTAAACAAAGAC ATTATTTCTCAACAAACTTTATTGGCAAAACAGGACAGTAAACATCCGCTATCCGAATCCCT TGAAAACGAAAATAAACTTTTATTAAAACAACTCCAATTGGTTCTACAAGAATTTGAAAAAA TATATACCTATAATCAAGCATTAGAAGCAAAGCTAGAAAAAGATAAGCAAACAACATCAATA ACAGATTTATATAATGAAGTCGCTAAAAGTGATTTAGGGTTAGTCAAAGAAACCAACAGCGC AAATCCATTAGTCAGTATTATCATGACATCTCACAATACAGCGCAATTTATCGAAGCTTCTA TTAATTCATTATTGTTACAAACATATAAAAACATAGAAATTATTATTGTAGATGATGATAGC TCGGATAATACATTTGAAATTGCCTCGAGAATAGCGAATACAACAAGCAAAGTCAGAGTATT TAGATTAAATTCAAACCTAGGAACTTACTTTGCGAAAAATACAGGCATATTAAAATCTAAAG GTGACATTATTTTCTTTCAAGATAGTGATGATGTATGTCATCATGAAAGAATAGAAAGATGT GTAAATATATTATTAGCTAATAAAGAAACTATTGCTGTTCGTTGTGCATACTCAAGACTAGC ACCAGAAACACAACATATCATTAAAGTCAATAATATGGATTATAGATTAGGTTTTATAACCT TGGGTATGCACAGAAAAGTATTTCAAGAAATTGGTTTCTTCAATTGTACGACTAAAGGCTCA GATGATGAGTTTTTTCATAGAATTGCGAAATATTATGGAAAAGAAAAAATAAAAAATTTACT CTTGCCGTTATACTACAACACAATGAGAGAAAACTCTTTATTTACTGATATGGTTGAATGGA TAGACAATCATAACATAATACAGAAAATGTCTGATACCAGACAACATTATGCAACCCTGTTT CAAGCGATGCATAACGAAACAGCCTCACATGATTTCAAAAATCTTTTTCAATTCCCTCGTAT TTACGATGCCTTACCAGTACCACAAGAAATGAGTAAGTTGTCCAATCCTAAGATTCCTGTTT ATATCAATATTTGTTCTATTCCCTCAAGAATAGCGCAATTACAACGTATTATCGGCATACTA AAAAATCAATGTGATCATTTTCATATTTATCTTGATGGCTATGTAGAAATCCCTGACTTCAT AAAAAATTTAGGTAATAAAGCAACCGTTGTTCATTGCAAAGATAAAGATAACTCCATTAGAG ATAATGGCAAATTCATTTTACTGGAAGAGTTGATTGAAAAAAATCAAGATGGATATTATATA ACCTGTGATGATGACATTATCTATCCAAGCGATTACATCAATACGATGATCAAAAAGCTGAA TGAATACGATGATAAAGCGGTTATTGGTTTACACGGCATTCTCTTTCCAAGTAGAATGACCA AATATTTTTCGGCGGATAGACTGGTATATAGCTTCTATAAACCTCTGGAAAAAGACAAAGCG GTCAATGTATTAGGTACAGGAACTGTTAGCTTTAGAGTCAGTCTCTTTAATCAATTTTCTCT TTCTGACTTTACCCATTCAGGCATGGCTGATATCTATTTCTCTCTCTTGTGTAAGAAAAATA ATATTCTTCAGATTTGTATTTCAAGACCAGCAAACTGGCTAACGGAAGATAATAGAGACAGC GAAACACTCTATCATCAATATCGAGACAATGATGAGCAACAAACTCAGCTGATCATGGAAAA CGGTCCATGGGGATATTCAAGTATTTATCCATTAGTCAAAAATCATCCTAAATTTACTGACC TTATCCCCTGTTTACCTTTTTATTTTTTATAA ProteinsequenceofHis.sub.6-PmHS2(Note:Italicsectionsofthe sequencesarefrompET15bvectorandprimer.Thesequencesfor His.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:16) MGSSHHHHHHSSGLVPRGSHMKGKKEMTQKQMTKNPPQHEKENELNTFQNKIDSLKTTLNKD IISQQTLLAKQDSKHPLSESLENENKLLLKQLQLVLQEFEKIYTYNQALEAKLEKDKQTTSI TDLYNEVAKSDLGLVKETNSANPLVSIIMTSHNTAQFIEASINSLLLQTYKNIEIIIVDDDS SDNTFEIASRIANTTSKVRVFRLNSNLGTYFAKNTGILKSKGDIIFFQDSDDVCHHERIERC VNILLANKETIAVRCAYSRLAPETQHIIKVNNMDYRLGFITLGMHRKVFOEIGFFNCTTKGS DDEFFHRIAKYYGKEKIKNLLLPLYYNTMRENSLFTDMVEWIDNHNIIQKMSDTRQHYATLF QAMHNETASHDEKNLEQFPRIYDALPVPQEMSKLSNPKIPVYINICSIPSRIAOLQRIIGIL KNQCDHFHIYLDGYVEIPDFIKNLGNKATVVHCKDKDNSIRDNGKFILLEELIEKNQDGYYI TCDDDIIYPSDYINTMIKKLNEYDDKAVIGLHGILFPSRMTKYFSADRLVYSFYKPLEKDKA VNVLGTGTVSFRVSLFNQFSLSDFTHSGMADIYFSLLCKKNNILQICISRPANWLTEDNRDS ETLYHQYRDNDEQQTQLIMENGPWGYSSIYPLVKNHPKFTDLIPCLPFYFL DNAsequenceofMBP-KfiA-His.sub.6(Note:Italicsectionsofthe sequencesarefrompMAL-c4Xvectorandprimer.Thesequences forHis.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:17) AACCTCGGGATCGAGGGAAGGATTTCAGAATTCATGATTGTTGCAAATATGAGCAGCTATCC TCCGCGTAAAAAAGAACTGGTTCATAGCATTCAGAGCCTGCATGCACAGGTGGATAAAATTA ATCTGTGCCTGAATGAATTTGAAGAAATTCCGGAAGAACTGGATGGCTTTAGCAAACTGAAT CCGGTTATTCCGGATAAAGATTATAAAGATGTGGGCAAATTTATTTTTCCGTGCGCCAAAAA TGATATGATTGTTCTGACCGATGATGATATTATTTATCCGCCAGATTATGTGGAAAAAATGC TGAATTTTTATAATAGCTTTGCCATTTTTAATTGCATTGTGGGTATTCATGGCTGCATTTAT ATTGATGCCTTTGATGGTGATCAGAGCAAACGTAAAGTGTTTAGCTTTACCCAGGGTCTGCT GCGTCCGCGTGTTGTTAATCAGCTGGGCACCGGCACCGTTTTTCTGAAAGCAGATCAGCTGC CGAGCCTGAAATATATGGATGGTAGCCAGCGTTTTGTGGATGTTCGTTTTAGCCGTTATATG CTGGAAAATGAAATTGGCATGATTTGTGTTCCGCGTGAAAAAAATTGGCTGCGTGAAGTTAG CAGCGGTAGCATGGAAGGTCTGTGGAATACCTTTACCAAAAAATGGCCTCTGGATATCATTA AAGAAACCCAGGCAATTGCCGGTTATAGTAAACTGAATCTGGAACTGGTGTATAATGTGGAA GGTCACCACCACCACCACCACTAA ProteinsequenceofMBP-KfiA-His.sub.6(Note:Italicsectionsof thesequencesarefrompMAL-c4Xvectorandprimer.The sequencesforHis.sub.6-tag(SEQIDNO:22)areunderlined) (SEQIDNO:18) NLGIEGRISEFMIVANMSSYPPRKKELVHSIQSLHAQVDKINLCLNEFEEIPEELDGFSKLN PVIPDKDYKDVGKFIFPCAKNDMIVLTDDDIIYPPDYVEKMLNFYNSFAIFNCIVGIHGCIY IDAFDGDQSKRKVFSFTQGLLRPRVVNQLGTGTVFLKADQLPSLKYMDGSQRFVDVRFSRYM LENEIGMICVPREKNWLREVSSGSMEGLWNTFTKKWPLDIIKETQAIAGYSKLNLELVYNVE GHHHHHH
(437) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications can be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.