METHOD FOR EFFICIENTLY PRODUCING ß MYOSIN HEAVY CHAIN IN CARDIAC MUSCLE CELLS DIFFERENTIATED FROM INDUCED PLURIPOTENT STEM CELLS DERIVED FROM HOMO SAPIENS
20180251504 · 2018-09-06
Inventors
Cpc classification
C12N5/0606
CHEMISTRY; METALLURGY
C12M35/02
CHEMISTRY; METALLURGY
B01J2219/00853
PERFORMING OPERATIONS; TRANSPORTING
B01J19/0046
PERFORMING OPERATIONS; TRANSPORTING
C12M21/08
CHEMISTRY; METALLURGY
B01J2219/0093
PERFORMING OPERATIONS; TRANSPORTING
C12N13/00
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
International classification
C12N13/00
CHEMISTRY; METALLURGY
C12M1/42
CHEMISTRY; METALLURGY
Abstract
The present invention provides a method for producing a myosin heavy chain in cardiac muscle cells differentiated from induced pluripotent stem cells derived from Homo sapiens. In the present method, first, a liquid culture medium containing the cardiac muscle cells is supplied onto a substrate comprising a first electrode, a second electrode and insulative fibers on the surface thereof. At least a part of the insulative fibers is located between the first electrode and the second electrode in a top view of the substrate. Then, the substrate is left at rest. Finally, the cardiac muscle cells are cultivated, while a pulse electric current is applied to the cardiac muscle cells through the first electrode and the second electrode.
Claims
1. A method for producing a myosin heavy chain in cardiac muscle cells differentiated from induced pluripotent stem cells derived from Homo sapiens, the method comprising: (a) supplying a liquid culture medium containing the cardiac muscle cells onto a substrate comprising a first electrode, a second electrode and insulative fibers on the surface thereof to coat a surface of the first electrode, a surface of the second electrode, and a region between the first electrode and the second electrode with the cardiac muscle cells; wherein at least apart of the insulative fibers is located between the first electrode and the second electrode in a top view of the substrate; and an angle formed between each of not less than 90% of the insulative fibers and an imaginary straight line which passes through both the first electrode and the second electrode is not more than 20 degrees in the top view; (b) leaving the substrate at rest; and (c) cultivating the cardiac muscle cells, while a pulse electric current is applied to the cardiac muscle cells through the first electrode and the second electrode.
2. The method according to claim 1, wherein in the step (b), the substrate is left at rest until the cardiac muscle cells adhere on the surface of the substrate or the insulative fibers.
3. The method according to claim 1, wherein a reference electrode is in contact with the liquid culture medium.
4. The method according to claim 3, wherein the reference electrode is grounded.
5. The method according to claim 3, wherein the substrate comprises the reference electrode on the surface thereof.
6. The method according to claim 3, wherein the liquid culture medium includes the reference electrode.
7. A substrate comprising: a first electrode; a second electrode; and insulative fibers, wherein the first electrode, the second electrode, and the insulative fibers are provided on a surface of the substrate; at least apart of the insulative fibers is located between the first electrode and the second electrode in a top view of the substrate; and an angle formed between each of not less than 90% of the insulative fibers and an imaginary straight line which passes through both the first electrode and the second electrode is not more than 20 degrees in the top view.
8. The substrate according to claim 7, further comprising a reference electrode on the surface thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
DETAILED DESCRIPTION OF THE EMBODIMENT
[0042] Hereinafter, an embodiment of the present invention will be described with reference to the drawings.
[0043] As disclosed in
[0044] The MHC has a primary structure consisting of the amino acid sequence represented by the following SEQ ID NO: 1. [0045] MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVT VKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVA AYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQS PGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAE RDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMY KLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFN HHMFVLEQEEYKKEGIEWTFIDEGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKS ANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANYAGADAP IEKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLE GIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLL GLLEEMRDERLSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLL KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIK NKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTE EMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLER AKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEE ELESERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAA ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALA HALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEA EEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESS QKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMEL QSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNE ALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRN AEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVR ELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQAN TNLSKFRKVQHELDEAEERADIAESQVNKLRAKSRDIGTKGLNEE (SEQ ID NO: 1)
[0046] For reference, myosin regulatory light chain 2 (hereinafter, referred to as MYL2) is also produced in the cardiac muscle cells. The MYL2 has a primary structure consisting of the amino acid sequences represented by the following SEQ ID NO: 2.
[0047] MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKN EEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKE EVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD (SEQ ID NO: 2)
[0048] Hereinafter, the cardiac muscle cells differentiated from induced pluripotent stem cells derived from Homo sapiens are just referred to as cardiac muscle cells. As well known, the induced pluripotent stem cells may be referred to as iPS cells.
[0049] (Step (a))
[0050] First, a liquid culture medium containing cardiac muscle cells are supplied on a substrate 100 comprising a first electrode, a second electrode, and insulative fibers on the surface thereof.
[0051]
[0052] As shown in
[0053] As shown in
[0054] As shown in
[0055] As shown in
[0056] The insulative fibers 50 are exposed on the surface of the substrate 100. The first electrode 31 and the second electrode 32 are also exposed on the surface of substrate 100.
[0057] The insulative fibers 50 have orientation such that an angle formed between each of not less than 90% of the insulative fibers 50 and an imaginary straight line which passes through both the first electrode 31 and the second electrode 32 is not more than 20 degrees in the top view of substrate 100. In other words, each of the not less than 90% of the insulative fibers 50 forms an angle of not more than 20 degrees with regard to the imaginary straight line. Therefore, not less than 90% of the insulative fibers 50 are substantially parallel to a direction of an electric field generated when an electric current (e.g., pulse electric current) is caused to flow between the first electrode 31 and the second electrode 32. Needless to say, the imaginary straight line does not exist actually on the substrate 100. Desirably, the angle is not more than 5 degrees. See the paragraph 0023 of U.S. patent application Ser. No. 15/519,341, which is incorporated herein by reference.
[0058] In case where less than 90% of the insulative fibers 50 are substantially parallel to the imaginary straight line which passes through both the first electrode 31 and the second electrode 32, the MHC is not produced efficiently. See the comparative examples 3-6 which will be described later. In the comparative examples 2-3, almost all of the insulative fibers 50 are substantially perpendicular to the imaginary straight line which passes through both the first electrode 31 and the second electrode 32. In other words, in the comparative examples 2-3, each of the almost all of the insulative fibers 50 forms an angle of approximately 90 degrees with regard to the imaginary straight line. In the comparative examples 4-5, a roughly half of the insulative fibers 50 are perpendicular to the imaginary straight line which passes through both the first electrode 31 and the second electrode 32, and the other roughly half of the insulative fibers 50 are parallel to the imaginary straight line.
[0059] Desirably, each of the insulative fibers 50 has a diameter of not less than 1 micrometer and not more than 5 micrometers. It is desirable that the material of the insulative fibers 50 is selected from the group consisting of polystyrene, polycarbonate, polymethylmethacrylate, polyvinyl chloride, polyethylene terephthalate, polyamide, polymethylglutarimide, or polylactic acid. It is desirable that the distance between the first electrode 31 and the second electrode 32 is not less than 150 micrometers and not more than 5,000 micrometers.
[0060] One example of a fabrication method of the substrate 100 will be described in more detail in the examples which will be described later. A skilled person who has read the examples which will be described later would understand easily the fabrication method of the substrate 100.
[0061] As shown in
[0062] (Step (b))
[0063] The Step (b) is conducted out after the step (a). In the Step (b), the substrate 100 is left at rest. In this way, the cardiac muscle cells adhere on the insulative fibers 50 or the surface of substrate 100. Desirably, the substrate 100 is left at rest over 24 hours.
[0064] (Step (c))
[0065] The Step (c) is conducted after the step (b). In the step (c), while a pulse electric current is applied to the cardiac muscle cells 180 through the first electrode 31 and the second electrode 32, the cardiac muscle cells 180 are cultivated. The same pulse electric current may be applied to the first electrode 31 and the second electrode 32. When the pulse electric current is applied to the first electrode 31 and the second electrode 32, a reference electrode 4 may be used. The reference electrode 4 is grounded. As shown in
[0066]
[0067] One pulse has a time length of 0.05 milliseconds to 4 milliseconds (0.4 milliseconds in
[0068] As demonstrated in the inventive example 1, the thus-cultivated cardiac muscle cells 180 contain a lot of MHC. In other words, the MHC is produced efficiently in the thus-cultivated cardiac muscle cells 180. In case where the pulse electric current fails to be applied, the MHC fails to be produced efficiently. See the comparative examples 1, 3, 5, and 7 which will be described later.
EXAMPLES
[0069] Hereinafter, the present invention will be described in more detail with reference to the following examples.
[0070] (Fabrication of Substrate 100)
[0071] The substrate 100 shown in
[0072] Then, the surface of the glass base 1 was coated with an insulation film 40 consisting of a photosensitive acrylic acid resin. The electric contacts 2 were not coated with the insulation film 40. Each one end of the electric wirings 3 was not coated with the insulation film 40, since the one end of the electric wiring 3 was used as the first electrode 31, the second electrode 32, or the reference electrode 4. Subsequently, the glass base 1 was subjected to plasma surface treatment at an RF power of 18 W for two minutes with a plasma treatment apparatus (available from Harrick Plasma Company, trade name: PDC-32G).
[0073]
[0074] The end of the electric wiring 3 exposed on the surface (i.e., the first electrode 31 and the second electrode 32) had a size of approximately 15 micrometersapproximately 170 micrometers. The reference electrode 4 had an area of approximately 200 square micrometers. The distance between the ends of adjacent two electric wirings 3 was approximately 400 micrometers. The distance of adjacent two electrode sets 6 was approximately 4 millimeters.
[0075] Meanwhile, insulative fibers made of polymethyl glutaric imide were formed on the surface of an aluminum tape (available from Hitachi Maxell. Ltd., trade name: SLIONTEC) by an electrospinning method in accordance with the process disclosed in the paragraph 0122 of U.S. patent application Ser. No. 15/519,341. Unlike the process disclosed in the paragraph 0122 of U.S. patent application Ser. No. 15/519,341, an ejection time of polymethyl glutaric imide in the electrospinning method was 30 minutes in the inventive example 1. The insulative fibers had a surface coverage of 30%.
[0076] Then, the aluminum tape having the insulative fibers was disposed on the surface of the glass base 1 so that the insulative fibers were sandwiched between the aluminum tape and the electric wiring 3. The aluminum tape having the insulative fibers was impressed onto the surface of the insulation film 40 and the exposed ends of the electric wirings 3. Then, the aluminum tape was removed.
[0077] Then, as shown in
[0078] The exposed ends of the electric wirings 3 were plated with platinum black 5. Specifically, the parts were plated at a current density of 20 mA/cm.sup.2 for two minutes using a plating solution. During the plating, the electric wirings 3 were used as cathodes. The plating solution had the composition shown in Table 1. The first electrode 31 or the second electrode 32 was formed through such plating on the surface of the end of the electric wiring 3. In other words, the first electrode 31 and the second electrode 32 were formed of platinum black.
TABLE-US-00001 TABLE 1 Composition Chemical formula Concentration Hexachloroplatinic (IV) H.sub.2PtCl.sub.66H.sub.2O 1% acid Lead acetate (CH.sub.3COO).sub.2Pb3H.sub.2O 0.01% Hydrochloric acid HCl 0.0025%
[0079] In this way, the substrate 100 was provided.
[0080] (Cultivation of Cardiac Muscle Cells)
[0081] Using the substrate 100, cardiac muscle cells differentiated by induced pluripotent stem cells derived from Homo sapiens were cultivated. And then, production ratio of the MHC was measured. Specifically, cardiac muscle cells differentiated by induced pluripotent stem cells derived from Homo sapiens (available from iPS Academia Japan, Inc., trade name: iCell Cardiomycytes) were used. Pursuant to the protocol described in the manual attached to iCell Cardiomycytes, a liquid culture medium containing cardiac muscle cells differentiated by induced pluripotent stem cells derived from Homo sapiens was prepared.
[0082] Then, as shown in
[0083] Two days after the supply of the liquid culture medium 182, the pulse electric current shown in
[0084] The pulse electric current was applied to the cardiac muscle cells 180 for 12 days, except in time of a change of a culture medium. In this way, the cardiac muscle cells 180 were cultivated.
[0085] (Measurement of Production Ratio of MHC)
[0086] The production ratio of the MHC contained in the thus-cultivated cardiac muscle cells 180 was measured as below.
[0087] The cardiac muscle cells were fixed with 4% paraformaldehyde and were permeabilized in phosphate buffered saline (PBS) plus 0.5% Triton X-100 for 0.5 hours. After blocking in a 5% normal donkey serum, 3% BSA, and 0.1% Tween 20 in PBS for 16 hours at 4 degrees Celsius, the cells were incubated for 16 hours at 4 degrees Celsius with mouse MYH7 monoclonal IgM primary antibodies (available from Santa Cruz Biotechnology, trade name: SC-53089) diluted at 1:100 with a blocking buffer. In this way, the primary antibodies were bound to the cardiac muscle cells. The antigen capable of binding to the primary antibody was MHC (GenBank: AAA51837.1).
[0088] Then, the cardiac muscle cells to which the primary antibodies were bound were washed with PBS. Subsequently, the cardiac muscle cells were incubated for 1 hour at 25 degrees Celsius with fluorescently-labelled anti-mouse IgM secondary antibodies (available from Jackson Immunoresearch labs., trade name: DyLight-594-Donkey anti-mouse IgM) diluted at 1:1,000 with the blocking buffer. In this way, the fluorescently-labelled secondary antibodies were bound to the primary antibodies. In this way, the cardiac muscle cells were fluorescently labelled.
[0089] The fluorescently-labelled cardiac muscle cells were observed using a fluorescent microscope.
[0090] Hereinafter, the MHC production ratio is defined as a rate of the sum of the areas of the regions each having a digital brightness level of not less than 65 to the area of the whole of the observation region. In other words, the MHC production ratio is calculated according to the following mathematical formula.
( MHC Production Ratio)=(Sum of Areas of the regions each having a digital brightness level of not less than 65)/(Area of the whole of the observation region)
[0091] In the inventive example 1, the MHC production ratio was 57.9%.
[0092] For reference, production ratio of myosin regulatory light chain 2 (hereinafter, referred to as MYL2) contained in the cultivated cardiac muscle cells was measured similarly. In particular, the MYL2 production ratio was calculated similarly to the case of the MHC production ratio, except for the following two matters.
[0093] (I) In place of the mouse MYH7 monoclonal IgM antibodies, rabbit MYL2 polyclonal IgG antibodies (dilution ratio: 1/200, available from Proteintech Company, trade name: 109060-1-AP) was used as the primary antibodies.
[0094] (II) In place of the anti-mouse IgM fluorescently-labelled secondary antibodies, anti rabbit IgG fluorescently-labelled antibodies (available from Jackson Immunoresearch labs., trade name: Alexa Fluor 488 Donkey anti-rabbit IgG) was used as the secondary antibodies.
[0095] As a result, the MYL2 production ratio was 36.7% in the inventive example 1.
Comparative Example 1
[0096] An experiment similar to the inventive example 1 was conducted, except that no pulse electric current was applied.
Comparative Example 2
[0097] An experiment similar to the inventive example 1 was conducted, except that almost all of the insulative fibers 50 were disposed substantially perpendicularly (namely, in a vertical direction in
Comparative Example 3
[0098] An experiment similar to the inventive example 1 was conducted, except that almost all of the insulative fibers 50 were disposed substantially perpendicularly (namely, in a vertical direction in
Comparative Example 4
[0099] An experiment similar to the inventive example 1 was conducted, except that roughly half of the insulative fibers 50 were disposed parallel (namely, in the horizontal direction in
Comparative example 5
[0100] An experiment similar to the inventive example 1 was conducted, except that some of the insulative fibers 50 were disposed parallel (namely, in the horizontal direction in
Comparative Example 6
[0101] An experiment similar to the inventive example 1 was conducted, except that no insulative fibers 50 were disposed, as shown in
Comparative Example 7
[0102] An experiment similar to the inventive example 1 was conducted, except that no insulative fibers 50 were disposed, as shown in
[0103] The following Table 2 shows the 13 WIC production rate measured in the inventive example 1 and the comparative examples 1-7.
TABLE-US-00002 TABLE 2 Relation Between Direction of Insulative fibers and Direction of Pulse electric MHC production Electric Field current rate (%) I.E. 1 FIG. 13A or FIG. 13B Applied 57.9 C.E. 1 FIG. 13A or FIG. 13B No 14.5 C.E. 2 FIG. 13C Applied 31.9 C.E. 3 FIG. 13C No 10.3 C.E. 4 FIG. 13D Applied 36.5 C.E. 5 FIG. 13D No 15.8 C.E. 6 No insulative fibers Applied 15.4 C.E. 7 No insulative fibers No 9.8 I.E. means Inventive Example. C.E. means Comparative Example. Electric Field means the electric field generated between the first electrode 31 and the second electrode 32 by the electric current pulse.
[0104] The following Table 3 shows the MYL2 production rate measured in the inventive example 1 and the comparative examples 1-7.
TABLE-US-00003 TABLE 3 Relation Between Direction of Insulative fibers and Direction of Pulse electric MYL2 production Electric Field current rate (%) I.E. 1 FIG. 13A or FIG. 13B Applied 36.7 C.E. 1 FIG. 13A or FIG. 13B No 25.1 C.E. 2 FIG. 13C Applied 30.0 C.E. 3 FIG. 13C No 19.0 C.E. 4 FIG. 13D Applied 32.5 C.E. 5 FIG. 13D No 24.0 C.E. 6 No insulative fibers Applied 16.2 C.E. 7 No insulative fibers No 10.1
[0105] As is clear from Table 2, when both of the following requirements (I) and (II) are satisfied, the MHC production rate is a significantly high value of 57.9%. See the inventive example 1.
[0106] Requirement (I): The insulative fibers 50 have orientation such that an angle formed between each of not less than 90% of the insulative fibers 50 and an imaginary straight line which passes through both the first electrode 31 and the second electrode 32 is not more than 20 degrees in the top view.
[0107] Requirement (II): The cardiac muscle cells 180 are cultivated, while the pulse electric current is applied thereto.
[0108] On the other hand, in case where at least one of the requirements (I) and (II) fails to be satisfied, the MHC production rate is a low value of less than 36.5%. See the comparative examples 1-7.
[0109] As is clear from Table 3, regardless to the direction of the insulative fibers, the MYL2 production rate is a constant value of approximately 32%-37%. On the other hand, as is clear from Table 1, the MHC production rate is significantly increased, when both of the requirements (I) and (II) are satisfied. In other words, the use of the insulative fibers increases the production amount of polypeptide (including protein) in the cardiac muscle cells. Among the polypeptide produced in the cardiac muscle cells, when both of the requirements (I) and (II) are satisfied, the MHC is produced at the significantly high production rate, unlike other polypeptide such as MYL2.
INDUSTRIAL APPLICABILITY
[0110] The present invention provides a method for efficiently producing myosin heavy chain in cardiac muscle cells differentiated from induced pluripotent stem cells derived from Homo sapiens.
REFERENTIAL SIGNS LIST
[0111] 100 Substrate [0112] 1 Glass plate [0113] 2 Electric contact [0114] 3 Electric wiring [0115] 4 Reference electrode [0116] 5 Platinum black [0117] 6 Electrode set [0118] 10 Enclosure [0119] 31 First electrode [0120] 32 Second electrode [0121] 40 Insulation film [0122] 50 Insulative fiber [0123] 60 Insulative sheet [0124] A Region [0125] B Region [0126] C Region [0127] 180 Cardiac muscle cells [0128] 182 Liquid culture medium [0129] 200 Pulse electric current generator
TABLE-US-00004 SEQUENCELISTING <110> PanasonicCorporation <120> METHODFOREFFICIENTLYPRODUCINGBETAMYOSINHEAVYCHAININ CARDIACMUSCLECELLSDIFFERENTIATEDFROMINDUCEDPLURIPOTENTSTEM CELLSDERIVEDFROMHOMOSAPIENS <130> P1006798US01 <160> 2 <170> PatentInversion3.5 <210> 1 <211> 1935 <212> PRT <213> Homosapiens <400> 1 MetGlyAspSerGluMetAlaValPheGlyAlaAlaAlaProTyrLeu 151015 ArgLysSerGluLysGluArgLeuGluAlaGlnThrArgProPheAsp 202530 LeuLysLysAspValPheValProAspAspLysGlnGluPheValLys 354045 AlaLysIleValSerArgGluGlyGlyLysValThrAlaGluThrGlu 505560 TyrGlyLysThrValThrValLysGluAspGlnValMetGlnGlnAsn 65707580 ProProLysPheAspLysIleGluAspMetAlaMetLeuThrPheLeu 859095 HisGluProAlaValLeuTyrAsnLeuLysAspArgTyrGlySerTrp 100105110 MetIleTyrThrTyrSerGlyLeuPheCysValThrValAsnProTyr 115120125 LysTrpLeuProValTyrThrProGluValValAlaAlaTyrArgGly 130135140 LysLysArgSerGluAlaProProHisIlePheSerIleSerAspAsn 145150155160 AlaTyrGlnTyrMetLeuThrAspArgGluAsnGlnSerIleLeuIle 165170175 ThrGlyGluSerGlyAlaGlyLysThrValAsnThrLysArgValIle 180185190 GlnTyrPheAlaValIleAlaAlaIleGlyAspArgSerLysLysAsp 195200205 GlnSerProGlyLysGlyThrLeuGluAspGlnIleIleGlnAlaAsn 210215220 ProAlaLeuGluAlaPheGlyAsnAlaLysThrValArgAsnAspAsn 225230235240 SerSerArgPheGlyLysPheIleArgIleHisPheGlyAlaThrGly 245250255 LysLeuAlaSerAlaAspIleGluThrTyrLeuLeuGluLysSerArg 260265270 ValIlePheGlnLeuLysAlaGluArgAspTyrHisHePheTyrGln 275280285 IleLeuSerAsnLysLysProGluLeuLeuAspMetLeuLeuIleThr 290295300 AsnAsnProTyrAspTyrAlaPheIleSerGlnGlyGluThrThrVal 305310315320 AlaSerIleAspAspAlaGluGluLeuMetAlaThrAspAsnAlaPhe 325330335 AspValLeuGlyPheThrSerGluGluLysAsnSerMetTyrLysLeu 340345350 ThrGlyAlaIleMetHisPheGlyAsnMetLysPheLysLeuLysGln 355360365 ArgGluGluGlnAlaGluProAspGlyThrGluGluAlaAspLysSer 370375380 AlaTyrLeuMetGlyLeuAsnSerAlaAspLeuLeuLysGlyLeuCys 385390395400 HisProArgValLysValGlyAsnGluTyrValThrLysGlyGlnAsn 405410415 ValGlnGlnValIleTyrAlaThrGlyAlaLeuAlaLysAlaValTyr 420425430 GluArgMetPheAsnTrpMetValThrArgIleAsnAlaThrLeuGlu 435440445 ThrLysGlnProArgGlnTyrPheIleGlyValLeuAspIleAlaGly 450455460 PheGluIlePheAspPheAsnSerPheGluGlnLeuCysIleAsnPhe 465470475480 ThrAsnGluLysLeuGlnGlnPhePheAsnHisHisMetPheValLeu 485490495 GluGlnGluGluTyrLysLysGluGlyHeGluTrpThrPheIleAsp 500505510 PheGlyMetAspLeuGlnAlaCysIleAspLeuIleGluLysProMet 515520525 GlyIleMetSerIleLeuGluGluGluCysMetPheProLysAlaThr 530535540 AspMetThrPheLysAlaLysLeuPheAspAsnHisLeuGlyLysSer 545550555560 AlaAsnPheGlnLysProArgAsnIleLysGlyLysProGluAlaHis 565570575 PheSerLeuIleHisTyrAlaGlyIleValAspTyrAsnIleIleGly 580585590 TrpLeuGlnLysAsnLysAspProLeuAsnGluThrValValGlyLeu 595600605 TyrGlnLysSerSerLeuLysLeuLeuSerThrLeuPheAlaAsnTyr 610615620 AlaGlyAlaAspAlaProIleGluLysGlyLysGlyLysAlaLysLys 625630635640 GlySerSerPheGlnThrValSerAlaLeuHisArgGluAsnLeuAsn 645650655 LysLeuMetThrAsnLeuArgSerThrHisProHisPheValArgCys 660665670 IleIleProAsnGluThrLysSerProGlyValMetAspAsnProLeu 675680685 ValMetHisGlnLeuArgCysAsnGlyValLeuGluGlyIleArgIle 690695700 CysArgLysGlyPheProAsnArgIleLeuTyrGlyAspPheArgGln 705710715720 ArgTyrArgIleLeuAsnProAlaAlaIleProGluGlyGlnPheIle 725730735 AspSerArgLysGlyAlaGluLysLeuLeuSerSerLeuAspIleAsp 740745750 HisAsnGlnTyrLysPheGlyHisThrLysValPhePheLysAlaGly 755760765 LeuLeuGlyLeuLeuGluGluMetArgAspGluArgLeuSerArgIle 770775780 IleThrArgIleGlnAlaGlnSerArgGlyValLeuAlaArgMetGlu 785790795800 TyrLysLysLeuLeuGluArgArgAspSerLeuLeuValIleGlnTrp 805810815 AsnIleArgAlaPheMetGlyValLysAsnTrpProTrpMetLysLeu 820825830 TyrPheLysIleLysProLeuLeuLysSerAlaGluArgGluLysGlu 835840845 MetAlaSerMetLysGluGluPheThrArgLeuLysGluAlaLeuGlu 850855860 LysSerGluAlaArgArgLysGluLeuGluGluLysMetValSerLeu 865870875880 LeuGlnGluLysAsnAspLeuGlnLeuGlnValGlnAlaGluGlnAsp 885890895 AsnLeuAlaAspAlaGluGluArgCysAspGlnLeuIleLysAsnLys 900905910 IleGlnLeuGluAlaLysValLysGluMetAsnGluArgLeuGluAsp 915920925 GluGluGluMetAsnAlaGluLeuThrAlaLysLysArgLysLeuGlu 930935940 AspGluCysSerGluLeuLysArgAspIleAspAspLeuGluLeuThr 945950955960 LeuAlaLysValGluLysGluLysHisAlaThrGluAsnLysValLys 965970975 AsnLeuThrGluGluMetAlaGlyLeuAspGluIleIleAlaLysLeu 980985990 ThrLysGluLysLysAlaLeuGlnGluAlaHisGlnGlnAlaLeuAsp 99510001005 AspLeuGlnAlaGluGluAspLysValAsnThrLeuThrLysAla 101010151020 LysValLysLeuGluGlnGlnValAspAspLeuGluGlySerLeu 102510301035 GluGlnGluLysLysValArgMetAspLeuGluArgAlaLysArg 104010451050 LysLeuGluGlyAspLeuLysLeuThrGlnGluSerHeMetAsp 105510601065 LeuGluAsnAspLysGlnGlnLeuAspGluArgLeuLysLysLys 107010751080 AspPheGluLeuAsnAlaLeuAsnAlaArgIleGluAspGluGln 108510901095 AlaLeuGlySerGlnLeuGlnLysLysLeuLysGluLeuGlnAla 110011051110 ArgIleGluGluLeuGluGluGluLeuGluSerGluArgThrAla 111511201125 ArgAlaLysValGluLysLeuArgSerAspLeuSerArgGluLeu 113011351140 GluGluIleSerGluArgLeuGluGluAlaGlyGlyAlaThrSer 114511501155 ValGlnIleGluMetAsnLysLysArgGluAlaGluPheGlnLys 116011651170 MetArgArgAspLeuGluGluAlaThrLeuGlnHisGluAlaThr 117511801185 AlaAlaAlaLeuArgLysLysHisAlaAspSerValAlaGluLeu 119011951200 GlyGluGlnIleAspAsnLeuGlnArgValLysGlnLysLeuGlu 120512101215 LysGluLysSerGluPheLysLeuGluLeuAspAspValThrSer 122012251230 AsnMetGluGlnIleIleLysAlaLysAlaAsnLeuGluLysMet 123512401245 CysArgThrLeuGluAspGlnMetAsnGluHisArgSerLysAla 125012551260 GluGluThrGlnArgSerValAsnAspLeuThrSerGlnArgAla 126512701275 LysLeuGlnThrGluAsnGlyGluLeuSerArgGlnLeuAspGlu 128012851290 LysGluAlaLeuIleSerGlnLeuThrArgGlyLysLeuThrTyr 129513001305 ThrGlnGlnLeuGluAspLeuLysArgGlnLeuGluGluGluVal 131013151320 LysAlaLysAsnAlaLeuAlaHisAlaLeuGlnSerAlaArgHis 132513301335 AspCysAspLeuLeuArgGluGlnTyrGluGluGluThrGluAla 134013451350 LysAlaGluLeuGlnArgValLeuSerLysAlaAsnSerGluVal 135513601365 AlaGlnTrpArgThrLysTyrGluThrAspAlaIleGlnArgThr 137013751380 GluGluLeuGluGluAlaLysLysLysLeuAlaGlnArgLeuGln 138513901395 GluAlaGluGluAlaValGluAlaValAsnAlaLysCysSerSer 140014051410 LeuGluLysThrLysHisArgLeuGlnAsnGluIleGluAspLeu 141514201425 MetValAspValGluArgSerAsnAlaAlaAlaAlaAlaLeuAsp 143014351440 LysLysGlnArgAsnPheAspLysIleLeuAlaGluTrpLysGln 144514501455 LysTyrGluGluSerGlnSerGluLeuGluSerSerGlnLysGlu 146014651470 AlaArgSerLeuSerThrGluLeuPheLysLeuLysAsnAlaTyr 147514801485 GluGluSerLeuGluHisLeuGluThrPheLysArgGluAsnLys 149014951500 AsnLeuGlnGluGluIleSerAspLeuThrGluGlnLeuGlySer 150515101515 SerGlyLysThrIleHisGluLeuGluLysValArgLysGlnLeu 152015251530 GluAlaGluLysMetGluLeuGlnSerAlaLeuGluGluAlaGlu 153515401545 AlaSerLeuGluHisGluGluGlyLysIleLeuArgAlaGlnLeu 155015551560 GluPheAsnGlnIleLysAlaGluIleGluArgLysLeuAlaGlu 156515701575 LysAspGluGluMetGluGlnAlaLysArgAsnHisLeuArgVal 158015851590 ValAspSerLeuGlnThrSerLeuAspAlaGluThrArgSerArg 159516001605 AsnGluAlaLeuArgValLysLysLysMetGluGlyAspLeuAsn 161016151620 GluMetGluIleGlnLeuSerHisAlaAsnArgMetAlaAlaGlu 162516301635 AlaGlnLysGlnValLysSerLeuGlnSerLeuLeuLysAspThr 164016451650 GlnIleGlnLeuAspAspAlaValArgAlaAsnAspAspLeuLys 165516601665 GluAsnIleAlaIleValGluArgArgAsnAsnLeuLeuGlnAla 167016751680 GluLeuGluGluLeuArgAlaValValGluGlnThrGluArgSer 168516901695 ArgLysLeuAlaGluGlnGluLeuIleGluThrSerGluArgVal 170017051710 GlnLeuLeuHisSerGlnAsnThrSerLeuIleAsnGlnLysLys 171517201725 LysMetAspAlaAspLeuSerGlnLeuGlnThrGluValGluGlu 173017351740 AlaValGlnGluCysArgAsnAlaGluGluLysAlaLysLysAla 174517501755 IleThrAspAlaAlaMetMetAlaGluGluLeuLysLysGluGln 176017651770 AspThrSerAlaHisLeuGluArgMetLysLysAsnMetGluGln 177517801785 ThrIleLysAspLeuGlnHisArgLeuAspGluAlaGluGlnIle 179017951800 AlaLeuLysGlyGlyLysLysGlnLeuGlnLysLeuGluAlaArg 180518101815 ValArgGluLeuGluAsnGluLeuGluAlaGluGlnLysArgAsn 182018251830 AlaGluSerValLysGlyMetArgLysSerGluArgArgIleLys 183518401845 GluLeuThrTyrGlnThrGluGluAspArgLysAsnLeuLeuArg 185018551860 LeuGlnAspLeuValAspLysLeuGlnLeuLysValLysAlaTyr 186518701875 LysArgGlnAlaGluGluAlaGluGluGlnAlaAsnThrAsnLeu 188018851890 SerLysPheArgLysValGlnHisGluLeuAspGluAlaGluGlu 189519001905 ArgAlaAspIleAlaGluSerGlnValAsnLysLeuArgAlaLys 191019151920 SerArgAspIleGlyThrLysGlyLeuAsnGluGlu 192519301935 <210> 2 <211> 166 <212> PRT <213> Homosapiens <400> 2 MetAlaProLysLysAlaLysLysArgAlaGlyGlyAlaAsnSerAsn 151015 ValPheSerMetPheGluGlnThrGlnIleGlnGluPheLysGluAla 202530 PheThrIleMetAspGlnAsnArgAspGlyPheHeAspLysAsnAsp 354045 LeuArgAspThrPheAlaAlaLeuGlyArgValAsnValLysAsnGlu 505560 GluIleAspGluMetIleLysGluAlaProGlyProIleAsnPheThr 65707580 ValPheLeuThrMetPheGlyGluLysLeuLysGlyAlaAspProGlu 859095 GluThrIleLeuAsnAlaPheLysValPheAspProGluGlyLysGly 100105110 ValLeuLysAlaAspTyrValArgGluMetLeuThrThrGlnAlaGlu 115120125 ArgPheSerLysGluGluValAspGlnMetPheAlaAlaPheProPro 130135140 AspValThrGlyAsnLeuAspTyrLysAsnLeuValHisIleIleThr 145150155160 HisGlyGluGluLysAsp 165