OPTOGENETIC SWITCHES IN BACTERIA
20220356213 · 2022-11-10
Inventors
- Andreas Diepold (Marburg, DE)
- Florian Lindner (Marburg, DE)
- Andreas Gahlmann (Charlottesville, VA, US)
Cpc classification
C12N15/74
CHEMISTRY; METALLURGY
A61N5/062
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
C07K14/24
CHEMISTRY; METALLURGY
C12N13/00
CHEMISTRY; METALLURGY
International classification
C07K14/24
CHEMISTRY; METALLURGY
C12N13/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a recombinant bacterium wherein said bacterium comprises an optogenetic interaction switch to control cellular functions, in particular wherein said bacterium is a recombinant gram-negative bacterium comprising a type III secretion system, wherein the activity of said type III secretion system is light-dependent, and to methods for controlling cellular functions in a bacterium using such an optogenetic interaction switch.
Claims
1. A recombinant gram-negative bacterium comprising a type III secretion system, wherein said type III secretion system is light-dependent, wherein said recombinant gram-negative bacterium comprises an optogenetic interaction switch.
2. The recombinant gram-negative bacterium of claim 1, which expresses at least one recombinant protein comprising (i) a cargo protein to be secreted by said type III secretion system and (ii) a secretion signal of said type III secretion system.
3. The recombinant gram-negative bacterium of claim 1 or 2, wherein said optogenetic interaction switch comprises a first and a second fusion protein, which specifically bind to each other in a light-dependent way.
4. The recombinant gram-negative bacterium of any one of claims 1 to 3, wherein said recombinant gram-negative bacterium expresses (a) a first fusion protein comprising (aa) a cytosolic component of said type III secretion system, and (ab) a first component of said optogenetic interaction switch, and (b) a second fusion protein comprising (ba) an inner membrane anchor protein and (bb) a second component of said optogenetic interaction switch, wherein said first component of said optogenetic interaction switch and said second component of said optogenetic interaction switch specifically bind to each other in a light-dependent way.
5. The recombinant gram-negative bacterium of claim 4, wherein said first fusion protein is expressed from a first nucleic acid sequence operably linked to first expression control sequences, and said second fusion protein is expressed from a second nucleic acid sequence operably linked to second expression control sequences, wherein expression of said first fusion protein is lower than expression of said second fusion protein, particularly lower by a factor of at least two, more particularly lower by a factor of at least five, particularly where said cytosolic component is a component of said type III secretion system with native low expression and/or low stoichiometry, and/or wherein said first nucleic acid sequence is either expressed from an inducible promoter or replaces the native nucleic acid sequence encoding said cytosolic component on the virulence plasmid or in the virulence region on the bacterial genome.
6. The recombinant gram-negative bacterium of any one of claims 1 to 5, wherein said recombinant gram-negative bacterium is selected from Yersinia enterocolitica and Pseudomonas aeruginosa.
7. The recombinant gram-negative bacterium of claim 6, wherein said recombinant gram-negative bacterium is selected from Yersinia enterocolitica, particularly wherein the six main virulence effectors of Yersinia enterocolitica have been deleted, more particularly wherein said recombinant gram-negative bacterium is from strain IML421asd.
8. The recombinant gram-negative bacterium of any one of claims 1 to 7, wherein the type III secretion system is functionally inactive in the absence of light of a particular wavelength, and can be functionally activated by illumination with light of said wavelength, particularly wherein said optogenetic interaction switch is the LOV switch, or an optogenetic interaction switch derived therefrom, more particularly wherein said first component of said optogenetic interaction switch is Zdk1, particularly Zdk1 according to Addgene No. 81010, and said second component of said optogenetic interaction switch is LOV2 particularly LOV2 according to Addgene No. 81041, or the V416L point mutation thereof.
9. The recombinant gram-negative bacterium of any one of claims 1 to 7, wherein the type III secretion system is functionally inactive in the presence of light of a particular wavelength, and can be functionally activated by removing illumination with light of said wavelength, particularly wherein said optogenetic interaction switch is the Magnet switch, or an optogenetic interaction switch derived therefrom, more particularly wherein said first component of said optogenetic interaction switch is nMAGHigh1, particularly nMAGHigh1 according to Addgene No. 67300, and said second component of said optogenetic interaction switch is pMAGFast2(3×), particularly pMAGFast2(3×)* according to Addgene No. 67297, or a variant of pMAGFast2(3×)* with two instead of three repeats of the domain.
10. The recombinant gram-negative bacterium of any one of claims 1 to 7, wherein the type III secretion system is functionally inactive in the presence of light of a particular wavelength, and can be functionally activated by removing illumination with light of said wavelength, particularly wherein said optogenetic interaction switch is the iLID switch, or an optogenetic interaction switch derived therefrom, more particularly wherein said first component of said optogenetic interaction switch is SspB, particularly SspB_Nano according to Addgene No. 60409, and said second component of said optogenetic interaction switch is iLID particularly iLID according to Addgene No. 60408, or the C530M point mutation thereof.
11. The recombinant gram-negative bacterium of any one of claims 1 to 7, wherein the type III secretion system is functionally inactive in the presence of light of a particular first wavelength, and is functionally active in the presence of light of a particular second wavelength, particularly wherein said optogenetic interaction switch is the Phy-PIF switch, more particularly wherein said first component of said optogenetic interaction switch is a fragment of a phytochrome interaction factor protein (PIF), particularly a PIF fragment consisting of residues 1-100 of A. thaliana PIF6 protein, and said second component of said optogenetic interaction switch is Phy, particularly a Phy variant consisting of residues 1-908 of the A. thaliana PhyB protein.
12. A method for modifying the translocation of one or more cargo proteins from a recombinant gram-negative bacterium, comprising the steps of (i) culturing a recombinant gram-negative bacterium comprising a light-dependent type III secretion system of any one of claims 1 to 11 under a first light condition, and (ii) culturing said recombinant gram-negative bacterium under a second light condition, wherein the change from said first light condition to said second light condition modifies the translocation activity of said light-dependent type III secretion system.
13. The method of claim 12, wherein said translocation activity is secretion of said one or more cargo proteins into the culture medium.
14. The method of claim 12, wherein said translocation activity is transfer of said one or more cargo proteins into a eukaryotic host cell.
15. The recombinant gram-negative bacterium of any one of claims 1 to 3, wherein the bacterium expresses (a) a first fusion protein comprising (aa) a secretion signal, and (ab) a first component of said optogenetic interaction switch, and (ac) a cargo protein to be translocated by the type III secretion system, and (b) a second fusion protein comprising (ba) an inner membrane anchor protein and (bb) a second component of said optogenetic interaction switch, wherein said first component of said optogenetic interaction switch and said second component of said optogenetic interaction switch specifically bind to each other in a light-dependent way.
Description
FIGURES
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
DETAILED DESCRIPTION OF THE INVENTION
[0039] The present invention is based on the surprising observation, that by anchoring a member of a light-dependent protein binding pair, for example to the cytoplasmic membrane, the activity of a protein of interest, which causes or modulates a cellular function of the bacterial host cell, and which is coupled to the other member of the light-regulated protein binding pair, can be switched on and off by light-induced cleavage and reformation of the light-dependent protein binding pair.
[0040] Thus, in a first aspect, the present invention relates to recombinant gram-negative bacterium comprising a type III secretion system, wherein said type III secretion system is light-dependent.
[0041] In the context of the present invention, the term “type III secretion system” refers to the bacterial type III secretion system (T3SS) injectisome. The injectisome is a bacterial nanomachine comprising a protein complex capable of translocating proteins, so-called effectors, into eukaryotic host cells in a one-step export mechanism across the bacterial and eukaryotic membranes (Deng et al, 2017; Wagner et al, 2018) (
[0042] The injectisome is an essential virulence factor for many pathogenic Gram-negative bacteria, including Salmonella, Shigella, pathogenic Escherichia coli, and Yersinia. It is usually assembled upon entry into a host organism, but remains inactive until contact to a host cell has been established. At this point, two translocator proteins exported by the T3SS form a pore in the host membrane, and a pool of so-called T3SS effector proteins is translocated into the host cell at rates of up to several hundred effectors per second (Schlumberger et al, 2005; Enninga et al, 2005; Mills et al, 2008).
[0043] As a machinery evolved to efficiently translocate proteins into eukaryotic cells, the T3SS has been successfully used to deliver protein cargo into various host cells for different purposes such as vaccination, immunotherapy, and gene editing (reviewed in Bai et al, 2018). N-terminal secretion signals as short as 15 amino acids marks cargo proteins for delivery by the T3SS (Michiels et al, 1990; Sory et al, 1995). Although the size and structure of the cargo proteins can influence translocation rates, and very large or stably folded proteins (such as GFP or dihydrofolate reductase) are exported at a lower rate, most cargoes, including large proteins with molecular weights above 60 kDa, can be exported by the T3SS (Jacobi et al, 1998; Göser et al, 2019; Ittig et al, 2015). Protein translocation into host cells can be titrated by adjusting the expression level and multiplicity of infection (ratio of bacteria and host cells). Within the bacteria, many native cargo proteins (effectors) are additionally bound by chaperones that stabilize the cargo and enhance export (Wattiau & Cornelis, 1993; Gauthier & Finlay, 2003).
[0044] Export through the T3SS is fast and efficient: more than 10.sup.6 effectors can be translocated into a single host cell at rates of several hundred effectors per injectisome and second (Schlumberger et al, 2005; Enninga et al, 2005; Ittig et al, 2015). While the size and folding of the cargo proteins can influence translocation rates, and very large or stably folded proteins (such as GFP or dihydrofolate reductase) are exported at a lower rate, most cargo proteins, including proteins with molecular weights above 60 kDa, can be exported by the T3SS (Jacobi et al, 1998; Ittig et al, 2015). The amount of protein translocation into host cells can be titrated by changing the multiplicity of infection (ratio of bacteria and host cells). Within the host, the T3SS secretion signal can be cleaved off by site-specific proteases or cleavage at the C-terminus of a ubiquitin domain by the native host cell machinery (in secretion signal-ubiquitin-cargo fusions), and subcellular localization can be influenced using nanobodies co-translocated by the T3SS (Blanco-Toribio et al, 2010; Ittig et al, 2015). Taken together, these properties make the T3SS an efficient, versatile and well-controllable tool for protein delivery into eukaryotic cells (Ittig et al, 2015; Bai et al, 2018).
[0045] However, T3SS inject effector proteins into host cells as soon as they are in contact (Pettersson et al, 1996). Lack of target specificity is therefore a main obstacle in the further development and application of that method (Walker et al, 2017; Feigner et al, 2017).
[0046] In the context of the present invention, the term “light-dependent” indicates that the function or feature of, or present in, the recombinant bacterium that is light-dependent, such as light-dependent protein binding or a light-dependent type III secretion system, is influenced by the presence or absence of light of a particular wavelength or wavelength spectrum. In particular, the term refers to situations, where the presence or absence of light of a particular wavelength or wavelength spectrum changes said function or feature from an “on” state to an “off” state or vice versa, such as from binding of a protein pair to non-binding, or from a light-dependent type III secretion system being active to being inactive. In particular embodiments, the term “light-dependent” refers to a function or feature that is not present in that light-dependent form in the wild-type bacterium that is the basis for the generation of the recombinant bacterium according to the present invention.
[0047] In particular embodiments, said recombinant gram-negative bacterium expresses at least one recombinant protein comprising (i) a cargo protein to be secreted by said type III secretion system and (ii) a secretion signal of said type III secretion system.
[0048] In the context of the present invention, the term “at least one recombinant protein” means that embodiments are included, wherein said recombinant gram-negative bacterium comprises one recombinant protein comprising a cargo protein that should be translocated, but that embodiments are included as well, where two or more recombinant proteins are present, each comprising such a cargo protein.
[0049] In particular embodiments, said secretion signal of said type III secretion system is a secretion signal of an effector protein of said gram-negative bacterium, in particular of one of the six effector protein of Y. enterocolitica, in particular an effector protein selected from YopH and YopE. In particular embodiments, said secretion signal comprises the minimal secretion signal for the native Y. enterocolitica effector YopH, in particular YopH.sub.1_17. In particular such embodiment, said secretion signal consists of the minimal secretion signal YopH.sub.1-17. In particular other embodiments, said secretion signal comprises the minimal secretion signal for the native Y. enterocolitica effector YopE, in particular YopH.sub.1-53. In particular such embodiment, said secretion signal consists of the minimal secretion signal YopH.sub.1-53.
[0050] In particular embodiments, said recombinant gram-negative bacterium comprises an optogenetic interaction switch.
[0051] In particular embodiments, said optogenetic interaction switch comprises a first and a second fusion protein, which specifically bind to each other in a light-dependent way.
[0052] In particular embodiments, said recombinant gram-negative bacterium expresses (a) a first fusion protein comprising (aa) a cytosolic component of said type III secretion system, and (ab) a first component of said optogenetic interaction switch, and (b) a second fusion protein comprising (ba) an inner membrane anchor protein and (bb) a second component of said optogenetic interaction switch, wherein said first component of said optogenetic interaction switch and said second component of said optogenetic interaction switch specifically bind to each other in a light-dependent way.
[0053] In the context of the present invention, the term “specifically bind to” refers to measurable and reproducible interactions such as binding between two proteins such as a protein of interest and its cognate binding partner, which is determinative of the presence of the protein of interest in the presence of a heterogeneous population of molecules including biological molecules. For example, an antibody that specifically binds to a target (which can be an epitope) is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets. In its most general form (and when no defined reference is mentioned), “specific binding” is referring to the ability of the a protein of interest to discriminate between the cognate binding partner and an unrelated molecule, as determined, for example, in accordance with a specificity assay methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA, RIA, ECL, IRMA, SPR (Surface plasmon resonance) tests and peptide scans. For example, a standard ELISA assay can be carried out. The scoring may be carried out by standard color development (e.g. secondary antibody with horseradish peroxide and tetramethyl benzidine with hydrogen peroxide). The reaction in certain wells is scored by the optical density, for example, at 450 nm. Typical background (=negative reaction) may be about 0.1 OD; typical positive reaction may be about 1 OD. This means the ratio between a positive and a negative score can be 10-fold or higher. In a further example, an SPR assay can be carried out, wherein at least 10-fold, preferably at least 100-fold difference between a background and signal indicates on specific binding. Typically, determination of binding specificity is performed by using not a single reference molecule, but a set of about three to five unrelated molecules, such as milk powder, transferrin or the like. The first component of the optogenetic interaction switch of the present invention and said second component of said optogenetic interaction switch are able to specifically bind to each other under a first light condition, so that the predominant part of said first fusion protein present in said recombinant gram-negative bacterium is bound to said second fusion protein by way of the specific interaction of said first and said second component of said type III secretion system, whereas under a second light condition, the predominant part of said first fusion protein is present in free form in said recombinant gram-negative bacterium. In particular embodiments, the ratio of free first fusion protein to first fusion protein bound to said second fusion protein changes at least 5-fold, particularly at least 10-fold, more particularly at least 20-fold between the first and second light condition.
[0054] In particular embodiments, said membrane anchor is derived from the E. coli TatA transmembrane protein, particularly a membrane anchor comprising the N-terminal part of TatA comprising an insertion of a Valine and a Leucine residue (see bold residues), particularly comprising the sequence MGGISIWQLLIIAVIVVLLVLFGTKKLGS (SEQ ID NO: 1).
[0055] In particular embodiments, said first fusion protein is expressed from a first nucleic acid sequence operably linked to first expression control sequences, and said second fusion protein is expressed from a second nucleic acid sequence operably linked to second expression control sequences, wherein expression of said first fusion protein is lower than expression of said second fusion protein, particularly lower by a factor of at least two, more particularly lower by a factor of at least five.
[0056] In particular such embodiments, said first fusion protein comprising the membrane anchor constructs is expressed rom an inducible medium-high copy expression vector, in particular pBAD-His/B, and the cytosolic bait fusion construct is expressed from a compatible low copy vector, in particular pACYC184.
[0057] In particular embodiments, said cytosolic component is a component of said type III secretion system with native low expression and/or low stoichiometry, and/or wherein said first nucleic acid sequence is either expressed from an inducible promoter or replaces the native nucleic acid sequence encoding said cytosolic component on the virulence plasmid or in the virulence region on the bacterial genome.
[0058] In the context of the present invention, the term “virulence plasmid” refers to a plasmid of pathogenic bacteria that encodes factors responsible and required for the pathogenic activity, and the term “virulence region” relates to a corresponding region of the genome of bacteria that have integrated the virulence factors into their genome. In the case of Yersinia enterocolitica as an example of a gram-negative bacterium comprising a type III secretion system, the virulence plasmid termed pYV comprises the ysc and Icr genes, which are essential for delivery of additional plasmid-borne anti-host factors collectively referred to as Yops (Yersinia outer proteins). In particular embodiments, said recombinant gram-negative bacterium does not comprise a cargo protein expressed by the wild-type form of said gram-negative bacterium. Thus, while it is not excluded that said recombinant gram-negative bacterium comprises both wild type cargo proteins, i. e. cargo proteins that are translocated by said type III secretion system in a wild type gram-negative bacterium, and a recombinant fusion protein comprising a protein of interest fused to a secretion signal of said type III secretion system, it is particularly advantageous that no such wild type cargo protein is present that could compete with said recombinant fusion protein for translocation by said type III secretion system.
[0059] In particular embodiments, said recombinant gram-negative bacterium does not comprise a non-recombinant protein comprising a secretion signal of said type III secretion system. In particular such embodiments, said recombinant-gram negative bacterium does not comprise a wild-type protein comprising a secretion signal. In particular such embodiments, said recombinant-gram negative bacterium does not comprise any protein comprising a secretion signal except for said first fusion protein.
[0060] In particular embodiments, said recombinant gram-negative bacterium is from a species selected from the group of Yersinia, Pseudomonas, Escherichia coli, Salmonella, Shigella, Vibrio, Burkholderia, Chlamydia, Erwinia, Ralstonia, Xanthomonas, and Rhizobium.
[0061] In particular embodiments, said recombinant gram-negative bacterium is from a species selected from Yersinia, Pseudomonas, Escherichia coli, and Salmonella, particularly selected from Yersinia and Pseudomonas.
[0062] In particular embodiments, said recombinant gram-negative bacterium is selected from Yersinia enterocolitica and Pseudomonas aeruginosa.
[0063] In particular embodiments, said recombinant gram-negative bacterium is from Yersinia enterocolitica.
[0064] The gram-negative, rod-shaped, facultative anaerobe enterobacterium Y. enterocolitica is able to colonize, invade and multiply in host tissues and cause intestine diseases that are commonly called yersiniosis. Essential for virulence is the translocation of six Yop (Yersinia outer protein) effector proteins into phagocytes, which prevent phagocytosis and block pro-inflammatory signaling (Cornelis, 2002).
[0065] In particular such embodiments, the six main virulence effectors of Yersinia enterocolitica have been deleted.
[0066] In the context of the present invention, the phrase “six main virulence effectors” refers to the six Yop (Yersinia outer protein) effector proteins.
[0067] In particular embodiments, said recombinant gram-negative bacterium is from strain IML421asd.
[0068] In the context of the present invention, the term “strain IML421asd” refers to the strain IML421asd (ΔHOPEMTasd) as described by Kudryashev et al, 2013, where the six main virulence effectors have been deleted.
[0069] In particular embodiments, said cytosolic component is selected from SctK, SctL, SctQ, and SctN.
[0070] In the context of the present invention, the terms “SctK”, “SctL”, “SctQ”, and “SctN” refer to the four soluble cytosolic components of the T3SS (SctK, L, Q, N, previously called YscK, L, Q, N) in Yersinia enterocolitica, which interact with each other, and form a complex at the proximal interface of the injectisome (Morita-ishihara et al, 2005; Johnson & Blocker, 2008; Biemans-Oldehinkel et al, 2011; Diepold et al, 2017; Hu et al, 2017; Lara-Tejero et al, 2019) (
[0071] In particular embodiments, said cytosolic component is SctQ.
[0072] In particular embodiments, the type III secretion system is functionally inactive in the absence of light of a particular wavelength and can be functionally activated by illumination with light of said wavelength.
[0073] In particular such embodiments, said optogenetic interaction switch is the LOV switch or an optogenetic interaction switch derived therefrom.
[0074] In the context of the present invention, the term “LOV switch” refers to the LOVTRAP system (LOV), which consists of the two interacting proteins LOV2 (a photo sensor domain from Avena sativa phototropin 1) (anchor) and Zdk1 (Z subunit of the protein A) (bait). These proteins are usually bound to each other in the dark. After irradiation with blue light (˜480 nm wavelength) LOV2 undergoes a conformational change and Zdk1 is released. Wang and coworkers have established several point mutations of the LOV2 binding domain which modulate the binding affinity and dissociation rate. In the present application, the wild type combination, which has a return rate of about 100 s (Wang et al, 2016) (
[0075] In the context of the present invention, the term “optogenetic interaction switch derived therefrom” refers to a variant of the optogenetic interaction switch being referred to. In the case of the wild type LOV switch as disclosed in Wang et al., 2016, the optogenetic switches derived therefrom include length variants of Zdk1 and/or LOV2, or point mutations, such as the V416L point mutant of LOV2.
[0076] In particular such embodiments, said first component of said optogenetic interaction switch is Zdk1, particularly Zdk1 according to Addgene No. 81010, and said second component of said optogenetic interaction switch is LOV2 particularly LOV2 according to Addgene No. 81041, or the V416L point mutation thereof.
TABLE-US-00001 Bait: Zdk1 generated by mRNA display screening of a library derived from the Z subunit of protein A Addgene code: p81010 SEQ ID NO: 2: Sequence of bait Zdk1-YscQ (Zdk1 sequence in italics, YscQ sequence in bold, linker underlined): MSLRSGAGVDNKFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSA NLLAEAKKLNDAQAPKGGSELGGSGGSGGSLLTLPQAKLSELSLRQRLSH YRQNYLWEEGKLELTVSEPPSSLNCILQLQWKGTHFTLYCFGDDLANWLT PDLLGAPFSTLPKELQLALLERQTVFLPKLVCNDIATASLSVTQPLLSLR LSRDNAHISFWLTSAEALFALLPARPNSERIPLPILLSLRWHKVYLTLDE VDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES DELNPKPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGE VRLLANGRLLGHGRLVEIQGRLGVRIERLTEVTIS Anchor: LOV2 (V416L) Photosensor domain from Avena sativa phototropin 1 Mutation V416L isaid to lower binding affinity Addgene code: p81041 SEQ ID NO: 3: Sequence of anchor (membrane anchor- FLAG tag in bold, LOV2 sequence in italics, mutation V416L underlined): MGGISIWQLLIIAVIVVLLVLFGTKKLGSDYKDDDDKGGAGGSLATTLER IEKNFLITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDR ATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFI GVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
[0077] In particular embodiments, the type III secretion system is functionally inactive in the presence of light of a particular wavelength and can be functionally activated by removing illumination with light of said wavelength.
[0078] In particular such embodiments, said optogenetic interaction switch is the Magnet switch, or an optogenetic interaction switch derived therefrom.
[0079] In the context of the present invention, the term “Magnet switch” refers to a system, which consists of two engineered photoreceptors VVD, called Magnets, which were derived from the filamentous fungus Neurospora crassa. These Magnet proteins bind to each other upon irradiation with blue light and dissociate to an “off-state” in the dark. Several mutations and combinations were designed (Kawano et al, 2015), which allows dissociation rates from seconds to hours. We chose the combination of pMAGFast2(3×) (anchor) and nMAGHigh1 (bait), which have a dissociation rate of 40-60 s (Kawano et al, 2015)
[0080] In particular embodiments, said first component of said optogenetic interaction switch is nMAGHigh1, particularly nMAGHigh1 according to Addgene No. 67300, and said second component of said optogenetic interaction switch is pMAGFast2(3×), particularly pMAGFast2(3×)* according to Addgene No. 67297, or a variant of pMAGFast2(3×)* with two instead of three repeats of the domain.
[0081] In other particular embodiments, said optogenetic interaction switch is the iLID switch, or an optogenetic interaction switch derived therefrom.
[0082] In the context of the present invention, the term “iLID switch” refers to a system that consists of two interacting proteins: iLID (anchor), which is derived from an LOV2 domain from Avena sativa phototropin 1 and a binding partner, in the present case SspB_Nano (bait). This combination was chosen because of its fast recovery half-time of 90-180 s. The iLID system has a low binding affinity in the dark and a high affinity upon irradiation with blue light (Guntas et al, 2015; Zimmerman et al, 2016).
[0083] In particular such embodiments, said first component of said optogenetic interaction switch is SspB, particularly SspB_Nano according to Addgene No. 60409, and said second component of said optogenetic interaction switch is iLID particularly iLID according to Addgene No. 60408, or the C530M point mutation thereof.
TABLE-US-00002 Anchor: iLID (C530M) derived from an LOV2 domain from Avena sativa phototropin 1 Addgene code: p60408 SEQ ID NO: 4: Sequence: TMH-FLAG-iLID (iLID sequence in italics): MGGISIWQLLIIAVIVVLLVLFGTKKLGSDYKDDDDKGGAGGSGEFLATT LERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPE TDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNVFHLQPMRDYKGDVQ YFIGVQLDGTERLHGAAEREAVMLIKKTAFQIAEAANDENYF Bait: SspB Nano Addgene code: p60409 SEQ ID NO: 5: Sequence of bait (SspB_Nano sequence in italics, YscQ sequence in bold, linker underlined): MSLRSGAGSSPKRPKLLREYYDWLVDNSFTPYLWDATYLGVNVPVEYVKD GQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYAREN GDGVMFEPEEIYDELNIGGAGELGGSGGSGGSLLTLPQAKLSELSLRQRL SHYRQNYLWEEGKLELTVSEPPSSLNCILQLQWKGTHFTLYCFGDDLANW LTPDLLGAPFSTLPKELQLALLERQTVFLPKLVCNDIATASLSVTQPLLS LRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILLSLRWHKVYLTL DEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSH ESDELNPKPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVD GEVRLLANGRLLGHGRLVEIQGRLGVRIERLTEVTIS
[0084] In other embodiments of the recombinant gram-negative bacterium of the present invention, the type III secretion system is functionally inactive in the presence of light of a particular first wavelength and is functionally active in the presence of light of a particular second wavelength.
[0085] In particular such embodiments, said optogenetic interaction switch is the Phy-PIF switch, or an optogenetic interaction switch derived therefrom.
[0086] In particular such embodiments, said first component of said optogenetic interaction switch is a fragment of a phytochrome interaction factor protein (PIF), and said second component of said optogenetic interaction switch is a Phy variant.
[0087] In particular such embodiments, said PIF fragment is a fragment of A. thaliana PIF3 protein, and said second component of said optogenetic interaction switch is a Phy variant, particularly a Phy variant consisting of residues 1-621 of the A. thaliana PhyB protein.
[0088] In particular other such embodiments, said PIF fragment is a fragment of A. thaliana PIF6 protein, particularly a PIF fragment consisting of residues 1-100 of A. thaliana PIF6 protein, and said second component of said optogenetic interaction switch is a Phy variant, particularly a Phy variant consisting of residues 1-901 of the A. thaliana PhyB protein.
[0089] In particular such embodiments, said Phy variant is fused N-terminally of said inner membrane anchor protein, particularly linked by the linker EFDSAGSAGSAGGSS (SEQ ID NO: 6).
[0090] In these embodiments, a membrane-permeable small molecule chromophore is needed for light-induced interaction. In particular embodiments, said recombinant gram-negative bacterium comprises phycocyanobilin (PCB). In particular such embodiments, PCB is present in or added to the culture medium. In other such embodiments, PCB synthesis is integrated inside said recombinant gram-negative bacterium, particularly by a two-plasmid system comprising a first plasmid expressing an apophytochrome, and a second plasmid expressing a dual gene operon containing a heme oxygenase and a bilin reductase.
[0091] In these embodiments of an optogenetic switch, exposure to light of a wavelength of 650 nm induces association of PIF and Phy, while exposure to light of a wavelength of 750 nm induces dissociation of PIF from Phy.
[0092] In a second aspect, the present invention relates to a method for modifying the translocation of one or more cargo proteins from a recombinant gram-negative bacterium, comprising the steps of (i) culturing a recombinant gram-negative bacterium comprising a light-dependent type III secretion system of the present invention under a first light condition, and (ii) culturing said recombinant gram-negative bacterium under a second light condition, wherein the change from said first light condition to said second light condition modifies the translocation activity of said light-dependent type III secretion system
[0093] In particular embodiments, said translocation activity is secretion of said one or more cargo proteins into the culture medium.
[0094] In other particular embodiments, said translocation activity is transfer of said one or more cargo proteins into a eukaryotic host cell.
[0095] In particular embodiments, said recombinant gram-negative bacterium expresses (a) a first fusion protein comprising (aa) a secretion signal, and (ab) a first component of said optogenetic interaction switch, and (ac) a cargo protein to be translocated by the type III secretion system, and (b) a second fusion protein comprising (ba) an inner membrane anchor protein and (bb) a second component of said optogenetic interaction switch, wherein said first component of said optogenetic interaction switch and said second component of said optogenetic interaction switch specifically bind to each other in a light-dependent way.
[0096] In such embodiments, the type III secretion system is fully functional, but no secretion of the cargo protein takes place, when said first fusion protein is bound to said second fusion via the interaction of said first component of said optogenetic interaction switch and said second component of said optogenetic interaction switch. Secretion of said cargo protein only starts after light-induced activation of said optogenetic interaction switch resulting in release of said first fusion protein. In particular embodiments, said recombinant gram-negative bacterium does not comprise a non-recombinant protein comprising a secretion signal of said type III secretion system. In particular such embodiments, said recombinant-gram negative bacterium does not comprise a wild-type protein comprising a secretion signal. In particular such embodiments, said recombinant-gram negative bacterium does not comprise any protein comprising a secretion signal except for said first fusion protein.
[0097] In a third aspect, the present invention relates to a recombinant bacterium wherein said recombinant bacterium comprises an optogenetic interaction switch to control one or more cellular functions.
[0098] In particular embodiments, said optogenetic interaction switch comprises a first and a second fusion protein, which specifically bind to each other in a light-dependent way.
[0099] In particular embodiments, said recombinant bacterium expresses (a) a first fusion protein comprising (aa) a first component of said optogenetic interaction switch, and (ab) the protein of interest whose one or more functions should be controlled in a light-dependent way, and (b) a second fusion protein comprising (ba) an anchor protein, wherein said anchor protein fixes said first second fusion protein to an organelle of said recombinant bacterium, particularly to the inner membrane, and (bb) a second component of said optogenetic interaction switch, wherein said first component of said optogenetic interaction switch and said second component of said optogenetic interaction switch specifically bind to each other in a light-dependent way.
[0100] In the context of the present invention, the term “organelle” refers in general to structural subunits of bacteria, including the outer cell wall, the cytoplasmic membrane, additional intracellular membranes, the bacterial chromosome, plasmids, any cytoskeleton structures, nutrient storage structures, and microcompartments. In particular, the term “organelle” refers to the cytoplasmic (or plasma) membrane.
[0101] In particular embodiments, one or more functions of said protein of interest within the bacterium are inhibited by light-dependent binding of said anchor protein to said organelle, particularly to the inner membrane, particularly wherein said protein of interest functions within the cytosol, or has an intermediate cytosolic state.
[0102] In particular embodiments, the one or more functions of said protein of interest are inhibited by light-dependent binding of said anchor protein to said organelle, particularly to the inner membrane, because said protein of interest cannot interact with any of its native target, or fulfil its native role, when in proximity to said membrane anchor.
[0103] In other particular embodiments, where the function of the target protein is inhibited by light-dependent binding to the membrane anchor, because a binding interface of said protein of interest that is required for any of the native functions of said protein of interest is inaccessible, when said anchor protein is bound to said organelle.
[0104] In a fourth aspect, the present invention relates to method for modifying at least one cellular function of a recombinant bacterium, comprising the steps of (i) culturing a recombinant bacterium comprising an optogenetic interaction switch of the third aspect of the present invention under a first light condition, and (ii) culturing said recombinant bacterium under a second light condition, wherein the change from said first light condition to said second light condition modifies at least one cellular function.
Examples
[0105] LITESEC-T3SS—Protein Secretion and Translocation into Eukaryotic Cells with High Spatial and Temporal Resolution by Light-Controlled Activation of the Bacterial Type III Secretion System
[0106] Abstract
[0107] In this study, we apply T3SS dynamics to control protein secretion and translocation by the T3SS, by coupling these dynamic proteins with optogenetic interaction switches featuring a membrane-bound anchor domain. Initially, we screened and optimized several optogenetic systems for a proof of principle for the establishment of optogenetic interaction control in prokaryotes. Next, we incorporated the essential dynamic cytosolic T3SS component SctQ into the most suitable systems, which allows controlling the availability of this component, and in consequence secretion of effector proteins through the T3SS by light. Different versions of our resulting LITESEC-T3SS (Light-induced secretion of effectors through sequestration of endogenous components of the T355) system achieve fast and specific temporal extraction or release of SctQ. Strikingly, in vitro secretion assays confirmed that these systems allow to both activate or block secretion of effector proteins through the T3SS by blue light, permitting spatially and temporally resolved protein translocation into host cells.
[0108] Function and Regulation of the T3SS in Yersinia enterocolitica
[0109] The gram-negative, rod-shaped, facultative anaerobe enterobacterium Y. enterocolitica is able to colonize, invade and multiply in host tissues and cause intestine diseases that are commonly called yersiniosis. Essential for virulence is the translocation of six Yop (Yersinia outer protein) effector proteins into phagocytes, which prevent phagocytosis and block pro-inflammatory signaling (Cornelis, 2002). In this study, we use the strain IML421asd (ΔHOPEMTasd) (Kudryashev et al, 2013), where the six main virulence effectors have been deleted. Formation of the injectisome is often induced by temperature. In Yersinia sp., incubation at 37° C., the host body temperature, leads to expression of the main T3SS transcription factor VirF/LcrF by the dissociation of the repressor YmoA, which blocks its transcription at lower temperatures (Lambert de Rouvroit et al, 1992). This activates the expression of the T3SS genes on the pYV virulence plasmid, and assembly of injectisomes. Secretion of effector proteins is then triggered by host cell contact or low Ca.sup.2+ in the medium (Cornelis, 2006).
[0110] Dynamics of the Cytosolic Components of the T3SS and its Link to Effector Secretion
[0111] In this work, three different optogenetic interaction switches were used to sequester cytosolic proteins to the bacterial inner membrane (IM) (Table 1): (i) the LOVTRAP system (LOV), (ii) the Magnet system, and (iii) the iLID system.
TABLE-US-00003 TABLE 1 Overview of optogenetic systems Optogenetic systems that were investigated in this work with properties and application in LITESEC-T3SS. *, due to recombination events during cloning, the used anchor for the Magnet-based sequestration system only contained two consecutive copies of the pMAGFast2 protein, and is therefore expected to display a slightly lower dissociation rate, compared to the original 3x version (Kawano et al, 2015). Used anchor Dissociation System class and bait rate after Application in System and properties proteins activation Ref. LITESEC-T3SS LOV Light-released LOV2 ~100 s Wang Release of bait Dark = bound Zdk1 et al, protein by blue state 2016 light .fwdarw. Light = activation of unbound state secretion Magnet Dark-released pMAGFast2(2x) ~40-60 s Kawano Tethering of bait Dark = nMAGHigh1 et al, protein by blue unbound state 2015 light .fwdarw. Light = bound suppression of state secretion iLID Dark-released iLID ~90-180 s Guntas Tethering of bait Dark = SspB_Nano et al, protein by blue unbound state 2015 light .fwdarw. Light = bound suppression of state secretion
[0112] Aim of this Study
[0113] By combining a light-induced protein interaction domain with an essential dynamic type III secretion system (T3SS) component, we aim to control the availability of the component, and in consequence T3SS-based protein translocation into host cells, by light. The resulting system allows spatially and temporally resolved protein translocation into host cells.
[0114] Optogenetic systems were mainly established and studied in eukaryotic cells (Mukherjee et al, 2017; Wang et al, 2016; Zimmerman et al, 2016; Kawano et al, 2015). Bacteria are less compartmentalized than eukaryotic cells. We therefore designed a system where one interaction partner of the interaction switch was tethered to the bacterial inner membrane (IM). As a proof of principle, we assessed the effect of illumination on the different switches by light microscopy, using a fluorescently labeled bait protein. This allowed to optimize the systems by adjusting expression levels of anchor and bait proteins, and intensity and duration of illumination. Having demonstrated that these optogenetic sequestration systems can be used in bacteria, we fused an essential Y. enterocolitica cytosolic T3SS component to the respective bait protein to control its availability and, in consequence, secretion of effector proteins through the T3SS by light. The successful development of this system enables widespread opportunities for using the T3SS as a specific and time-controlled tool to deliver proteins of interest into eukaryotic cells (Ittig et al, 2015; Bai et al, 2018).
[0115] Results
[0116] Establishment and Optimization of Optogenetic Sequestration Systems in Y. enterocolitica
[0117] Design and Functionality of Light-Controlled Protein Sequestration Systems
[0118] Optogenetic systems were mainly established and studied in eukaryotic cells (Mukherjee et al, 2017), most optogenetic applications have not been used or characterized in bacteria so far. Bacteria are much smaller than eukaryotic cells and generally lack organelles, which are often used as anchoring points for optogenetic interaction switches in eukaryotes (Wang et al, 2016; Zimmerman et al, 2016). For that reason, the first step of our research was to establish optogenetic sequestration systems in Y. enterocolitica to act as proofs of principle and to allow the optimization of the resulting strains for the application in the LITESEC systems. For the sequestration systems, the larger optogenetic interaction partner of all three underlying optogenetic interaction switches was anchored to the inner membrane (anchor). This was achieved by adding the N-terminal transmembrane helix (TMH) of a well-characterized transmembrane protein, Escherichia coli TatA, which was extended by two amino acids for more stable insertion in the IM, and connected with the interaction partner by a linker containing short Glycine-rich stretches for flexibility and a FLAG tag for detection (see material and methods for details). The smaller interaction partner was fused with a flexible linker to a fluorescent protein for the proof of principle, or the dynamic T3SS component for the final LITESEC constructs (bait). This strategy increased the chance of obtaining functional fusion proteins.
[0119] To characterize the resulting optogenetic sequestration systems in living bacteria, we visualized fusions of fluorescent proteins to either the membrane anchor, or the cytosolic bait (
TABLE-US-00004 TABLE 2 Optogenetic constructs for membrane sequestration assay Constructs of the interaction partners used for the membrane sequestration assay, and their domains. TMH, extended transmembrane helix (see material and methods for details). Role of Optogenetic Plasmid expressed system name Domains of expressed protein protein LOV pAD608 TMH-FLAG-LOV2 Anchor pFL100 TMH-FLAG-mCherry-LOV2 pFL101 Zdk1-EGFP Bait pFL104 Zdk1-mCherry Magnet pAD614 TMH-FLAG-pMAGFast2 Anchor pFL102 TMH-FLAG-mCherry- pFL103 pMAGFast2 Bait pFL106 nMAGHigh1-EGFP nMAGHigh1-mCherry iLID pFL108 TMH-FLAG-iLID Anchor pFL107 TMH-FLAG-mCherry-iLID pFL109 SspB_Nano-mCherry Bait
[0120] To visualize the localization of the two interacting optogenetic proteins of the LOV system and the Magnet system, combinations of mCherry-labeled anchors and corresponding EGFP-labeled bait proteins were transformed into Y. enterocolitica. The strains were grown at ambient light and visualized with a fluorescence microscope (no pre-irradiation with blue light of˜480 nm). The membrane-anchored proteins fused to mCherry showed a strict localization on the membrane and no fluorescence signal in the cytosol (
[0121] Light-Dependent Protein Sequestration in Y. enterocolitica
[0122] Next, we tested the effect of blue light on the localization of the bait proteins in the different systems. For each tested optogenetic interaction switch, we combined a non-fluorescent anchor and fused the bait to mCherry, which has an excitation wavelength that does not overlap with the activation wavelength of the optogenetic switch systems. To exclude any effect of blue light components of ambient light on the tested samples, we incubated Y. enterocolitica expressing the respective protein pairs in the dark or under blue light (see material and methods for details), and fixed the cells prior to analysis at the fluorescence microscope.
[0123] The bait protein in the LOV-based sequestration system was released to the cytosol upon illumination, albeit incompletely, and still displayed partial membrane localization in light conditions (
[0124] Expression Level and Stability of Optogenetic Fusion Proteins
[0125] To investigate possible reasons for the incomplete binding or release of the bait proteins (
[0126] Based on these results, we used the iLID-based sequestration system, which showed the most suitable expression ratio and a strong reaction to blue light, and the LOV-based sequestration system, which is the only light-released system, allowing to activate the T3SS in the final LITESEC system, in the next experiments.
[0127] Interaction and Recovery Dynamics of the Optogenetic Sequestration Systems
[0128] To test the dynamics of the sequestration switches in live Y. enterocolitica, time-lapse experiments with the iLID-based and the LOV-based sequestration systems were performed. In each case, the localization of the mCherry-bait fusion in live Y. enterocolitica grown in the dark was determined by fluorescence microscopy. The system was then activated by a short pulse of blue light (0.1 sec of GFP excitation light (˜480 nm)), and changes in bait localization were tracked over time (
[0129] Optogenetic Control of T3SS Effector Secretion
[0130] To establish light control over protein translocation activity of the T3SS, we developed two complementary systems, based on the results of the previous experiments:
[0131] A) LITESEC-Supp, a System that Confers Suppression of T3SS-Dependent Protein Translocation by Blue Light Illumination
[0132] B) LITESEC-Act, a System that Confers Activation of T3SS-Dependent Protein Translocation by Blue Light Illumination
[0133] Both systems rely on two interaction partners which we have engineered:
[0134] (i) the membrane-bound anchor proteins used in the previous experiments, fusions between an extended trans-membrane helix, a Flag peptide for detection and spacing, and the larger component of the interaction switches that performed best in the sequestration assays, iLID (LITESEC-supp)/LOV2 (LITESEC-act). As in the preliminary experiments, the resulting fusion proteins, TMH-iLID/TMH-LOV2, are expressed from a plasmid;
[0135] (ii) fusion proteins between an essential cytosolic T3SS component, SctQ, and the smaller component of the interaction switches, SspB_Nano (LITESEC-supp)/Zdk1 (LITESEC-act). The two domains of the fusion proteins are connected by a flexible Glycine-rich peptide linker that was shown to retain the functionality of SctQ fusion proteins (Diepold et al, 2010, 2015). The resulting fusion proteins, SspB_Nano-SctQ/Zdk1-SctQ, replace the wild-type SctQ protein on the virulence plasmid (allelic exchange of the genes, (Kaniga et al, 1991)).
[0136] The two proteins were co-expressed in a non-virulent Y. enterocolitica strain lacking its native virulence effectors to allow optogenetic (light-induced) control of protein translocation by the T3SS (
[0137] For the iLID-based LITESEC-supp system, in the light, the bait protein is tethered to the membrane anchor (
[0138] Expression Levels and Stability of LITESEC Components
[0139] We confirmed that the SctQ fusion proteins used in the LITESEC system, Zdk1-SctQ and SspB_Nano-SctQ are functional (strains expressing the fusion proteins instead of wild-type SctQ secrete effectors at a normal level) (
[0140] Development and Characterization of LITESEC Strains
[0141] For the development of the LITESEC strains, we replaced SctQ with the bait fusion proteins Zdk1-SctQ or SspB_Nano-SctQ at its native genetic location via allelic exchange. We confirmed the functionality of the fusion proteins (normal level of effector secretion) in an in vitro secretion assay (
[0142] Light-Dependent Protein Sequestration in Y. enterocolitica
[0143] To assess the efficiency of the sequestration switches and to monitor their dynamics in live Y. enterocolitica, we visualized the components of the iLID- and LOV-based sequestration systems by time-lapse fluorescence microscopy. In preliminary experiments, we confirmed that the membrane-anchored proteins fused to mCherry showed a strict membrane localization and no fluorescence signal in the cytosol (
[0144] Control of Protein Secretion by Illumination
[0145] Can we control T3SS secretion by light? We first tested the LITESEC-supp system in an in vitro protein secretion assay under conditions that usually lead to effector secretion (presence of 5 mM EGTA in the medium) (Cornelis, 2006). Indeed, the light-suppressed LITESEC-supp system showed normal effector secretion when grown in the dark, but strongly reduced effector secretion when grown under blue light (λ=488 nm) (
[0146] Improved Functionality of the LITESEC-Act System by Using a Mutated Anchor (V416L)
[0147] We next tested the LITESEC-act1 system, where secretion is induced by blue light illumination, and detected only a very weak activation of protein export under light conditions (
[0148] Therefore, we constructed and tested additional versions of LITESEC-act, using the mutated anchor version V416L, which displays a weaker affinity to the bait (Wang et al, 2016). We introduced the mutation into the medium-high copy pBAD expression vector used for the baits in all previous experiments, as well as two low-copy vectors, pACYC184 and pMMB67EH, which we hypothesized to lead to a lower anchor/bait expression ration, and as a consequence to more efficient release of the bait and activation of T3SS secretion upon illumination. As controls, we also expressed the anchor of the LITESEC-supp1 system from the same plasmids.
[0149] We then tested the response of the resulting LITESEC systems (Table 3) to light in an in vitro secretion assay. In contrast to the original LITESEC-act1 strain, LITESEC-act2 showed significant induction of protein secretion in the light, compared to dark conditions (
[0150] To determine whether the changed secretion efficiencies are indeed due to the lower expression of the anchor proteins in the new strains, we tested the expression levels by immunoblot. As expected, the anchor proteins expressed from the pBAD plasmids in the LITESEC-act2/-supp1 strains show the highest expression level (
[0151] The Export of Heterologous Substrates by the T3SS can be Controlled by Light
[0152] The T3SS-dependent export of heterologous cargo has been shown and applied for many purposes in earlier studies (Ittig et al, 2015; Walker et al, 2017; Bai et al, 2018). To confirm that we can control the export of heterologous proteins in the LITESEC strains, we combined the LITESEC-act3 and -supp2 systems with a plasmid expressing a heterologous cargo protein, the luciferase NanoLuc, fused to a short N-terminal secretion signal, YopE.sub.1_53, and a C-terminal FLAG tag for detection. YopE.sub.1-53 had been determined as minimal translocation signal for YopE (Sory et al, 1995), and successfully used for translocation of ß-lactamase by Y. enterocolitica into various eukaryotic cell lines (Köberle et al, 2009; Autenrieth et al, 2010). The cargo protein was specifically exported in the light by the LITESEC-act3 strain, and specifically in the dark by the LITESEC-supp2 strain, whereas export was light-independent in a wild-type strain (
[0153] Kinetics of Light-Induced T3SS Activation
[0154] To test whether the function of the LITESEC system can be influenced over time, and to estimate the activation and deactivation kinetics, the LITESEC-supp1 strain and a wild-type control were incubated under secreting conditions, consecutively for 60 min under blue light, 60 min in the dark, and another 60 min under blue light. After each incubation period, the culture medium was replaced, and a sample was tested for secretion by SDS-PAGE. Secretion in LITESEC-supp1 was specifically induced in the dark and suppressed upon illumination (
TABLE-US-00005 TABLE 3 Schematic overview of the two LITESEC systems and their optogenetic components Constructs of the interaction partners used for the membrane sequestration assay, and their properties. All bait proteins are expressed from their native genetic locus. TMH, extended transmembrane helix (see material and methods for details). Optogenetic T3SS control system Anchor (plasmid) Bait Properties LITESEC-supp1 TMH-FLAG-iLID (pBAD) SspB_Nano-SctQ Suppression of T3SS-based protein LITESEC-supp2 TMH-FLAG-iLID (pACYC184) secretion upon illumination by membrane LITESEC-supp3 TMH-FLAG-iLID (pMMB67EH) sequestration of essential cytosolic T3SS component LITESEC-act1 TMH-FLAG-LOV2 (pBAD) Zdk1-SctQ Activation of T3SS-based protein LITESEC-act2 TMH-FLAG-LOV2.sub.V416L (pBAD) secretion upon illumination by release of LITESEC-act3 TMH-FLAG-LOV2.sub.V416L (pACYC184) essential cytosolic T3SS component LITESEC-act4 TMH-FLAG-LOV2.sub.V416L (pMMB67EH)
[0155] The Light-Dependent Export of Heterologous Substrates by the T3SS
[0156] The T3SS-dependent export of heterologous cargo has been shown and applied for many purposes in earlier studies (Ittig et al, 2015; Walker et al, 2017; Bai et al, 2018). To confirm that the export of heterologous proteins can be induced in the LITESEC strains, the LITESEC-supp2 system can be combined with a standard expression vector, such as pBAD, expressing a heterologous cargo protein, expressed with a short N-terminal secretion signal (for example with YopH.sub.1-17, the minimal secretion signal for the native Y. enterocolitica effector YopH, (Sory et al, 1995)) and a tag for detection, for example a C-terminal FLAG tag. The cargo protein can specifically be exported in the dark by the LITESEC-supp2 strain and can be detected in the medium, whereas export is light-independent in a wild-type strain.
[0157] In an alternative approach, we wanted to employ the LITESEC-act system to induce the injection of cargo proteins into eukaryotic host cells upon illumination. To this aim, we used ß-lactamase fused to the YopE1-53 secretion signal as a T3SS reporter substrate. Translocation of ß-lactamase can be visualized by the cleavage of a Förster resonance energy transfer (FRET) reporter substrate, CCF2, within host cells (Charpentier & Oswald, 2004; Marketon et al, 2005), which results in a green to blue shift in the emission wavelength. Bacteria were grown to allow for formation of the T3SS and were then incubated on ice under secretion-“off” conditions for several minutes. They were added to a semi-confluent layer of HEp2-cells and incubated under blue light or dark conditions for 60 minutes. To visualize effector translocation, CCF2 was added for 5 minutes, washed away and the cells were incubated for another 10 minutes, before they were fixed with 1% para-formaldehyde and analysed in a fluorescence microscope. As expected, a wild-type strain translocated the YopE1-53-ß-lactamase reporter substrate into a high fraction of host cells irrespective of the illumination. The negative control, the same strain expressing the ß-lactamase reporter without a secretion signal showed significantly lower translocation rates (
Discussion
[0158] Establishing an Optogenetic Interaction Switch in Yersinia enterocolitica
[0159] To overcome the lack of specificity and control of T3SS-dependent protein secretion and translocation into eukaryotic cells, it was aimed to control T3SS-based protein secretion by external light. Our system, LITESEC, is based on the sequestration of an essential dynamic T3SS component, for example SctQ, by an optogenetic interaction switch. In eukaryotic systems, proteins have been sequestered to various structures including the plasma membrane or mitochondria (Wang et al, 2016; Kawano et al, 2015; Zimmerman et al, 2016). The simpler cellular organization of bacteria makes the inner membrane a potential target for protein sequestration, to which interaction domains can be easily targeted to by the addition of N-terminal TMHs. As, to our knowledge, such a system had not been established in prokaryotes before, we first tested sequestration systems based on several optogenetic switches, the LOV, Magnet, and iLID systems (Wang et al, 2016; Kawano et al, 2015; Guntas et al, 2015), in Y. enterocolitica. In all cases, we expressed the larger of the two interacting proteins as a fusion to an optimized TMH, based on the N-terminal TMH of the E. coli TatA protein (De Leeuw et al, 2001), an integral component of the Tat export system (Palmer & Berks, 2012). We tested a range of anchor/bait combinations for the different optogenetic systems, either alone or fused to fluorescent reporter proteins (Table 2), and visualized their localization in live bacteria. The membrane anchors localized exclusively to the membrane and influenced the localization of the respective bait proteins (
[0160] Controlling Protein Secretion and Translocation by the T3SS with Light
[0161] In this study, we exploited the recently uncovered dynamic exchange of various essential T3SS components between an injectisome-bound state and a freely diffusing cytosolic state (Diepold et al, 2017, 2015), to control protein secretion by the T3SS by protein sequestration. By fusing SctQ, an essential and dynamic cytosolic component of the T3SS (Diepold et al, 2015) with one of bait protein of the optogenetic sequestration systems, and by expressing the other interaction domain fused to a membrane anchor in trans, we established strains where the activity of the T3SS is controlled by light. We termed the resulting system LITESEC-T3SS (Light-induced secretion of effectors through sequestration of endogenous components of the T3SS). Two different LITESEC systems can be applied in opposite directions: in the LITESEC-supp system, protein export is suppressed by blue light illumination, the LITESEC-act system secretion allows to activate secretion by blue light.
[0162] Of the two original systems, the LITESEC-supp1 system, which is based on the iLID optogenetic interaction switch (Guntas et al, 2015), showed a significant reaction to light (light/dark secretion ratio of 0.28; 24% vs. 85% of wild-type secretion under light and dark conditions, respectively;
[0163] For many applications, activation of T3SS protein export upon illumination is preferable. The LITESEC-act1 system, which is based on the LOV optogenetic interaction switch (Wang et al, 2016), only achieved weak activation of T3SS secretion upon illumination (
[0164] To explore the relation between the anchor/bait expression ratio and light control of the T3SS in more detail, we correlated the expression levels of anchor and bait proteins with the light-dependent activation of the system. The results indicate that anchor/bait ratios for the iLID-based LITESEC-supp system and for the LOV-based LITESEC-supp system allow an optimal response to blue light. Higher ratios retain partial membrane sequestration under conditions where the bait should be cytosolic and subsequently impair T3SS activity in the activated stage; conversely, low ratios lead to incomplete sequestration and measurable T3SS activity under non-activating conditions (
[0165] Both reaction time and recovery dynamics of the sequestration systems are crucial for their applicability to control the function of the T3SS. Fast reaction times to blue light increase the temporal precision of T3SS activation/deactivation, whereas the recovery times influence the effect of illumination on secretion. Very fast recovery means that the system has to be continuously illuminated for a sustained effect on secretion, while very slow recovery leads to long-term activation/deactivation that is difficult to revert, and renders handling of the cultures difficult due to possible long-term effects of illumination prior to the actual experiment. In time-course experiments we could show that in the LITESEC-supp system, unbinding of the bait in the light state was almost immediate, while recovery in the dark occurred within few minutes (
[0166] Light-Controlled Protein Translocation into Host Cells
[0167] The T3SS is a very promising tool for protein delivery into eukaryotic cells, both in cell culture and in healthcare (Ittig et al, 2015; Walker et al, 2017; Bai et al, 2018). However, the T3SS indiscriminately injects cargo proteins into contacting host cells (Pettersson et al, 1996). Lack of target specificity is therefore a main obstacle in the further development and application of this method (Walker et al, 2017; Feigner et al, 2017). Previous methods to control the activity of the T3SS relied on controlled expression of one or all components of the injectisome. For example, Song and colleagues expressed all components of the Salmonella SPI-1 T3SS from two inducible promoters in a clean expression system (Song et al, 2017), and Schulte et al. expressed the T3SS genes from a TetA promoter, which additionally allows the intracellular induction of the T3SS (Schulte et al, 2018). Besides the difficulty to specifically induce secretion in defined places in situ, the main drawback of these methods is the slow response (induction of expression and assembly of the T3SS take >60 min, (Diepold et al, 2010; Song et al, 2017; Schulte et al, 2018)), and the system remains active as long as it is in contact to a host cell, and the induced protein(s) are still present.
[0168] By using light to specifically activate the modified T3SS in bacteria at a site of choice, we have addressed this issue. The LITESEC system allows delivering proteins into host cells at a specific time and place. The system gives complete control over the secretion of heterologous T3SS cargo into the supernatant, either by providing illumination (LITESEC-act), or stopping the light exposure (LITESEC-supp). Importantly, secretion by the LITESEC-act system is temporary, and stopped within few minutes after the end of illumination with blue light, thereby further reducing unspecific activation.
[0169] A main application of the LITESEC system is the temporally and spatially controlled translocation of proteins into cultured eukaryotic cells (
[0170] A potential, relatively straightforward extension of our work would allow the specific protein delivery into diseased cells, such as cancer cells, within biological tissues. The T3SS has been used to treat cancer cells in vitro, e.g. by translocating angiogenic inhibitors (Shi et al, 2016), but again, the promiscuity of the T3SS and the resulting unspecific translocation at non-target sites represent a major obstacle in the further development of T3SS-based methods for clinical applications (Walker et al, 2017). Most current approaches rely on localized injection of bacteria or the natural tropism of bacteria to tumorous tissue. However, bacteria applied with these methods are not restricted to the target tissue, and unspecific activation presents a problem, especially for potentially powerful applications such as the delivery of pro-apoptotic proteins. By using light to specifically activate the modified T3SS in bacteria at a site of choice, delivery of effector proteins could be temporarily induced at a specific time and place. This method would reduce unspecific activation and side effects, allowing a highly controlled targeting of host cells. Bacteria could be applied to the patient (exploiting the natural tropism of bacteria for tumor tissue to achieve local enrichment in the case of cancer), where injection of the effector protein would be triggered in situ with high spatial and temporal precision using light delivered with the help of endoscopes and minimally-invasive surgery techniques. As the blue light used to control the current LITESEC systems does not penetrate tissue efficiently, activation by red or far-red light would be advantageous. Several such red-light systems have been characterized (Shimizu-Sato et al, 2002; Reichhart et al, 2016; Kaberniuk et al, 2016); however, all these systems require cofactors not usually present in bacteria.
[0171] The successful development and application of the LITESEC system highlights some key features for the control of prokaryotic processes by optogenetic interaction switches. The target protein (in our case the essential T3SS component SctQ) (i) has to be functional as a fusion protein to an optogenetic interaction domain, (ii) must be present in the cytosol at least temporarily to allow sequestration to occur, and (iii) may not be functional when tethered to the anchor protein. To fulfil the last criterion, the target protein may feature a) a specific place of action (such as the injectisome for SctQ in the present case), or b) a specific interaction interface that is made inaccessible by the interaction with the anchor. In case b), the anchor protein does not necessarily need a specific localization. Otherwise, the IM is the most promising, if not the only suitable place to target a sufficient number of anchor proteins to within most bacteria. While the nature of the TMH is likely to be secondary for the success of the application, the extended TatA TMH and the short glycine-rich linker worked well for our approach.
[0172] Crucially, we found that the expression ratio between anchor and bait proteins is a crucial determinant for the success of LITESEC and, most, likely, similar approaches to control bacterial processes by light.
[0173] The LITESEC system presented in this work uses light-controlled sequestration of an essential dynamic T3SS component to precisely regulate the activity of the T3SS. This approach provides a new method for highly time- and space-resolved protein secretion and delivery into eukaryotic cells.
[0174] Kinetics of LITESEC Activation and Deactivation
[0175] Both reaction time and recovery dynamics of the sequestration systems are crucial for their applicability to control the function of the T3SS. Fast reaction times to blue light increase the temporal precision of T3SS activation/deactivation, whereas the recovery times influence the duration of the effect on secretion after illumination. Very fast recovery means that the system has to be continuously illuminated for a sustained effect on secretion, while very slow recovery leads to long-term activation/deactivation that is difficult to revert, and renders handling of the cultures difficult due to possible long-term effects of illumination prior to the actual experiment. In time-course experiments we could show that in the iLID-based protein sequestration system, unbinding of the bait in the light state was almost immediate, and that recovery in the dark occurred within few minutes (
[0176] Applications of the Optogenetic Switch Technology:
[0177] 1. Protein Translocation into Unmodified Eukaryotic Cells in Cell Culture with High Temporal and Spatial Resolution.
[0178] Cell cultures play an important role in development, research and, increasingly, healthcare. Often, specific proteins need to be expressed in all or a subset of the cultured cells at a given time point. At the moment, this is mainly done by inducing expression of the target protein within the host cells. This method requires prior transfection of the host cells with the target gene or time-consuming creation of stable transgenic cell lines. Induction of expression itself is relatively slow, and difficult to apply to a certain subset of cells.
[0179] Our method allows translocating proteins into unmodified host cells with high specificity. Bacteria that lack their native virulence effectors, but express one or more cargo proteins with a short secretion signal, are brought into contact with host cells. The chosen subset of host cells is then subjected to darkness or blue light (which does not influence bacteria or host cells at the used intensity), which temporarily induces translocation of the cargo into the host cells within short time. An additional advantage of our method is that it directly translocates proteins into the host cell, rather than inducing the transcription of mRNA, as is the case in the current inducible transfection systems. The amount of translocated protein can be regulated by the duration of illumination/darkness, and the multiplicity of infection (ratio of bacteria/host cells) (Ittig et al, 2015).
[0180] 2. Therapeutic Protein Delivery into Diseased Cells
[0181] Specific protein delivery into diseased cells, such as cancer cells, is one of the main targets for treating important diseases. The T3SS has been used to treat cancer cells in vitro, e.g. by translocating angiogenic inhibitors (Shi et al, 2016). A major obstacle in the further development of T3SS-based methods for clinical applications is the promiscuity of the T3SS (Walker et al, 2017). Most current approaches rely on localized injection of bacteria or the natural tropism of bacteria to tumorous tissue. However, bacteria applied with these methods are not restricted to the target tissue, and unspecific activation is an obstacle, especially for potentially powerful applications such as the delivery of pro-apoptotic proteins.
[0182] By using light to specifically activate the modified T3SS in bacteria at a site of choice, delivery of effector proteins could be temporarily induced at a specific time and place. This method reduces unspecific activation and side effects, allowing a highly controlled targeting of host cells. Bacteria could be applied to the patient (exploiting the natural tumor tropism of bacteria for tumor tissue in the case of cancer treatment to achieve an enrichment at the tumor site in the case of cancer), where injection of the effector protein would be triggered in situ with high spatial and temporal precision using light delivered with the help of endoscopes and minimally-invasive surgery techniques.
[0183] A main challenge for the in situ application of T3SS-based protein delivery with our LITESEC system is the wavelength of the activating light. The blue light used to control the LITESEC system does not penetrate tissue efficiently, and activation by red or far-red light would be advantageous.
[0184] In summary, a main application of the LITESEC system is the temporally and spatially controlled translocation of proteins into cultured eukaryotic cells (
[0185] A potential, relatively straightforward extension of our work would allow the specific protein delivery into diseased cells, such as cancer cells, within biological tissues. The T3SS has been used to treat cancer cells in vitro, e.g. by translocating angiogenic inhibitors (Shi et al, 2016), but again, the promiscuity of the T3SS and the resulting unspecific translocation at non-target sites represent a major obstacle in the further development of T3SS-based methods for clinical applications (Walker et al, 2017). Most current approaches rely on localized injection of bacteria or the natural tropism of bacteria to tumorous tissue. However, bacteria applied with these methods are not restricted to the target tissue, and unspecific activation presents a problem, especially for potentially powerful applications such as the delivery of pro-apoptotic proteins. By using light to specifically activate the modified T3SS in bacteria at a site of choice, delivery of effector proteins could be temporarily induced at a specific time and place. This method would reduce unspecific activation and side effects, allowing a highly controlled targeting of host cells. Bacteria could be applied to the patient (exploiting the natural tropism of bacteria for tumor tissue to achieve local enrichment in the case of cancer), where injection of the effector protein would be triggered in situ with high spatial and temporal precision using light delivered with the help of endoscopes and minimally-invasive surgery techniques. As the blue light used to control the current LITESEC systems does not penetrate tissue efficiently, activation by red or far-red light would be advantageous. Several such red-light systems have been characterized (Shimizu-Sato et al, 2002; Reichhart et al, 2016; Kaberniuk et al, 2016); however, all these systems require cofactors not usually present in bacteria.
[0186] Generic Description of Optogenetic Switch in Red or Far-Red Light.
[0187] Several such systems have been characterized (Shimizu-Sato et al, 2002; Reichhart et al, 2016; Kaberniuk et al, 2016), which require cofactors not usually present in bacteria. One example is the Phy-PIF system: [0188] light-controllable binding interaction between two genetically encoded components: [0189] a fragment of Arabidopsis thaliana phytochrome B (Phy) (anchor) [0190] consisting of residues 1-908 of the A. thaliana PhyB protein (Entrez Gene ID: 816394) [0191] maybe think about codon optimization (was expressed without codon optimization in yeast but codon optimization is said to increase expression ratio (Toettcher et al., 2011b))-Phy—PIF recruitment is easiest to observe if Phy expression levels are high [0192] Phy fusion protein expression and function is particularly sensitive to linker lengths and component orientation. Phy appears to work most robustly as an N-terminal fusion component (Phy-TMH) [0193] Best working linker: EFDSAGSAGSAGGSS between the C-terminus of Phy and the N-terminus of downstream fusion constructs [0194] and a fragment of phytochrome interaction factor 6 (PIF) (bait) [0195] consisting of residues 1-100 of A. thaliana PIF6 protein [0196] does not exhibit any preference toward N or C terminal fusions and also tolerates fusions on both termini simultaneously Source for constructs: https://www.addgene.org/browse/gene/816394/ [0197] membrane-permeable small molecule chromophore, phycocyanobilin (PCB) is needed for light-induced interaction [0198] in most references, PCB was just added to the cultivation media [0199] PCB synthesis could also be integrated inside the cells: two-plasmid system, one expressing an apophytochrome and the other expressing a dual gene operon containing a heme oxygenase and a bilin reductase is needed (Gambetta and Lagarias, 2001) [0200] Exposure to 650 nm induces association of PIF and Phy, while exposure to 750 nm light induces dissociation of PIF from Phy [0201] Note: two pairs are used: PhyB (1-621)+PIF3 (good for control of gene expression—more sensitive—activation also in room light)/PhyB (1-908)+PIF6 (better for protein localization control, not that sensitive—nearly no activation with normal room light) (Pathak et al., 2014) [0202] “Phy can be reversibly switched between PIF-interacting and—non-interacting states using light within seconds, and switching can be performed for hundreds of cycles without toxicity to the cell or any measurable degradation of the system's performance”—(Toettcher et al., 2011b)
[0203] Material and Methods
[0204] Plasmids and strains used in this study are listed in Table 6 and Table 7, respectively. Additional methods and materials are listed in “supplementary methods and materials”.
[0205] Cultivation of Bacteria
[0206] All Y. enterocolitica strains were cultivated in BHI media (3.7% w/v) (Brain Heart Infusion Broth—VWR Chemicals). To this medium nalidixic acid (NAL) (35 μg/ml) and 2,6-diaminopimelic acid (DAP) (60 μg/ml) were always added, because the used Yersinia strains are auxotrophic for DAP and have a genome encoded resistance against NAL. All E. coli strains were cultivated in LB media (tryptone (10% w/v), yeast extract (5% w/v), NaCl (10% w/v)—CARL ROTH GmbH & CO KG (Karlsruhe, Germany)). If necessary, further antibiotics Ampicillin (Amp) (200 μg/ml) (for plates, the more stable form Carbenicillin (Carb) was used), Chloramphenicol (Cam) (25 μg/ml), Streptomycin (Sm) (50 μg/ml) depending on the integrated plasmids were added to the cultivation media. For an overnight culture, 2-5 ml of cultivation media with corresponding antibiotics were inoculated with a specific strain from the glycerol stock strain collection and were cultivated overnight at 28° C. (Y. enterocolitica) or 37° C. (E. coli) in a shaking incubator. For cultivation plates, 15% w/v Agar (Becton, Dickinson and Company (New Jersey, USA)) was added to the media.
[0207] T3SS In Vitro Secretion Assay
[0208] From a stationary n overnight culture of strains that were planned to be examined, 100 μl (for non-secreting conditions) or 120 μl (for secreting conditions) were inoculated in corresponding media (1:50 dilution for non-secreting conditions, 1:41.67 for secreting conditions). The cultivation media contains BHI (3.7% w/v), NAL (35 μg/ml), DAP (50 μg/ml), MgCl.sub.2 (20 mM), glycerol (0.4% w/v) and corresponding antibiotics. For non-secreting conditions CaCl.sub.2) (5 mM) and for secreting conditions EGTA (5 mM) was added. The cultures were cultivated for 90 min at 28° C. and then shifted to a 37° C. water bath and inoculated for 2-3 h (if the strain contained an inducible plasmid, the plasmid was induced with 0.2% w/v L-arabinose before shifting to 37° C.).
[0209] Fluorescence Microscopy
[0210] For fluorescence microscopy, strains that were planned to be examined were cultivated as described above under non-secreting conditions. 2 ml of cell culture then was spun down for 4 min at 2.400 relative centrifugal force (rcf) and the cell pellet was resuspended in 400 μl of minimal media (HEPES (100 mM), (NH.sub.4).sub.2SO.sub.4 (5 mM), NaCl (100 mM), sodium glutamate (20 mM), MgCl.sub.2 (10 mM), K.sub.2SO.sub.4 (5 mM), casamino acids (0.5% w/v)) including DAP (60 μg/ml). From this culture, 2 μl was given on prepared agar slides (1.5% w/v agarose in minimal media, heated up in microwave, 80-100 μl then put on a microscope slide with cavities (Marienfeld GmbH & Co. KG (Königshofen, Germany)) and topped with a cover slip (25 mm ø).
[0211] On the coverslip then a drop of microscopy oil (Cargille Laboratories, Inc. (Cedar Grove, USA)) (1.514 for GFP pictures, 1.522 for mCherry pictures) was added. Samples were observed with an inverse fluorescence microscope. Unless stated differently, exposure times were 500 ms for mCherry fluorescence, using a mCherry filter set, and 200 ms for GFP fluorescence, using a GFP filter set. In dual color imaging experiments, mCherry fluorescence was excited and recorded before GFP fluorescence to minimize photo bleaching of mCherry. Per image, a z stack containing 7 to 15 frames per wavelength with a spacing of 150 nm was acquired.
[0212] Optogenetic Cell Cultivation For optogenetic experiments the strains for cell fixation or secretion assays (to determine the amount of secreted proteins) were cultivated under the presence of blue light. They were cultivated under secreting conditions as described in before but after shift to 37° C. for 5 min-1.5 h in the water bath, the cultures were cultivated at 37° C. for 1-3 h in an optogenetic experimental setup (
[0213] Infection Assay
[0214] The infection assay was adapted from (Wolters et al, 2015). 200 μl of bacterial overnight culture were inoculated in BHI supplemented with DAP (50 μg/ml), MgCl2 (20 mM), and glycerol (0.4% w/v). Expression of the cargo protein from the pBAD plasmid was induced with 0.2% arabinose (w/v), unless stated differently. The cultures were incubated for 90 min at 37° C. under activating conditions (dark for LITESEC-supp/light for LITESEC-act) to induce T3SS formation. After incubation, cultures were centrifuged for 4 min at 4.500 g and 4° C. Cells were then resuspended in ice-cold PBS containing 50 μg/ml DAP at a density of ˜2.5×108 cfu/ml.
[0215] HEp-2 cells were cultivated and preserved at 37° C. and 5% atmospheric CO2.
[0216] Bacteria were grown to allow for formation of the T3SS and were then incubated on ice under secretion-“off” conditions for several minutes. They were added to a semi-confluent layer of HEp2-cells and incubated under blue light or dark conditions for 60 minutes. To visualize effector translocation, CCF2 was added for 5 minutes, washed away and the cells were incubated for another 10 minutes, before they were fixed with 1% paraformaldehyde and analyzed in a fluorescence microscope.
TABLE-US-00006 TABLE 6 Strains Yersinia enterocolitica strains that were created and/or used during this work. Strain Name Genotype background Comments/Reference dHOPEMTasd pYV40 yopO.sub.Δ2-427 yopE.sub.21 yopH.sub.Δ1-352 (Kudryashev et al, 2013) yopM.sub.23 yopP.sub.23 yopT.sub.135 Δasd AD4324 mCherry-SctQ dHOPEMTasd (Diepold et al, 2015) AD4419 ΔSctQ dHOPEMTasd (Diepold et al, 2015) FL02 Zdk1-mCherry-SctQ dHOPEMTasd pFL115 ×* dHOPEMTasd FL03 Zdk1-SctQ, mCherry-SctL dHOPEMTasd pAD612 ×* ADTM4521 FL04 SspB_Nano-mCherry-SctQ dHOPEMTasd pFL117 ×* dHOPEMTasd FL05 SspB_Nano-SctQ, mCherry-SctL dHOPEMTasd pFL118 ×* ADTM4521 FL09 Zdk1-mCherry-SctQ, ΔSctN dHOPEMTasd pAD168 ×* FL02 FL10 SspB_Nano-mCherry-SctQ, ΔSctN dHOPEMTasd pAD168 ×* FL04 FL11 Zdk1-SctQ, mCherry-SctL, ΔSctN dHOPEMTasd pAD168 ×* FL03 FL12 SspB_Nano-SctQ mCherry-SctL, ΔSctN dHOPEMTasd pAD168 ×* FL05 *× = homologous recombination between mutator plasmid and host strain, recombination leads to an allelic exchange of the native gene and the mutated gene (Kaniga et al, 1991).
TABLE-US-00007 TABLE 7 Plasmids Plasmids with corresponding properties that were designed and/or used in this work. Name Restriction Primer used for Template (Reference) Genotype enzymes Resist. Insert-PCR for Insert System pFL100 pBAD::TMH-FLAG-(L1)- NcoI, Amp AD638/704/705 p81041** LOV mCherry-(L2)-LOV2 EcoRI pFL101 pACYC184::Zdk1-(L4)-EGFP BamHI, Cam AD698/699/700/701 P81010**/pAD301 LOV SalI pFL102 pBAD::TMH-FLAG-(L1)- NcoI*, Amp AD638/706/707/708/642 p67297**/pAD304 Magnet mCherry-(L3)-pMAGFast2 (2x) EcoRI pFL103 pACYC184::nMAGHigh1-(L4)- EcoRV, Cam AD702/703 p67300** Magnet EGFP BamHI pFL104 pACYC184::Zdk1-(L4)-mCherry BamHI, Cam AD638/699/721/722 p81010**/pAD304 LOV SalI pFL106 pACYC184::nMAGHigh1-(L4)- EcoRV, Cam AD702/721/723/724 p67300**/pAD304 Magnet mCherry EagI pFL107 pBAD::TMH-FLAG-(L1)- NcoI*, Amp AD638/706/707/732/733 p60408**/pAD304 iLID mCherry-(L3)-iLID EcoRI pFL108 pBAD::TMH-FLAG-(L1)-iLID NcoI, Amp AD638/733/734 p60408** iLID EcoRI pFL109 pACYC184::SspB_Nano-(L4)- BamHI, Cam AD721/722/735/736 p60409**/pAD304 iLID mCherry SalI pFL111 pBAD::Zdk1-(L4)-mCherry BgIII, Amp AD759/768 pFL104 LOV EcoRI pFL113 pBAD::SspB_Nano-(L4)-mCherry BgIII, Amp AD762/768 pFL109 iLID EcoRI pFL114 pBAD::SspB_Nano BgIII, Amp AD762/769 pFL109 iLID EcoRI pFL115 pKNG101::Zdk1-(L4)-mCherry- BgIII, Sm **** pFL111 LOV SctQ MfeI*** pFL117 pKNG101::SspB_Nano-(L4)- BgIII, Sm **** pFL113 iLID mCherry-SctQ MfeI*** pFL118 pKNG101::SspB_Nano-SctQ BgIII, Sm **** pFL114 iLID MfeI*** pFL126 pACYC184::TMH-FLAG-(L1)- BamHI***** Cam AD921/903 pAD610 LOV LOV2 (V416L) SalI pFL127 pACYC184::TMH-FLAG-(L1)- BamHI***** Cam AD921/904 pFL108 iLID iLID SalI pFL31****** pMMB67EH::TMH-FLAG-(L1)- BamHI***** Gm AD921/903 pFL126 LOV LOV(V416L) SalI pFL132****** pMMB67EH::TMH-FLAG-(L1)- Bam HI***** Gm AD921/904 pFL127 iLID iLID SalI pFL133 pBAD::YopE1-53-Nanoluc-FLAG pAD681 pFL135 pMMB67EH::RBS-YopE1-53-bla AD986/967 pBMD040 pAD168 pKNG101::ΔSctN Sm (Diepold et al., 2010) pAD304 pUC19-mCherry Amp (Diepold et al, 2015) pAD608 pBAD::TMH-FLAG-(L1)-LOV2 NcoI*, Amp AD638/639/640 p81041** LOV EcoRI pAD610 pBAD::TMH-FLAG-(L1)- NcoI*, Amp LOV LOV2(V416L) EcoRI pAD612 pKNG101::Zdk1-SctQ BgIII, Sm **** pAD611 LOV MfeI*** pAD614 pBAD::TMH-FLAG-(L1)- NcoI*, Amp AD638/641/642 p67297** Magnet pMAGFast2(2x) EcoRI pBMD028 pBAD::YopE1-53 Amp AD894/895 pYV pBMD040 pBAD::YopE1-53-□-lactamase Amp **** pNL1.1 (Promega)/pBMD028 Plasmids with corresponding properties that were designed and/or used in this work. Anchor proteins were targeted to the bacterial IM by addition of an optimized TMH based on the N-terminal TMH of the Escherichia coli TatA protein (De Leeuw et al, 2001), an integral component of the Tat export system (Palmer & Berks, 2012). A high expression ratio of the anchor to bait protein was reported to be a prerequisite for complete binding of the bait to the anchor (Kawano et al, 2015). We therefore expressed the membrane anchor constructs from the inducible medium-high copy expression vector pBAD-His/B, and the cytosolic bait fusions from a compatible low copy constitutive expression vector, pACYC184. * Insert was digested with BsaI instead of NcoI ** Addgene code *** Insert was digested with EcoRI instead of MfeI **** Insert was cut out of pre-mutator and ligated to mutator-vector ***** Insert was digested with BgIII instead of BamHI ****** pMMB67EH-MA was designed without promotor region L1—GAGG linker (SEQ ID NO: 7) L2—GSGS linker (SEQ ID NO: 8) L3—GAGGGAGG linker (SEQ ID NO: 9) L4—GGSGGSGG linker (SEQ ID NO: 10)
[0217] Supplementary Methods and Materials
[0218] Plasmid Construction
[0219] All plasmids that were designed and made in this work are listed in Table 4. Primer that were designed and used for PCR of the plasmid-specific inserts are listed in Table S1.
[0220] PCR products were purified by using a purification kit or by gel electrophoresis (1:6 6× loading dye (Bromphenol blue (0.25% w/v), Xylene cyanol FF (0.25% w/v), Glycerol (30% w/v) in PCR reaction mix, load on an agarose gel (1% w/v Agarose, 1×TAE buffer (TRIS-acetate (40 mM), EDTA (1 mM), pH=8.3), EtBr (0.05% w/v))— settings: 135 V, 500 mA, 30 min) and following gel extraction of the band of correct size that was cut out.
[0221] Purified PCR products and corresponding vector were digested with corresponding restriction enzymes and settings (shown on NEB cloner) depending on the used enzymes (usually 1 h at 37° C. and specific restriction buffer). The digested vector was treated with Antarctic Phosphatase (2% w/v) (plus 10× phosphatase buffer—10% w/v) (New England Biolabs GmbH (Frankfurt am Main, Germany)) that dephosphorylates the 5′ and 3′ ends and impede self-religation of the vector (Rina et al, 2000). The digestion then was purified by gel electrophoresis and gel extraction.
[0222] The digested PCR insert and vector were then ligated in a ligation mix (total volume 15 μl) that contains H.sub.2O (15 μl-x), digested vector (100 ng), digested insert (3:1 molar ratio to vector), “10× T4 DNA Ligase buffer” (10% w/v) and “T4 DNA Ligase” (5% w/v) (New England Biolabs GmbH (Frankfurt am Main, Germany). The ligation mix was incubated for 1 h at room temperature (RT).
[0223] Colonies that were grown on the transformation plates were verified with a colony PCR. 20 μl of the PCR reaction mix was used for each reaction tube. Usually 12 to 24 colonies were picked with a sterile pipette tip, transferred first to a well labelled master plate and afterwards to the reaction tube.
[0224] PCR was performed as described but with 10 min in the first 98° C. step (to lyse the cells). 5 μl of PCR product then was loaded on an agarose gel and verified by gel electrophoresis.
TABLE-US-00008 TABLE S1 Primers List of primers that were designed and/or used in this work. Restriction sites are shown in red, linkers are shown in blue, start and stop sequences are shown in purple. SEQ ID Primer NO Sequence from 5′ to 3′ AD321_SctQ_1fwd 11 GACTGGGCCCCTTACCTGAATTGGGGGCTA AD324_SctQ_2rev 12 GACTTCTAGAAGAGAATGGAGCCCCTAGTAAG AD339_pBAD_seq_fwd 13 ATGCCATAGCATTTTTATCC AD340_pBAD_seq_rev 14 GCGTTCTGATTTAATCTGTATCAGG AD341_pKNG_seq_fwd 15 TATTAATTGATCTGCATCAACTTAACG AD342_pKNG_seq_rev 16 GACTATACTAGTATACTCCGTCTACTGTACG AD638_ext_TatA_TMH_f 17 GGTCTCCCATGGGTGGTATCAGTAGGCAGTT ATTGATTATTGCCGTCATCGTTGTACTGCTTGTCC TAGGCACCAAAAAGCTCGGCTCCGACTACAA GGACGACGATGATAAGGGTGGAGCAGGT AD639_int_LOV2_f 18 GACTACAAGGACGACGATGATAAGGGTGGAGCA GGTGGATCCTTGGCTACTACACTTGA AD640_LOV2_r 19 GACTGAATTCGCAAGCTTTTAAAGTTCTTTTG AD642_MAG_r 20 GACTGAATTCTTACTCAGTCTCGCACTGAAACC AD698_Zdk1- 21 GACTGGATCCTTGACTGAATGGTGGATAACAAAT EGFP_1fw TCAATAAAGAAAAGA AD699_Zdk1- 22 ACCACCAGAGCCGCCCGACCCACCAGAACCACC EGFP_1rv TTTTGGGGCCT AD700_Zdk1- 23 GGTGGGTCGGGCGGCTCTGGTGGTGGTGCTGG EGFP_2fw CGTGAGCAAG AD701_Zdk1- 24 GATCGTCGACTTACTTGTACAGCTCGTCCATGC EGFP_2rv AD702_nMagHigh1- 25 GACTGATATCTGACTGAATGGGACACACTCTTTA EGFP_fw CGCCC AD703_nMagHigh1- 26 GCTAGGATCCCTAGTACAGCTCGTCCATTCCGA EGFP_rev AD704_mCh- 27 GACGATGATAAGGGTGGAGCAGGTGTGAGCAAG LOV2_int_fw GGCGAGGAG AD705_mCh- 28 GACTGAATTCGCAAGCTTTTAAAGTTCTTTTG LOV2_rev AD706_pMAGF2- 29 GACGATGATAAGGGTGGAGCAGGTGTGAGCAAG mCh_int_1fw GGCGAGGAG AD707_pMAGF2- 30 TCCACCTGCTCCACCACCAGCGCCCTTGTACAG mCh_1rv AD708_pMAGF2- 31 GGCGCTGGTGGTGGAGCAGGTGGACACACTCTT mCh_2fw TACGCCCCTGG AD717_pACYC184_fw 32 CAGGCACCGTGTATGAAATC AD718_pACYC184_rev 33 GAGCCCGATCTTCCCCATC AD719_pACYC184_rev_Sall 34 GTCCTCGCCGAAAATGACC AD720_pFL103_seq 35 CTTACGGAAAGCTGACCCTG AD721_mCh_fwd 36 GGTGGGTCGGGCGGCTCTGGTGGTGTGAGCAAG GGCGAGGAG AD722_mCh_rev 37 GATCGTCGACTTACTTGTACAGCTCGTCCATGC AD723_nMagHigh1_rev2 38 ACCACCAGAGCCGCCCGACCCACCTTCGGTTTC GCACTGGAAT AD724_mCh_rev_Eagl 39 GATCCGGCCGTTACTTGTACAGCTCGTCCATGC AD732_ILID_mCh_2fw 40 GGCGCTGGTGGTGGAGCAGGTGGAGGATCCGG GGAGTTTCTGG AD733_ILID_mCh_2rev 41 GACTGAATTCTCAGCTAATTAAGCTTTTAAAAGT AD734_ILID_fw 42 GACGATGATAAGGGTGGAGCAGGTGGATCCGGG GAGCTGG AD735_SspB_Nano_fw 43 GACTGGATCCTTGACTGAATGAGCTCCCCGAAAC GCCC AD736_SspB 44 ACCACCAGAGCCGCCCGACCCACCACCAATATTC Nano_rev AGCTCGTCAT AD737_pACYC184_rev_Eagl 45 CCGGAAGCGAGAAGAATCATA AD759_Zdk1_premut_fwd 46 GACTAGATCTGGCGCAGGTGTGGATAACAAATTC AATAAAGAAAAGA AD762_SspB_premut_fwd 47 GACTAGATCTGGCGCAGGTAGCTCCCCGAAACG CCCTAA AD768_mCh_premut_rev_EcoRI 48 GACTGAATTCACCTGCGCCCTTGTACAGCTCGTC SCATGC AD769_SspB_premut_rev_EcoRI 49 GACTGAATTCACCTGCGCCACCAATATTCAGCTC GTCATAGA AD894_YopE1- 50 GATCTCATGAAAATATCATCATTTATTTCTACATCA 53_pro-apop_fwd CTGC AD895_YopE1- 51 GATCGAATTCGCGCAGATCTTCCGCCGGAACCCT 53_pro-apop_rev GAGGGCCAGTGC AD903_MA_LOV2_pACYC184_rev 52 GACTGTCGACGCAAGCTTTTAAAGTTCTTTTG AD904_MA_iLID_pACYC184_rev 53 GACTGTCGACTCAGCTAATTAAGCTTTTAAAAGT AD921_MA_pACYC_fw_new 54 GACTAGATCTTTGACTGAATGGGTGGTATCAGTA TTTGGC AD933_YopH1- 55 GACTTCATGAACTTATCATTAAGCGATCTTCATCG 17-BgIII- TCAGGTATCTCGATTGGTGCAGGGAGGTAGATCT NanoLuc_fw GGCGCAGGTGTCTTCACACTCGAAGACGTT AD934_NanoLuc- 56 GACTAAGCTTTTAGAATTCGCCTGCACCCTTATCA Flag-EcoRI- TCGTCGTCCTTGTAGTCACCTCCCGCCAGAATGC stop_rv GTTCGCA
[0225] Transformation of Escherichia coli and Yersinia enterocolitica
[0226] Transformation of E. coli was either performed with Top10 (strain for plasmid propagation) or with Sm10 λpir.sup.+ (strain that contains pir gene for pKNG101 propagation-pKNG101 can only replicate if π is provided in trans (as in the E. coli Sm10λpir.sup.+ strain) or if it integrates into the host chromosome (or pYV plasmid in Yersinia) (Kaniga et al, 1991)—used for 2-Step homologous recombination). For transformation of chemical competent E. coli (were made competent with TSS buffer (tryptone (1% w/v), yeast extract (0.5% w/v), NaCl (1% w/v), PEG 3350 (10% w/v), DMSO (5% w/v), MgCl.sub.2 (50 mM), pH=6.5—protocol adapted from (Chung & Miller, 1993)), 15 μl of ligation mix was added to the defrosted E. coli cells and incubated on ice for at least 30 min. The cells were then heat shocked for 1 min at 42° C. water bath, incubated for 1 min on ice and were resuspended in 800 μl LB and incubated for 1 h at 37° C. shaker (800 rpm). After incubation, the cells were spun down for 2 min and 8.000 rcf and resuspended in 50 μl remaining supernatant—the rest was discarded. 20 μl were plated on LB-plates with corresponding antibiotics and incubated at 37° C. o/n.
[0227] Transformation of Y. enterocolitica was performed with dHOPEMTasd. For transformation of electro competent Y. enterocolitica, 1-2 μl of miniprep plasmid DNA was added to the defrosted Y. enterocolitica cells and incubated on ice for at least 15 min. The cells were then transferred into pre-cooled electroporation cuvettes and electroporated with a micropulser and the setting Ec2 (2.5 kV). Directly afterwards, cells were resuspended in 800 μl BHI+DAP (60 μg/ml) and transferred into new tubes. After incubating for 2 h at 28° C. shaker (700 rpm) the cells were spun down for 2 min and 8.000 rcf and resuspended in 50 μl of remaining supernatant—the rest was discarded. 50 μl were plated on BHI+NAL+DAP+corresponding antibiotics and incubated at 28° C. for 2-3 days.
[0228] Strain Construction by Allelic Exchange
[0229] For allelic exchange by two-step homologous recombination, an o/n culture (2.5 ml of media+corresponding ingredients) of the acceptor strain (Yersinia) and the mutator strain (E. coli— SM10λpir.sup.+) were grown. 1 ml of o/n culture was spun down for 2 min at 10.000 rcf, the pellet was resuspended in 1 ml LB+DAP and spun down again. The pellet then was resuspended in 100 μl LB+DAP and 20 μl of the acceptor strain and the mutator strain were mixed in a sterile Eppendorf tube. 20 μl of the mix was spotted on a LB+DAP plate and incubated at 28° C. for 4 h. After incubation, the grown spot was scratched and resuspended in 1 ml LB+DAP. 20 μl of the resuspended bacteria were plated on a LB+DAP+Nal+Sm (Sm selects for the first recombination step—integration of the mutator plasmid “PKNG101+Mutation” with a Sm-resistance into the pYV plasmid of Yersinia (Kaniga et al, 1991)). Then they were incubated for 2-3 days at 28° C. From single grown colonies, 6-8 were inoculated in 2.5 ml of BHI+Nal+DAP+Sm and cultivated o/n at 28° C. on a shaker. 1.5 μl of the o/n culture were transferred into fresh tubes containing 2.5 ml of BHI+Nal+DAP and cultures were grown for at least 8 h at 28° C. on a shaker (media is without Sm to initiate the second recombination step—the removal of the mutator plasmid (Kaniga et al, 1991)). After 8 h of incubation, 1.5 μl of culture were transferred into new tubes containing fresh 2.5 ml BHI+Nal+DAP and incubated o/n at 28° C. on a shaker. 20 μl of a 1:10 dilution of the o/n culture were plated on BHI+Nal+DAP+sucrose (8% w/v) (sucrose selects for the absence of the mutator plasmid (Kaniga et al, 1991)) and incubated o/n at 28° C. The next day, a colony PCR was performed on single colonies to check for site directed mutagenesis.
[0230] Analysis of Protein Expression and Secretion Activity
[0231] After induction of T3SS (4.3) 2 ml of bacteria culture was spun down for 10 min at 4° C. and 12.000 rcf while measuring the OD.sub.600 of the cell cultures to use for later calculations. For visualization of secreted proteins, 1.8 ml of the supernatant was mixed with 200 μl TCA (TCA is used for protein precipitation (Link & LaBaer, 2011)). After centrifugation for 15 min at 4° C. and 20.000 rcf, the protein pellet was washed twice with 900 μl ice-cold acetone and spin down for 5 min at 4° C. and max. speed inbetween and then could be used for further analysis. If the expressed T3SS proteins wanted to be quantified, the total cell pellet without supernatant was used for further analysis. For normalization of cell density, the pellet then was resuspended in calculated amount of 1× sample buffer (SDS (2% w/v), Tris (0.1 M), glycerol (10% w/v), DTT (0.05 M, pH=6.8).
[0232] After heating the sample for 5 min at 99° C., 15 μl were loaded on an SDS-gel and run for 45-90 min at 130 V and 40 mA. The SDS-gel was then stained with staining solution for an optional time length (depends on how strong the colorizing effect should be) or used for western blot.
[0233] The SDS-gel was blotted on a nitrocellulose membrane using a Blot Transfer-system with the settings: 1.3 A, 25 V, 7 min. After blotting, the membrane was put in 15 ml milk solution (5% w/v nonfat dried milk powder (PanReac AppliChem ITW Reagents (Darmstadt, Germany)) in 1×PBS (NaCl (137 mM), KCl (2.7 mM), Na.sub.2HPO.sub.4 (10 mM), KH.sub.2PO.sub.4 (2 mM), pH=7.4)) and incubated o/n at 4° C. on a shaker. The blot was washed once with 1×PBS and then incubated with the first antibody (diluted in milk solution (5% w/v)) for 1 h at RT on a shaker.
[0234] Then the blot was washed 1× with 1×PBS, 1× with 1×PBS-T (1×PBS+Tween 20 (0.2% w/v)), 1× with 1×PBS (washing steps always were performed for 1 min). After washing, the blot was incubated with the second antibody (diluted in milk solution (5% w/v)) for 1 h at RT on a shaker. Then the blot was washed again 1× with 1×PBS, 4× with 1×PBS-T, 1× with 1×PBS. After removing the 1×PBS buffer, 800 μl of detection reagent (“Luminata™ Forte Western HRP Substrate”— MERCK (Darmstadt, Germany)) was added to the blot and spread evenly with a Drigalski spatula. Pictures of the blot were taken with a Luminescent Image Analyzer.
[0235] Cell Fixation
[0236] Cell fixation was performed after optogenetic cell cultivation. “Blue light” samples were incubated and handled under blue light, “dark” samples were incubated in the dark and handled under red light to avoid activation of the optogenetic system. 300 μl of bacterial culture were transferred in a tube containing 100 μl PFA (16% w/v PFA in 1×PBS) and were incubated for 10-15 min. Cells were spun down for 4 min at 2.400 rcf and the pellet was washed afterwards 1× with Glycine (2% w/v in 1×PBS) and 1× with 1×PBS. After fixation, cells could be stored at 4° for several days and used for fluorescence microscopy.
[0237] Chemicals and Online Tools
[0238] Chemicals that were used for buffers or cultivation media were purchased from CARL ROTH GmbH & CO KG (Karlsruhe, Germany), SIGMA-ALDRICH (Steinheim, Germany), VWR Chemicals (Darmstadt, Germany) and Becton, Dickinson and Company (New Jersey, USA). All buffers, dNTP's, restriction enzymes and polymerases were purchased from THERMO FISHER SCIENTIFIC (Schwerte, Germany), CARL ROTH GmbH & CO KG (Karlsruhe, Germany) and New England Biolabs GmbH (Frankfurt am Main, Germany). For gel electrophoresis a “Quick-Load® Purple 2-Log DNA Ladder” (New England Biolabs GmbH) was used. For SDS-PAGE “Mini-PROTEAN® Precast Gels” (Life Science Research—BIO-RAD (California, USA)) and a “BlueClassic Prestained Protein Marker®” (Jena Bioscience (Jena, Germany)) were used. For staining of an SDS-Gel, an “Instant Blue staining solution” (Expedeon Inc. (San Diego, USA)) was used. For PCR purification and gel extraction a “NucleoSpin® Gel and PCR Clean-up” kit and for plasmid purification of E. coli a “NucleoSpin® Plasmid” kit (MACHEREY-NAGEL (Düren, Germany)) was used. For Western blot method a “Trans-Blot Turbo® Nitrocellulose- or PVDF-transfer pack” and a Trans-Blot Turbo® Transfer System (Life Science Research— BIO-RAD (California, USA)) were used. Pictures of the blot were taken on a “Luminescent Image Analyzer Las-4000 (Fujifilm (Minato, J) with the corresponding software “ImageReader LAS-4000”. Antibodies were purchased from THERMO FISHER SCIENTIFIC (Schwerte, Germany). Measurements of DNA-concentration or optical density (OD.sub.600) of cell cultures were performed on a “DS-11+Spectrophotometer” (DeNovix Inc. (Wilmington, USA)). Electroporation of Yersinia cells were performed with a “MicroPulser™ Electroporator” and “Gene E. coli Pulser Cuvettes” 0.2 cm (Life Science Research—BIO-RAD (California, USA)). During fluorescence microscopy the images were taken on a Deltavision Spectris Optical Sectioning Microscope (Applied Precision, Issaquah, Wash., USA), equipped with a UPlanSApo×100/1.40 oil objective (Olympus, Tokyo, Japan) and x 1.6 auxiliary magnification, using an Evolve EMCCD Camera (Photometrics, Tucson, Ariz., USA) at a gain level 50. Microscopy pictures were analyzed and processed with ImageJ-Fiji (Schindelin et al, 2012). All primers and sequencing were placed in order at EUROFINS GENOMICS (Ebersberg, Germany). Gene sequences were bioinformatically analyzed and designed with SerialCloner 2.6.1 (Serial Basics) and the online tools listed in Table S2. Primers that were designed and used during this work are listed in Table 51.
TABLE-US-00009 TABLE S2 Online Tools List of online tools that were used for sequence analysis and primer design. Name URL Expasy Translate tool https://web.expasy.org/translate/ WebCutter http://rna.lundberg.gu.se/cutter2/ Primer 3 http://primer3.ut.ee/ Nucleic Acid Sequence Massager http://www.attotron.com/cybertory/analysis/seqMassager.htm NEB cloner https://nebcloner.neb.com/#!/
REFERENCES
[0239] Autenrieth S E, Linzer T-R, Hiller C, Keller B, Warnke P, Köberle M, Bohn E, Biedermann T, Bühring H-J, Hämmerling G J, Rammensee H-G & Autenrieth I B (2010) Immune Evasion by Yersinia enterocolitica: Differential Targeting of Dendritic Cell Subpopulations In Vivo. PLoS Pathog. 6: e1001212 [0240] Bai F, Li Z, Umezawa A, Terada N & Jin S (2018) Bacterial type III secretion system as a protein delivery tool for a broad range of biomedical applications. Biotechnol. Adv. 36: 482-493 [0241] Biemans-Oldehinkel E, Sal-Man N, Deng W, Foster L J & Finlay B B (2011) Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. J. Bacteriol. 193: 5514-9 [0242] Blanco-Toribio A, Muyldermans S, Frankel G & Fernández L Á (2010) Direct Injection of Functional Single-Domain Antibodies from E. coli into Human Cells. PLoS One 5: e15227 [0243] Charpentier X & Oswald E (2004) Identification of the secretion and translocation domain of the enteropathogenic and enterohemorrhagic Escherichia coli effector Cif, using TEM-1 beta-lactamase as a new fluorescence-based reporter. J. Bacteriol. 186: 5486-95 [0244] Cornelis G R (2002) The Yersinia Ysc-Yop ‘type III’ weaponry. Nat. Rev. Mol. Cell Biol. 3: 742-52 [0245] Cornelis G R (2006) The type III secretion injectisome. Nat. Rev. Microbiol. 4: 811-825 De Leeuw E, Porcelli I, Sargent F, Palmer T & Berks B C (2001) Membrane interactions and self-association of the TatA and TatB components of the twin-arginine translocation pathway. FEBS Lett. 506: 143-148 [0246] Deisseroth K (2011) Optogenetics. Nat. Methods 8: 26-29 [0247] Deng W, Marshall N C, Rowland J L, McCoy J M, Worrall L J, Santos A S, Strynadka N C J & Finlay B B (2017) Assembly, structure, function and regulation of type III secretion systems. Nat. Rev. Microbiol. [0248] Di Ventura B & Kuhlman A (2016) Go in! Go out! Inducible control of nuclear localization. Current Opinion in Chemical Biology 34: 62-71 [0249] Diepold A, Amstutz M, Abel S, Sorg I, Jenal U & Cornelis G R (2010) Deciphering the assembly of the Yersinia type III secretion injectisome. EMBO J. 29: 1928-1940 Diepold A & Armitage J P (2015) Type III secretion systems: the bacterial flagellum and the injectisome. Philos. Trans. R. Soc. B Biol. Sci. 370: 20150020 [0250] Diepold A, Kudryashev M, Delalez N J, Berry R M & Armitage J P (2015) Composition, Formation, and Regulation of the Cytosolic C-ring, a Dynamic Component of the Type III Secretion Injectisome. PLOS Biol. 13: e1002039 [0251] Diepold A, Sezgin E, Huseyin M, Mortimer T, Eggeling C & Armitage J P (2017) A dynamic and adaptive network of cytosolic interactions governs protein export by the T3S S injectisome. Nat. Commun. 8: 15940 [0252] Diepold A & Wagner S (2014) Assembly of the bacterial type III secretion machinery. FEMS Microbiol. Rev. 38: 802-22 [0253] Diepold A, Wiesand U, Amstutz M & Cornelis G R (2012) Assembly of the Yersinia injectisome: the missing pieces. Mol. Microbiol. 85: 878-92 [0254] Diepold A, Wiesand U & Cornelis G R (2011) The assembly of the export apparatus (YscR,S,T,U,V) of the Yersinia type III secretion apparatus occurs independently of other structural components and involves the formation of an YscV oligomer. Mol. Microbiol. 82: 502-14 [0255] Enninga J, Mounier J, Sansonetti P, Tran Van Nhieu G & Nhieu G T Van (2005) Secretion of type III effectors into host cells in real time. Nat. Methods 2: 959-65 Feigner S, Pawar V, Kocijancic D, Erhardt M & Weiss S (2017) Tumour-targeting bacteria-based cancer therapies for increased specificity and improved outcome. Microb. Biotechnol. 10: 1074-1078 [0256] Gambetta, G. A. and Lagarias, J. C. (2001) ‘Genetic engineering of phytochrome biosynthesis in bacteria.’, Proceedings of the National Academy of Sciences of the United States of America. National Academy of Sciences, 98(19), pp. 10566-71. doi: 10.1073/pnas.191375198. [0257] Gauthier A & Finlay B B (2003) Translocated intimin receptor and its chaperone interact with ATPase of the type III secretion apparatus of enteropathogenic Escherichia coli. J. Bacteriol. 185: 6747-55 [0258] Göser V, Kommnick C, Liss V & Hensel M (2019) Self-Labeling Enzyme Tags for Analyses of Translocation of Type III Secretion System Effector Proteins. MBio 10: e00769-19 [0259] Guntas G, Hallett R A, Zimmerman S P, Williams T, Yumerefendi H, Bear J E & Kuhlman B (2015) Engineering an improved light-induced dimer (iLID) for controlling the localization and activity of signaling proteins. Proc. Natl. Acad. Sci. 112: 112-117 [0260] Hu B, Lara-Tejero M, Kong Q, Galan J E & Liu J (2017) In Situ Molecular Architecture of the Salmonella Type III Secretion Machine. Cell 168: 1065-1074.e10 [0261] Hueck C J (1998) Type III protein secretion systems in bacterial pathogens of animals and plants. Microbiol. Mol. Biol. Rev. 62: 379-433 [0262] Ittig S J, Schmutz C, Kasper C A, Amstutz M, Schmidt A, Sauteur L, Vigano M A, Low S H, Affolter M, Cornelis G R, Nigg E A & Arrieumerlou C (2015) A bacterial type III secretion-based protein delivery tool for broad applications in cell biology. J. Cell Biol. 211: 913-31 Jacobi C A, Roggenkamp A, Rakin A, Zumbihl R, Leitritz L & Heesemann J (1998) In vitro and in vivo expression studies of yopE from Yersinia enterocolitica using the gfp reporter gene. Mol. Microbiol. 30: 865-882 [0263] Jayaraman P, Devarajan K, Chua T K, Zhang H, Gunawan E & Poh C L (2016) Blue light-mediated transcriptional activation and repression of gene expression in bacteria. Nucleic Acids Res. 44: 6994-7005 [0264] Johnson S & Blocker A J (2008) Characterization of soluble complexes of the Shigella flexneri type III secretion system ATPase. FEMS Microbiol. Lett. 286: 274-8 Kaberniuk A A, Shemetov A A & Verkhusha V V (2016) A bacterial phytochrome-based optogenetic system controllable with near-infrared light. Nat. Methods 13: 591-7 [0265] Kaniga K, Delor I & Cornelis G R (1991) A wide-host-range suicide vector for improving reverse genetics in gram-negative bacteria: inactivation of the blaA gene of Yersinia enterocolitica. Gene 109: 137-41 [0266] Kawano F, Aono Y, Suzuki H & Sato M (2013) Fluorescence Imaging-Based High-Throughput Screening of Fast- and Slow-Cycling LOV Proteins. PLoS One 8: e82693 [0267] Kawano F, Suzuki H, Furuya A & Sato M (2015) Engineered pairs of distinct photoswitches for optogenetic control of cellular proteins. Nat. Commun. 6: 6256 KOberle M, Klein-Gunther A, Schutz M, Fritz M, Berchtold S, Tolosa E, Autenrieth I B & Bohn E (2009) Yersinia enterocolitica Targets Cells of the Innate and Adaptive Immune System by Injection of Yops in a Mouse Infection Model. PLoS Pathog. 5: e1000551 [0268] Kudryashev M, Stenta M, Schmelz S, Amstutz M, Wiesand U, Castano-Diez D, Degiacomi M T, Münnich S, Bleck C K, Kowal J, Diepold A, Heinz D W, Dal Peraro M, Cornelis G R & Stahlberg H (2013) In situ structural analysis of the Yersinia enterocolitica injectisome. Elife 2: e00792 [0269] Lambert de Rouvroit C, Sluiters C & Cornelis G R (1992) Role of the transcriptional activator, VirF, and temperature in the expression of the pYV plasmid genes of Yersinia enterocolitica. Mol. Microbiol. 6: 395-409 [0270] Lara-Tejero M, Kato J, Wagner S, Liu X & Galán J E (2011) A Sorting Platform Determines the Order of Protein Secretion in Bacterial Type III Systems. Science (80-.). 331: 1188-91 [0271] Lara-Tejero M, Qin Z, Hu B, Butan C, Liu J & Galán J E (2019) Role of SpaO in the assembly of the sorting platform of a Salmonella type III secretion system. PLOS Pathog. 15: e1007565 [0272] Marketon M M, DePaolo R W, DeBord K L, Jabri B & Schneewind O (2005) Plague bacteria target immune cells during infection. Science (80-.). 309: 1739-41 Michiels T, Wattiau P, Brasseur R, Ruysschaert J M & Cornelis G R (1990) Secretion of Yop proteins by Yersiniae. Infect. Immun. 58: 2840-9 [0273] Mills E, Baruch K, Charpentier X, Kobi S & Rosenshine I (2008) Real-time analysis of effector translocation by the type III secretion system of enteropathogenic Escherichia coli. Cell Host Microbe 3: 104-13 [0274] Morita-ishihara T, Ogawa M, Sagara H, Yoshida M, Katayama E & Sasakawa C (2005) Shigella Spa33 is an essential C-ring component of type III secretion machinery. J. Biol. Chem. 281: 599-607 [0275] Mukherjee A, Repina N A, Schaffer D V & Kane R S (2017) Optogenetic tools for cell biological applications. J. Thorac. Dis. 9: 4867-4870 [0276] Palmer T & Berks B C (2012) The twin-arginine translocation (Tat) protein export pathway. Nat. Rev. Microbiol. 10: 483-496 [0277] Pathak, G. P., Strickland, D., Vrana, J. D. and Tucker, C. L. (2014) ‘Benchmarking of optical dimerizer systems.’, ACS synthetic biology. American Chemical Society, 3(11), pp. 832-8. doi: 10.1021/sb500291r. [0278] Pettersson J, Nordfelth R, Dubinina E, Bergman T, Gustafsson M, Magnusson K E & Wolf-Watz H (1996) Modulation of virulence factor expression by pathogen target cell contact. Science (80-.). 273: 1231-3 [0279] Reichhart E, Ingles-Prieto A, Tichy A-M, McKenzie C & Janovjak H (2016) A Phytochrome Sensory Domain Permits Receptor Activation by Red Light. Angew. Chemie Int. Ed. 55: 6339-6342 [0280] Schlumberger M C, Willer A, Ehrbar K, Winnen B, Duss I, Stecher B, Hardt W-D & Mu A J (2005) Real-time imaging of type III secretion: Salmonella SipA injection into host cells. Proc. Natl. Acad. Sci. U.S.A 102: 12548-12553 [0281] Schraidt O & Marlovits T C (2011) Three-dimensional model of Salmonella's needle complex at subnanometer resolution. Science (80-.). 331: 1192-5 [0282] Schulte M, Sterzenbach T, Miskiewicz K, Elpers L, Hensel M & Hansmeier N (2018) A versatile remote control system for functional expression of bacterial virulence genes based on the tetA promoter. Int. J. Med. Microbiol. [0283] Shi L, Yu B, Cai C-H & Huang J-D (2016) Angiogenic inhibitors delivered by the type III secretion system of tumor-targeting Salmonella typhimurium safely shrink tumors in mice. AMB Express 6: 56 [0284] Shimizu-Sato S, Huq E, Tepperman J M & Quail P H (2002) A light-switchable gene promoter system. Nat. Biotechnol. 20: 1041-1044 [0285] Song M, Sukovich D J, Ciccarelli L, Mayr J, Fernandez-Rodriguez J, Mirsky E A, Tucker A C, Gordon D B, Marlovits T C & Voigt C A (2017) Control of type III protein secretion using a minimal genetic system. Nat. Commun. 8: 14737 [0286] Sory M-P P, Boland A, Lambermont I & Cornelis G R (1995) Identification of the YopE and YopH domains required for secretion and internalization into the cytosol of macrophages, using the cyaA gene fusion approach. Proc. Natl. Acad. Sci. U.S.A 92: 11998-12002 [0287] Spiltoir J I, Strickland D, Glotzer M & Tucker C L (2016) Optical Control of Peroxisomal Trafficking. ACS Synth. Biol. 5: 554-560 [0288] Toettcher J E, Voigt C A, Weiner O D & Lim W A (2011) The promise of optogenetics in cell biology: interrogating molecular circuits in space and time. Nat. Methods 8: 35-8 [Toettcher et al, 2011a]. [0289] Toettcher, J. E., Gong, D., Lim, W. A. and Weiner, O. D. (2011) ‘Light control of plasma membrane recruitment using the Phy-PIF system.’, Methods in enzymology. NIH Public Access, 497, pp. 409-23. doi: 10.1016/6978-0-12-385075-1.00017-2 [Toettcher et al, 2011b]. [0290] Wagner S, Grin I, Malmsheimer S, Singh N, Torres-Vargas C E & Westerhausen S (2018) Bacterial type III secretion systems: A complex device for delivery of bacterial effector proteins into eukaryotic host cells. FEMS Microbiol. Lett. [0291] Walker B J, Stan G-B V. & Polizzi K M (2017) Intracellular delivery of biologic therapeutics by bacterial secretion systems. Expert Rev. Mol. Med. 19: e6 [0292] Wang H, Vilela M, Winkler A, Tarnawski M, Schlichting I, Yumerefendi H, Kuhlman B, Liu R, Danuser G & Hahn K M (2016) LOVTRAP: an optogenetic system for photoinduced protein dissociation. Nat. Methods 13: 755-8 [0293] Wattiau P & Cornelis G R (1993) SycE, a chaperone-like protein of Yersinia enterocolitica involved in Ohe secretion of YopE. Mol. Microbiol. 8: 123-31 [0294] Westerhausen S, Nowak M, Torres-Vargas C E, Bilitewski U, Bohn E, Grin I & Wagner S (2019) A NanoLuc luciferase-based assay enabling the real-time analysis of protein secretion and injection by bacterial type III secretion systems. bioRxiv: 745471 Zhang Y, Lara-Tejero M, Bewersdorf J & Galan J E (2017) Visualization and characterization of individual type III protein secretion machines in live bacteria. Proc. Natl. Acad. Sci. U.S.A 114: 6098-6103 [0295] Zimmerman S P, Hallett R A, Bourke A M, Bear J E, Kennedy M J & Kuhlman B (2016) Tuning the Binding Affinities and Reversion Kinetics of a Light Inducible Dimer Allows Control of Transmembrane Protein Localization. Biochemistry 55: 5264-71