Anti-alpha V beta 6 antibodies and uses thereof
10035860 ยท 2018-07-31
Assignee
Inventors
- Shelia M. Violette (Lexington, MA)
- Paul H. Weinreb (Andover, MA)
- Timothy David Jones (Babraham, GB)
- Francis Joseph Carr (Aberdeen, GB)
- Anja Sibylle Tessarz (Cambridge, GB)
Cpc classification
C07K2317/14
CHEMISTRY; METALLURGY
G01N33/5308
PHYSICS
C07K2317/24
CHEMISTRY; METALLURGY
International classification
A61K39/395
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
Abstract
Humanized antibodies and antibody fragments thereof that bind to v6 are disclosed. Also disclosed are methods of using these antibodies and antibody fragments to diagnose, treat, and/or prevent v6-mediated diseases such as acute tissue injury, fibrosis, and cancer.
Claims
1. An antibody or antigen-binding fragment thereof that specifically binds to v6, wherein the antibody or the antigen-binding fragment thereof comprises: a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:1 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:9; a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:3 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:9; a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:5 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:9; or a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:7 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:9.
2. An antibody or antigen-binding fragment thereof that specifically binds to v6, wherein the antibody or the antigen-binding fragment thereof comprises: a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:1 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:11; a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:3 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:11; a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:5 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:11; or a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:7 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:11.
3. An antibody or antigen-binding fragment thereof that specifically binds to v6, wherein the antibody or the antigen-binding fragment thereof comprises: a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:1 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:13; a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:3 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:13; a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:5 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:13; or a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:7 and a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NO:13.
4. A pharmaceutical composition comprising the antibody or the antigen-binding fragment thereof of claim 1 and a pharmaceutically acceptable carrier.
5. A pharmaceutical composition comprising the antibody or the antigen-binding fragment thereof of claim 2 and a pharmaceutically acceptable carrier.
6. A pharmaceutical composition comprising the antibody or the antigen-binding fragment thereof of claim 3 and a pharmaceutically acceptable carrier.
7. A method of treating a cancer in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 1.
8. The method of claim 7, wherein the cancer is a pancreatic cancer, a lung cancer, a breast cancer, a colorectal cancer, a head and neck cancer, an esophageal cancer, a skin cancer, a cervical cancer, a prostate cancer, an ovarian cancer, a kidney cancer, and an endometrial cancer.
9. A method of treating fibrosis in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 1.
10. A method of treating acute exacerbations of idiopathic pulmonary fibrosis in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 1.
11. A method of diagnosing an v6-mediated disorder in a human subject, the method comprising: (a) contacting a cell or tissue from the human subject with an isolated antibody or an antigen-binding fragment thereof of claim 1; (b) detecting the formation of a complex between the antibody or the antigen-binding fragment thereof and the cell or tissue to determine the level of expression of v6 in the cell or tissue, wherein an increased level of v6 in the cell or tissue compared to a cell or tissue from a control human subject not having the v6-mediated disorder is indicative that the human subject has or is likely to develop the v6-mediated disorder.
12. A method of treating a cancer in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 2.
13. A method of treating a cancer in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 3.
14. The method of claim 12, wherein the cancer is a pancreatic cancer, a lung cancer, a breast cancer, a colorectal cancer, a head and neck cancer, an esophageal cancer, a skin cancer, a cervical cancer, a prostate cancer, an ovarian cancer, a kidney cancer, and an endometrial cancer.
15. The method of claim 13, wherein the cancer is a pancreatic cancer, a lung cancer, a breast cancer, a colorectal cancer, a head and neck cancer, an esophageal cancer, a skin cancer, a cervical cancer, a prostate cancer, an ovarian cancer, a kidney cancer, and an endometrial cancer.
16. A method of treating fibrosis in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 2.
17. A method of treating fibrosis in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 3.
18. A method of treating acute exacerbations of idiopathic pulmonary fibrosis in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 2.
19. A method of treating acute exacerbations of idiopathic pulmonary fibrosis in a human subject in need thereof, comprising administering to the human subject the antibody or the antigen-binding fragment thereof of claim 3.
20. A method of diagnosing an v6-mediated disorder in a human subject, the method comprising: (a) contacting a cell or tissue from the human subject with an isolated antibody or an antigen-binding fragment thereof of claim 2; (b) detecting the formation of a complex between the antibody or the antigen-binding fragment thereof and the cell or tissue to determine the level of expression of v6 in the cell or tissue, wherein an increased level of v6 in the cell or tissue compared to a cell or tissue from a control human subject not having the v6-mediated disorder is indicative that the human subject has or is likely to develop the v6-mediated disorder.
21. A method of diagnosing an v6-mediated disorder in a human subject, the method comprising: (a) contacting a cell or tissue from the human subject with an isolated antibody or an antigen-binding fragment thereof of claim 3; (b) detecting the formation of a complex between the antibody or the antigen-binding fragment thereof and the cell or tissue to determine the level of expression of v6 in the cell or tissue, wherein an increased level of v6 in the cell or tissue compared to a cell or tissue from a control human subject not having the v6-mediated disorder is indicative that the human subject has or is likely to develop the v6-mediated disorder.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
DETAILED DESCRIPTION
(3) This disclosure features antibodies and antigen-binding fragments that specifically bind the v6 integrin. More specifically, these antibodies and antigen-binding fragments bind the 6 subunit of the v6 integrin. These antibodies and antigen-binding fragments can bind to both native and denatured 6. The antibodies and antigen-binding fragments thereof described herein are useful in the treatment or prevention of v6-associated disorders such as fibrosis, acute tissue injury, acute lung injury, acute kidney injury, and cancers. In addition, these antibodies are useful to diagnose v6-associated disorders. 6
(4) The amino acid sequence of the human 6 protein (Genbank Accession No. A26609.1) is shown below:
(5) TABLE-US-00001 (SEQIDNO:37) MGIELLCLFFLFLGRNDSRTRWLCLGGAETCEDCLLIGPQCAWCAQENFT HPSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSD IVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLN TIKELGSGLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSI PYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAA VCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATV GLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLF QHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSP ECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTD SCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGL LCGGNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAGEECVDKCK LAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEK DCPKPPNIPMIMLGVSLATLLIGVVLLCIWKLLVSFHDRKEVAKFEAERS KAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
(6) The amino acid sequence of the murine 6 protein (Genbank Accession No. NP_001153036.1) is shown below:
(7) TABLE-US-00002 (SEQIDNO:38) MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFT HLSGAGERCDTPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSD IVQIAPQSLVLKLRPGREQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLN TIKELGSRLAKEMSKLTSNFRLGFGSFVEKPVSPFMKTTPEEITNPCSSI PYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPEGGFDAIMQAA VCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATV GLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLF PHQKKCSHMKVGDTASFNVTVSVSNCEKRSRNLIIKPVGLGDTLEILVSA ECDCDCQREIETNSSKCHNGNGSFQCGVCTCNPGHMGPHCECGEDMVSTD SCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCDNFSCLRHKGL LCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCK AIGATISEEDFSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKD CPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSK AKWQTGTNPLYRGSTSTFKNVTYKHREKHKAGLSSDG
(8) The human and murine 6 proteins share about 91% sequence identity.
(9) Anti-v6 Antibodies
(10) This disclosure includes antibodies and antigen-binding fragments that specifically bind to v6, and more specifically to the 6 subunit. The antibodies disclosed herein are derived from the murine 2E5 antibody produced by the hybridoma deposited at the ATCC on Dec. 5, 2001, with the accession number PTA-3897. Example 1 discloses four exemplary heavy chain variable regions, VH1, VH2, VH3, and VH4, having the amino acid sequences set forth in SEQ ID NOs:1, 3, 5, and 7, respectively, and three exemplary light chain variable region, VL1, VL2, and VL3, having the amino acid sequences set forth in SEQ ID NOs: 9, 11, and 13, respectively. Each of the VH chains can pair with any of the VL chains: i.e., VH1 can pair with VL1, VL2, or VL3; VH2 can pair with VL1, VL2, or VL3; VH3 can pair with VL1, VL2, or VL3; and VH4 can pair with VL1, VL2, or VL3. Thus, the heavy chain variable region and light chain variable regions disclosed in Example 1 can form 12 different VH-VL pairs.
(11) The amino acid sequences of the complementarity determining regions (CDRs) 1, 2, and 3 as well as the framework regions (FRs) 1, 2, 3, 4 of the four heavy chain variable regions and the three light chain variable regions of the exemplary antibodies described in Example 1 are provided below. The CDRs are based upon the Kabat numbering system.
(12) TABLE-US-00003 Domain SEQIDNO Sequence VHCDR1 15 NYLIE VHCDR2 16 VINPGTSITNYNEKFKG VHCDR3 17 IYYGEFSHAVDS VLCDR1 18 KASQGVSSAVA VLCDR2 19 SASYRYT VLCDR3 20 QQHYGSPWT VH1FR1 21 QVQLVQSGAELKKPGSSVKVSCKASGYVFT VH1FR2 22 WVKQAPGQGLEWIG VH1FR3 23 RATLTADKSTSTAYMQLSSLTSEDSAVYFCAT VH1FR4 24 WGQGTSVTVSS VH2FR1 25 QVQLVQSGAEVKKPGSSVKVSCKASGYVFT VH2FR2 26 WVRQAPGQGLEWIG VH2FR3 27 RATLTADKSTSTAYMELSSLRSEDTAVYFCAT VH2FR4 28 WGQGTLVTVSS VH3FR1 25 QVQLVQSGAEVKKPGSSVKVSCKASGYVFT VH3FR2 26 WVRQAPGQGLEWIG VH3FR3 29 RATLTADKSTSTAYMELSSLRSEDTAVYYCAT VH3FR4 28 WGQGTLVTVSS VH4FR1 25 QVQLVQSGAEVKKPGSSVKVSCKASGYVFT VH4FR2 26 WVRQAPGQGLEWIG VH4FR3 30 RATITADKSTSTAYMELSSLRSEDTAVYYCAT VH4FR4 28 WGQGLTVTVSS VL1FR1 31 DIVMTQSHSFMSASVGDRVTITC VL1FR2 32 WYQQKPGKAPKLLIF VL1FR3 33 GVPDRFTGSGSGTDFTLTISSLQAEDVAVYYC VL1FR4 34 FGQGTKLEIK VL2FR1 35 DIVMTQSPSSMSASVGDRVTITC VL2FR2 32 WYQQKPGKAPKLLIF VL2FR3 33 QVPDRFTGSGSGTDFTLTISSLQAEDVAVYYC VL2FR4 34 FGQGTKLEIK VL3FR1 36 DIQMTQSPSSMSASVGDRVTITC VL3FR2 32 WYQQKPGKAPKLLIF VL3FR3 33 GVPDRFTGSGSGTDFTLTISSLQAEDVAVYYC VL3FR4 34 FGQGTKLEIK
(13) The anti-v6 antibodies of this disclosure can also comprise alternate CDRs. By alternate CDRs are meant CDRs (CDR1, CDR2, and CDR3) defined according to any one of the Chothia, from AbYsis, enhanced Chothia/AbM CDR, or the contact definitions. These alternate CDRs can be obtained, e.g., by using the AbYsis database (www.bioinf.org.uk/abysis/sequence_input/key_annotation/key_annotation.cgi). The amino acid sequences of alternate CDRs 1, 2, and 3 of the heavy chain variable region and the light chain variable region of the anti-v6 antibodies of this disclosure are compared with the CDRs defined according to Kabat in the Table below.
(14) TABLE-US-00004 Chothia Enhanced Domain Kabat fromAbYsis Chothia/AbM Contact VHCDR1 NYLIE GYVFTNY GYVFTNYLIE TNYLIE (SEQIDNO:15) (SEQIDNO:47) (SEQIDNO:49) (SEQIDNO:51) VHCDR2 VINPGTSITNYNEKFKG NPGTSI VINPGTSITN WIGVINPGTSITN (SEQIDNO:16) (SEQIDNO:48) (SEQIDNO:50) (SEQIDNO:52) VHCDR3 IYYGEFSHAVDS IYYGEFSHAVDS IYYGEFSHAVDS ATIYYGEFSHAVD (SEQIDNO:17) (SEQIDNO:17) (SEQIDNO:17) (SEQIDNO:53) VLCDR1 KASQGVSSAVA KASQGVSSAVA KASQGVSSAVA SSAVAWY (SEQIDNO:18) (SEQIDNO:18) (SEQIDNO:18) (SEQIDNO:54) VLCDR2 SASYRYT SASYRYT SASYRYT LLIFSASYRY (SEQIDNO:19) (SEQIDNO:19) (SEQIDNO:19) (SEQIDNO:55) VLCDR3 QQHYGSPWT QQHYGSPWT QQHYGSPWT QQHYGSPW (SEQIDNO:20) (SEQIDNO:20) (SEQIDNO:20) (SEQIDNO:56)
(15) The anti-v6 antibodies of this disclosure can comprise or consist of the heavy chain and light chain CDR 1, CDR2, and CDR3 according to any of the Kabat definition, the Chothia from AbYsis definition, the enhanced Chothia/AbM CDR definition, or the contact definitions. The anti-v6 antibodies of this disclosure can comprise or consist of the heavy chain CDR 1, CDR2, and CDR3 and/or light chain CDR 1, CDR2, and CDR3 according to any of the Kabat definition, the Chothia from AbYsis definition, the enhanced Chothia/AbM CDR definition, or the contact definitions with 1, 2 or 3 substitutions within one or more of the CDRs (i.e., 1, 2, 3, 4, 5 or 6).
(16) This disclosure also includes antibodies that specifically bind v6 and/or 6 that have heavy chain variable regions that are: 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO:1; 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO:3; 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO:5; or 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO: 7. In certain embodiments, these antibodies bind both native and denatured 6. In some embodiments, these antibodies further include light chain variable region variable regions that are: 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO:9; 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO:11; or 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences set forth in SEQ ID NO: 13. In certain embodiments, these antibodies bind both native and denatured 6.
(17) This disclosure also includes antibodies that specifically bind v6 and/or 6 that have four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, three, or all four of the framework regions, and/or four or fewer (e.g., four, three or fewer, two or fewer, or one) amino acid substitutions in one, two, or all three CDRs, of the heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs:1, 3, 5, or 7. The application also includes antibodies that have four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, three, or all four of the framework regions, and/or four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, or all three CDRs, of the light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 9, 11, or 13. In certain embodiments, the humanized antibodies of this disclosure include antibodies that specifically bind v6 and/or 6 that have four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, three, or four of the framework regions, and/or four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, or three CDRs, of the heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs:1, 3, 5, or 7 and four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, three, or four of the framework regions, and/or four or fewer (e.g., four, three or fewer, three, two or fewer, two, or one) amino acid substitutions in one, two, or three CDRs, of the light chain variable regions comprising the amino acid sequences set forth in SEQ ID NOs: 9, 11, or 13. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.
(18) In certain embodiments the VH and or VL region can be linked to a constant region (e.g., a wild-type human Fc region or an Fc region that includes one or more alterations). In certain embodiments, the constant region comprises a CH1 domain and a hinge region. In some embodiments, the constant region comprises a CH3 domain. In some embodiments, the antibody has a constant region derived from a human kappa or lambda sequence. In a specific embodiment, constant region comprises a human subgroup kappa 2 sequence. The constant region can be a human Fc region, e.g., a wild-type Fc region, or an Fc region that includes one or more amino acid substitutions. The constant region can have substitutions that modify the properties of the antibody (e.g., increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function). For example, the human IgG1 constant region can be mutated at one or more residues, e.g., one or more of residues 234 and 237 (based on Kabat numbering). Antibodies may have mutations in the CH2 region of the heavy chain that reduce or alter effector function, e.g., Fc receptor binding and complement activation. For example, antibodies may have mutations such as those described in U.S. Pat. Nos. 5,624,821 and 5,648,260. Antibodies may also have mutations that stabilize the disulfide bond between the two heavy chains of an immunoglobulin, such as mutations in the hinge region of IgG4, as disclosed in the art (e.g., Angal et al. (1993) Mol. Immunol. 30:105-08). See also, e.g., U.S. 2005-0037000.
(19) In certain embodiments the antibodies or antigen binding fragments thereof can be linked to a cytotoxic agent. In some embodiments, the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic agent, a prodrug, an immunologically active ligand, a cytokines, an alkylating agent, an antimetabolilte, and an anti-proliferative agent, a tubulin binding agent, a hormone, and a hormone antagonist. Exemplary cytotoxic agents include .sup.90Y, .sup.131I, Monomethyl Auristatin E (MMAE), mertansine (DM1), DM4, diphtheria toxin, Pseudomonas exotoxin (PE38), and A chain of ricin. In a specific embodiment, the cytotoxic agent is a maytansinoid. In certain embodiments, the antibody has an isotype selected from the group consisting of IgG1, IgG2, IgG3, and IgG4.
(20) In certain embodiments the antibodies or antigen binding fragments thereof can be conjugated to one or more agents that are useful for treating or preventing the condition the antibody or antigen binding fragment thereof is being used to treat or prevent. These agents can be, e.g., miRNAs, miRNA mimics, siRNAs, anti-miRs, antisense nucleic acids, ribozymes, small molecule compounds, and other chemical moieties. Such antibodies or antigen binding fragments can be used e.g., to deliver the bound agent(s) to a cell or tissue of interest that expresses v6. In certain embodiments, the antibodies or antigen binding fragments thereof can be conjugated to a drug that has systemic toxicity and use the conjugated antibody or antigen-binding fragment to selectively deliver the drug to v6 expressing cells thereby decreasing or preventing the toxicity of the conjugated drug.
(21) Antibodies can be selected for use based on improved potency, higher affinity or avidity for 6, or v6 and/or reduced immunogenicity than previously known v6 antibodies. Methods of determining potency, affinity or avidity, and immunogenicity of antibodies are within the skill of the ordinary artisan.
(22) Methods of Obtaining Anti-v6 Antibodies
(23) Antibodies, such as those described above, can be made, for example, by preparing and expressing synthetic genes that encode the recited amino acid sequences. Methods of generating variants (e.g., comprising amino acid substitutions) of any of the anti-v6 antibodies are well known in the art. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide-mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of a prepared DNA molecule encoding the antibody or any portion thereof (e.g., a framework region, a CDR, a constant region). Site-directed mutagenesis is well known in the art (see, e.g., Carter et al., Nucleic Acids Res., 13:4431-4443 (1985) and Kunkel et al., Proc. Natl. Acad. Sci. USA, 82:488 (1987)). PCR mutagenesis is also suitable for making amino acid sequence variants of the starting polypeptide. See Higuchi, in PCR Protocols, pp. 177-183 (Academic Press, 1990); and Vallette et al., Nuc. Acids Res. 17:723-733 (1989). Another method for preparing sequence variants, cassette mutagenesis, is based on the technique described by Wells et al., Gene, 34:315-323 (1985).
(24) Affinity Maturation
(25) In one embodiment, an anti-v6 antibody or antigen-binding fragment thereof described herein is modified, e.g., by mutagenesis, to provide a pool of modified antibodies. The modified antibodies are then evaluated to identify one or more antibodies having altered functional properties (e.g., improved binding, improved stability, reduced antigenicity, or increased stability in vivo). In one implementation, display library technology is used to select or screen the pool of modified antibodies. Higher affinity antibodies are then identified from the second library, e.g., by using higher stringency or more competitive binding and washing conditions. Other screening techniques can also be used.
(26) In some implementations, the mutagenesis is targeted to regions known or likely to be at the binding interface. If, for example, the identified binding proteins are antibodies, then mutagenesis can be directed to the CDR regions of the heavy or light chains as described herein. Further, mutagenesis can be directed to framework regions near or adjacent to the CDRs, e.g., framework regions, particularly within 10, 5, or 3 amino acids of a CDR junction. In the case of antibodies, mutagenesis can also be limited to one or a few of the CDRs, e.g., to make step-wise improvements.
(27) In one embodiment, mutagenesis is used to make an antibody more similar to one or more germline sequences. One exemplary germlining method can include: identifying one or more germline sequences that are similar (e.g., most similar in a particular database) to the sequence of the isolated antibody. Then mutations (at the amino acid level) can be made in the isolated antibody, either incrementally, in combination, or both. For example, a nucleic acid library that includes sequences encoding some or all possible germline mutations is made. The mutated antibodies are then evaluated, e.g., to identify an antibody that has one or more additional germline residues relative to the isolated antibody and that is still useful (e.g., has a functional activity). In one embodiment, as many germline residues are introduced into an isolated antibody as possible.
(28) In one embodiment, mutagenesis is used to substitute or insert one or more germline residues into a CDR region. For example, the germline CDR residue can be from a germline sequence that is similar (e.g., most similar) to the variable region being modified. After mutagenesis, activity (e.g., binding or other functional activity) of the antibody can be evaluated to determine if the germline residue or residues are tolerated. Similar mutagenesis can be performed in the framework regions.
(29) Selecting a germline sequence can be performed in different ways. For example, a germline sequence can be selected if it meets a predetermined criteria for selectivity or similarity, e.g., at least a certain percentage identity, e.g., at least 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 99.5% identity, relative to the donor non-human antibody. The selection can be performed using at least 2, 3, 5, or 10 germline sequences. In the case of CDR1 and CDR2, identifying a similar germline sequence can include selecting one such sequence. In the case of CDR3, identifying a similar germline sequence can include selecting one such sequence, but may include using two germline sequences that separately contribute to the amino-terminal portion and the carboxy-terminal portion. In other implementations, more than one or two germline sequences are used, e.g., to form a consensus sequence.
(30) Calculations of sequence identity between two sequences are performed as follows. The sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). The optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences.
(31) In other embodiments, the antibody may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern). As used in this context, altered means having one or more carbohydrate moieties deleted, and/or having one or more glycosylation sites added to the original antibody. Addition of glycosylation sites to the presently disclosed antibodies may be accomplished by altering the amino acid sequence to contain glycosylation site consensus sequences; such techniques are well known in the art. Another means of increasing the number of carbohydrate moieties on the antibodies is by chemical or enzymatic coupling of glycosides to the amino acid residues of the antibody. These methods are described in, e.g., WO 87/05330, and Aplin and Wriston (1981) CRC Crit. Rev. Biochem., 22:259-306. Removal of any carbohydrate moieties present on the antibodies may be accomplished chemically or enzymatically as described in the art (Hakimuddin et al. (1987) Arch. Biochem. Biophys., 259:52; Edge et al. (1981) Anal. Biochem., 118:131; and Thotakura et al. (1987) Meth. Enzymol., 138:350). See, e.g., U.S. Pat. No. 5,869,046 for a modification that increases in vivo half life by providing a salvage receptor binding epitope.
(32) In one embodiment, an antibody has CDR sequences (e.g., a Chothia or Kabat CDR) that differ from those of SEQ ID NOs: 15, 16, 17, 18, 19, and 20. CDR sequences that differ from those of the 2E5 humanized antibodies described herein include amino acid changes, such as substitutions of 1, 2, 3, or 4 amino acids if a CDR is 5-7 amino acids in length, or substitutions of 1, 2, 3, 4, 5, 6, or 7 of amino acids in the sequence of a CDR if a CDR is 10 amino acids or greater in length. The amino acid that is substituted can have similar charge, hydrophobicity, or stereochemical characteristics. In some embodiments, the amino acid substitution(s) is a conservative substitution. In other embodiments, the amino acid substitution(s) is a non-conservative substitution. Such substitutions are within the ordinary skill of an artisan. The antibody or antibody fragments thereof that contain the substituted CDRs can be screened to identify antibodies that specifically bind to 6 or v6.
(33) Unlike in CDRs, more substantial changes in structure framework regions (FRs) can be made without adversely affecting the binding properties of an antibody. Changes to FRs include, but are not limited to, humanizing a nonhuman-derived framework or engineering certain framework residues that are important for antigen contact or for stabilizing the binding site, e.g., changing the class or subclass of the constant region, changing specific amino acid residues which might alter an effector function such as Fc receptor binding (Lund et al., J. Immun., 147:2657-62 (1991); Morgan et al., Immunology, 86:319-24 (1995)), or changing the species from which the constant region is derived.
(34) The anti-v6 antibodies can be in the form of full length antibodies, or in the form of low molecular weight forms (e.g., biologically active antibody fragments or minibodies) of the anti-v6 antibodies, e.g., Fab, Fab, F(ab).sub.2, Fv, Fd, dAb, scFv, and sc(Fv)2. Other anti-v6 antibodies encompassed by this disclosure include single domain antibody (sdAb) containing a single variable chain such as, VH or VL, or a biologically active fragment thereof. See, e.g., Moller et al., J. Biol. Chem., 285(49): 38348-38361 (2010); Harmsen et al., Appl. Microbiol. Biotechnol., 77(1):13-22 (2007); U.S. 2005/0079574 and Davies et al. (1996) Protein Eng., 9(6):531-7. Like a whole antibody, a sdAb is able to bind selectively to a specific antigen. With a molecular weight of only 12-15 kDa, sdAbs are much smaller than common antibodies and even smaller than Fab fragments and single-chain variable fragments.
(35) Provided herein are compositions comprising a mixture of an anti-v6 antibody or antigen-binding fragment thereof and one or more acidic variants thereof, e.g., wherein the amount of acidic variant(s) is less than about 80%, 70%, 60%, 60%, 50%, 40%, 30%, 30%, 20%, 10%, 5% or 1%. Also provided are compositions comprising an anti-v6 antibody or antigen-binding fragment thereof comprising at least one deamidation site, wherein the pH of the composition is from about 5.0 to about 6.5, such that, e.g., at least about 90% of the anti-v6 antibodies are not deamidated (i.e., less than about 10% of the antibodies are deamidated). In certain embodiments, less than about 5%, 3%, 2% or 1% of the antibodies are deamidated. The pH may be from 5.0 to 6.0, such as 5.5 or 6.0. In certain embodiments, the pH of the composition is 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5.
(36) An acidic variant is a variant of a polypeptide of interest which is more acidic (e.g. as determined by cation exchange chromatography) than the polypeptide of interest. An example of an acidic variant is a deamidated variant.
(37) A deamidated variant of a polypeptide molecule is a polypeptide wherein one or more asparagine residue(s) of the original polypeptide have been converted to aspartate, i.e. the neutral amide side chain has been converted to a residue with an overall acidic character.
(38) The term mixture as used herein in reference to a composition comprising an anti-v6 antibody or antigen-binding fragment thereof, means the presence of both the desired anti-v6 antibody or antigen-binding fragment thereof and one or more acidic variants thereof. The acidic variants may comprise predominantly deamidated anti-v6 antibody, with minor amounts of other acidic variant(s).
(39) In certain embodiments, the binding affinity (K.sub.D), on-rate (K.sub.D on) and/or off-rate (K.sub.D off) of the antibody that was mutated to eliminate deamidation is similar to that of the wild-type antibody, e.g., having a difference of less than about 5 fold, 2 fold, 1 fold (100%), 50%, 30%, 20%, 10%, 5%, 3%, 2% or 1%.
(40) In certain embodiments, an anti-v6 antibody or antigen-binding fragment thereof or low molecular weight antibodies thereof specifically binds to 6 or v6 and/or reduces the severity of symptoms when administered to human patients having one or more of, or animal models of: fibrosis (e.g., lung fibrosis, kidney fibrosis), acute lung injury, acute kidney injury, pancreatic cancer, lung cancer, breast cancer, colorectal cancer, head and neck cancer, esophageal cancer, skin cancer, prostate cancer, cervical cancer, ovarian cancer, kidney cancer, and endometrial cancer. In one embodiment, the anti-v6 antibody or antigen-binding fragment thereof or low molecular weight antibodies thereof inhibit disease development in an idiopathic pulmonary fibrosis model (Degryse et al., Am J Med Sci., 341(6):444-9 (2011)). These features of an anti-v6 antibody or antigen-binding fragment thereof or low molecular weight antibodies thereof can be measured according to methods known in the art.
(41) Antibody Fragments
(42) Antibody fragments (e.g., Fab, Fab, F(ab)2, Facb, and Fv) of v6-binding antibodies may be prepared by proteolytic digestion of intact v6 antibodies. For example, antibody fragments can be obtained by treating the whole antibody with an enzyme such as papain, pepsin, or plasmin. Papain digestion of whole antibodies produces F(ab)2 or Fab fragments; pepsin digestion of whole antibodies yields F(ab)2 or Fab; and plasmin digestion of whole antibodies yields Facb fragments.
(43) Alternatively, antibody fragments can be produced recombinantly. For example, nucleic acids encoding the antibody fragments of interest can be constructed, introduced into an expression vector, and expressed in suitable host cells. See, e.g., Co, M. S. et al., J. Immunol., 152:2968-2976 (1994); Better, M. and Horwitz, A. H., Methods in Enzymology, 178:476-496 (1989); Pluckthun, A. and Skerra, A., Methods in Enzymology, 178:476-496 (1989); Lamoyi, E., Methods in Enzymology, 121:652-663 (1989); Rousseaux, J. et al., Methods in Enzymology, (1989) 121:663-669 (1989); and Bird, R. E. et al., TIBTECH, 9:132-137 (1991)). Antibody fragments can be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of these fragments. Antibody fragments can be isolated from the antibody phage libraries. Alternatively, Fab-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab)2 fragments (Carter et al., Bio/Technology, 10:163-167 (1992)). According to another approach, F(ab)2 fragments can be isolated directly from recombinant host cell culture. Fab and F(ab) 2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046.
(44) Minibodies
(45) Minibodies of anti-v6 antibodies include diabodies, single chain (scFv), and single-chain (Fv)2 (sc(Fv)2).
(46) A diabody is a bivalent minibody constructed by gene fusion (see, e.g., Holliger, P. et al., Proc. Natl. Acad. Sci. U.S.A, 90:6444-6448 (1993); EP 404,097; WO 93/11161). Diabodies are dimers composed of two polypeptide chains. The VL and VH domain of each polypeptide chain of the diabody are bound by linkers. The number of amino acid residues that constitute a linker can be between 2 to 12 residues (e.g., 3-10 residues or five or about five residues). The linkers of the polypeptides in a diabody are typically too short to allow the VL and VH to bind to each other. Thus, the VL and VH encoded in the same polypeptide chain cannot form a single-chain variable region fragment, but instead form a dimer with a different single-chain variable region fragment. As a result, a diabody has two antigen-binding sites.
(47) An scFv is a single-chain polypeptide antibody obtained by linking the VH and VL with a linker (see e.g., Huston et al., Proc. Natl. Acad. Sci. U.S.A, 85:5879-5883 (1988); and Pluckthun, The Pharmacology of Monoclonal Antibodies Vol. 113, Ed Resenburg and Moore, Springer Verlag, New York, pp. 269-315, (1994)). The order of VHs and VLs to be linked is not particularly limited, and they may be arranged in any order. Examples of arrangements include: [VH] linker [VL]; or [VL] linker [VH]. The H chain V region and L chain V region in an scFv may be derived from any anti-v6 antibody or antigen-binding fragment thereof described herein.
(48) An sc(Fv)2 is a minibody in which two VHs and two VLs are linked by a linker to form a single chain (Hudson, et al., J. Immunol. Methods, (1999) 231: 177-189 (1999)). An sc(Fv)2 can be prepared, for example, by connecting scFvs with a linker. The sc(Fv)2 of the present invention include antibodies preferably in which two VHs and two VLs are arranged in the order of: VH, VL, VH, and VL ([VH] linker [VL] linker [VH] linker [VL]), beginning from the N terminus of a single-chain polypeptide; however the order of the two VHs and two VLs is not limited to the above arrangement, and they may be arranged in any order. Examples of arrangements are listed below:
(49) [VL] linker [VH] linker [VH] linker [VL]
(50) [VH] linker [VL] linker [VL] linker [VH]
(51) [VH] linker [VH] linker [VL] linker [VL]
(52) [VL] linker [VL] linker [VH] linker [VH]
(53) [VL] linker [VH] linker [VL] linker [VH]
(54) Normally, three linkers are required when four antibody variable regions are linked; the linkers used may be identical or different. There is no particular limitation on the linkers that link the VH and VL regions of the minibodies. In some embodiments, the linker is a peptide linker. Any arbitrary single-chain peptide comprising about three to 25 residues (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18) can be used as a linker. Examples of such peptide linkers include: Ser; Gly Ser; Gly Gly Ser; Ser Gly Gly; Gly Gly Gly Ser (SEQ ID NO:39); Ser Gly Gly Gly (SEQ ID NO:40); Gly Gly Gly Gly Ser (SEQ ID NO:41); Ser Gly Gly Gly Gly (SEQ ID NO:42); Gly Gly Gly Gly Gly Ser (SEQ ID NO:43); Ser Gly Gly Gly Gly Gly (SEQ ID NO:44); Gly Gly Gly Gly Gly Gly Ser (SEQ ID NO:45); Ser Gly Gly Gly Gly Gly Gly (SEQ ID NO:46); (Gly Gly Gly Gly Ser (SEQ ID NO:41).sub.n, wherein n is an integer of one or more; and (Ser Gly Gly Gly Gly (SEQ ID NO:42).sub.n, wherein n is an integer of one or more.
(55) In certain embodiments, the linker is a synthetic compound linker (chemical cross-linking agent). Examples of cross-linking agents that are available on the market include N-hydroxysuccinimide (NHS), disuccinimidylsuberate (DSS), bis(sulfosuccinimidyl)suberate (BS3), dithiobis(succinimidylpropionate) (DSP), dithiobis(sulfosuccinimidylpropionate) (DTSSP), ethyleneglycol bis(succinimidylsuccinate) (EGS), ethyleneglycol bis(sulfosuccinimidylsuccinate) (sulfo-EGS), disuccinimidyl tartrate (DST), disulfosuccinimidyl tartrate (sulfo-DST), bis[2-(succinimidooxycarbonyloxy)ethyl]sulfone (BSOCOES), and bis[2-(sulfosuccinimidooxycarbonyloxy)ethyl]sulfone (sulfo-BSOCOES).
(56) The amino acid sequence of the VH or VL in the minibodies may include modifications such as substitutions, deletions, additions, and/or insertions. For example, the modification may be in one or more of the CDRs of the anti-v6 antibody or antigen-binding fragment thereof. In certain embodiments, the modification involves one, two, or three amino acid substitutions in one or more CDRs and/or framework regions of the VH and/or VL domain of the anti-v6 minibody. Such substitutions are made to improve the binding, functional activity and/or reduce immunogenicity of the anti-v6 minibody. In certain embodiments, the substitutions are conservative amino acid substitutions. In other embodiments, one, two, or three amino acids of the CDRs of the anti-v6 antibody or antigen-binding fragment thereof may be deleted or added as long as there is v6 binding and/or functional activity when VH and VL are associated.
(57) Bispecific Antibodies
(58) Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes. Exemplary bispecific antibodies may bind to two different epitopes of the v6 protein. Other such antibodies may combine a v6 binding site with a binding site for another protein (e.g., v1, v3, v5, v8, tumor specific antigens (e.g., alphafetoprotein (AFP), carcinoembryonic antigen (CEA), CA-125, MUC-1, Epithelial tumor antigen (ETA), tyrosinase, Melanoma-associated antigen (MAGE)-1, MAGE-3, BAGE-1, GAGE-1, GnTV, KM-FIN-1, KK-LC-1, LAGE-1, NA88-A, NY-ESO-1, SAGE, Sp17, SSX-2, TAG-1, TRAG-3, TRP2, XAGE-1b, HPV 16, HPV E6, HPV E7, TAG-72, L6-antigen, CD19, CD22, CD37, CD52, EGF receptor, HER 2 receptor, Lewis Y), T-cell antigens (e.g., CD2, CD3, CD5, CD6, CD7, TCR)). Bispecific antibodies can be prepared as full length antibodies or low molecular weight forms thereof (e.g., F(ab).sub.2 bispecific antibodies, sc(Fv)2 bispecific antibodies, diabody bispecific antibodies).
(59) Traditional production of full length bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (Millstein et al., Nature, 305:537-539 (1983)). In a different approach, antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences. DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host cell. This provides for greater flexibility in adjusting the proportions of the three polypeptide fragments. It is, however, possible to insert the coding sequences for two or all three polypeptide chains into a single expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields.
(60) According to another approach described in U.S. Pat. No. 5,731,168, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers that are recovered from recombinant cell culture. The preferred interface comprises at least a part of the C.sub.H3 domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g., tyrosine or tryptophan). Compensatory cavities of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
(61) Bispecific antibodies include cross-linked or heteroconjugate antibodies. For example, one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin. Heteroconjugate antibodies may be made using any convenient cross-linking methods.
(62) The diabody technology provides an alternative mechanism for making bispecific antibody fragments. The fragments comprise a VH connected to a VL by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
(63) Multivalent Antibodies
(64) A multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind. The antibodies describe herein can be multivalent antibodies with three or more antigen binding sites (e.g., tetravalent antibodies), which can be readily produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody. The multivalent antibody can comprise a dimerization domain and three or more antigen binding sites. An exemplary dimerization domain comprises (or consists of) an Fc region or a hinge region. A multivalent antibody can comprise (or consist of) three to about eight (e.g., four) antigen binding sites. The multivalent antibody optionally comprises at least one polypeptide chain (e.g., at least two polypeptide chains), wherein the polypeptide chain(s) comprise two or more variable domains. For instance, the polypeptide chain(s) may comprise VD1-(X1).sub.n-VD2-(X2).sub.n-Fc, wherein VD1 is a first variable domain, VD2 is a second variable domain, Fc is a polypeptide chain of an Fc region, X1 and X2 represent an amino acid or peptide spacer, and n is 0 or 1.
(65) Conjugated Antibodies
(66) The antibodies disclosed herein may be conjugated antibodies which are bound to various molecules including macromolecular substances such as polymers (e.g., polyethylene glycol (PEG), polyethylenimine (PEI) modified with PEG (PEI-PEG), polyglutamic acid (PGA) (N-(2-Hydroxypropyl) methacrylamide (HPMA) copolymers), hyaluronic acid, fluorescent substances, luminescent substances, haptens, enzymes, metal chelates, and drugs.
(67) In one embodiment, to improve the cytotoxic actions of anti-v6 antibodies (and antigen-binding fragments thereof) and consequently their therapeutic effectiveness, the antibodies are conjugated with highly toxic substances, including radioisotopes and cytotoxic agents. These conjugates can deliver a toxic load selectively to the target site (i.e., cells expressing the antigen recognized by the antibody) while cells that are not recognized by the antibody are spared. In order to minimize toxicity, conjugates are generally engineered based on molecules with a short serum half-life (e.g., use of antibody fragments, murine sequences, and/or IgG3 or IgG4 isotypes). Exemplary radioisotopes include: .sup.90Y, .sup.125I, .sup.131I, .sup.123I, .sup.111I, .sup.105Rh, .sup.153Sm, .sup.67Cu, .sup.67Ga, .sup.166Ho, .sup.177Lu, .sup.186Re, and .sup.188Re. Cytotoxic agents that can be used include cytotoxic drugs which are used for cancer therapy. As used herein, a cytotoxic agent means any agent that is detrimental to the growth and proliferation of cells and may act to reduce, inhibit, or destroy a cell or malignancy. Exemplary cytotoxic agents include, but are not limited to, radionuclides, biotoxins, enzymatically active toxins, cytostatic or cytotoxic therapeutic agents (e.g., alkylating agents, antimetabolites, anti-proliferative agents, tubulin binding agents, hormones and hormone antagonists), prodrugs, immunologically active ligands and biological response modifiers such as cytokines. Any cytotoxin that acts to retard or slow the growth of immunoreactive cells or malignant cells is within the scope of the present invention. Exemplary cytostatics include alkylating substances, such as mechlorethamine, triethylenephosphoramide, cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan or triaziquone, also nitrosourea compounds, such as carmustine, lomustine, or semustine. In one embodiment, the cytotoxic agent that is conjugated to an antibody or antigen-binding fragment described herein is a maytansinoid. Maytansinoids are known in the art to include maytansine, maytansinol, C-3 esters of maytansinol, and other maytansinol analogues and derivatives (see, e.g., U.S. Pat. Nos. 5,208,020 and 6,441,163). C-3 esters of maytansinol can be naturally occurring or synthetically derived. Moreover, both naturally occurring and synthetic C-3 maytansinol esters can be classified as a C-3 ester with simple carboxylic acids, or a C-3 ester with derivatives of N-methyl-L-alanine, the latter being more cytotoxic than the former. Synthetic maytansinoid analogues also are known in the art and described in, for example, Kupchan et al., J. Med. Chem., 21, 31-37 (1978). Methods for generating maytansinol and analogues and derivatives thereof are described in, for example, U.S. Pat. No. 4,151,042. In certain embodiments, the maytansinoids comprise a linking moiety that contain a reactive chemical group (e.g., C-3 esters of maytansinol and its analogs where the linking moiety contains a disulfide bond and the attachment moiety comprises a N-succinimidyl or N-sulfosuccinimidyl ester). In certain embodiments, the maytansinoid conjugated with the antibodies or antigen-binding described herein is N.sup.2-deacetyl-N.sup.2-(-3-mercapto-1-oxopropyl)-maytansine (DM1) or N.sup.2-deacetyl-N.sup.2-(4-mercapto-4-methyl-1-oxopentyl)-maytansine (DM4). In certain other embodiments, cytotoxic agents include, for example, the anthracycline family of drugs, the vinca drugs, the mitomycins, the bleomycins, the cytotoxic nucleosides, the pteridine family of drugs, diynenes, and the podophyllotoxins. Particularly useful members of these families include, for example, adriamycin, carminomycin, daunorubicin (daunomycin), doxorubicin, aminopterin, methotrexate, methopterin, mithramycin, streptonigrin, dichloromethotrexate, mitomycin C, actinomycin-D, porfiromycin, 5-fluorouracil, floxuridine, ftorafur, 6-mercaptopurine, cytarabine, cytosine arabinoside, podophyllotoxin, or podophyllotoxin derivatives such as etoposide or etoposide phosphate, melphalan, vinblastine, vincristine, leurosidine, vindesine, leurosine and the like. In other embodiments, the cytotoxic agents include taxol, taxane, cytochalasin B, gramicidin D, ethidium bromide, emetine, tenoposide, colchicin, dihydroxy anthracin dione, mitoxantrone, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. Hormones and hormone antagonists, such as corticosteroids, e.g. prednisone, progestins, e.g. hydroxyprogesterone or medroprogesterone, estrogens, e.g. diethylstilbestrol, antiestrogens, e.g. tamoxifen, androgens, e.g. testosterone, and aromatase inhibitors, e.g. aminogluthetimide can also be conjugated with the antibodies or antigen-binding fragments thereof described herein. In certain embodiments, the cytotoxic agent comprises a member or derivative of the enediyne family of anti-tumor antibiotics, including calicheamicin, esperamicins, or dynemicins. These toxins are extremely potent and act by cleaving nuclear DNA, leading to cell death. Unlike protein toxins which can be cleaved in vivo to give many inactive but immunogenic polypeptide fragments, toxins such as calicheamicin, esperamicins, and other enediynes are small molecules which are essentially non-immunogenic. These non-peptide toxins are chemically-linked to the dimers or tetramers by techniques which have been previously used to label monoclonal antibodies and other molecules. These linking technologies include site-specific linkage via the N-linked sugar residues present only on the Fc portion of the constructs. Such site-directed linking methods have the advantage of reducing the possible effects of linkage on the binding properties of the constructs. In further embodiments, the antibodies or antigen-binding fragments thereof can also be associated with a biotoxin such as ricin subunit A, abrin, diptheria toxin, botulinum, cyanginosins, saxitoxin, shigatoxin, tetanus, tetrodotoxin, trichothecene, verrucologen, or a toxic enzyme. Such biotoxins can be made using genetic engineering techniques that allow for direct expression of the antibody-toxin construct. One skilled in the art could readily form such constructs using conventional techniques. Methods of conjugating cytotoxic agents are well known in the art (see, e.g., U.S. Pat. No. 8,021,661).
(68) In certain embodiments, an anti-v6 antibody or antigen-binding fragment thereof are modified with a moiety that improves its stabilization and/or retention in circulation, e.g., in blood, serum, or other tissues, e.g., by at least 1.5, 2, 5, 10, or 50 fold. For example, the anti-v6 antibody or antigen-binding fragment thereof can be associated with (e.g., conjugated to) a polymer, e.g., a substantially non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide. Suitable polymers will vary substantially by weight. Polymers having molecular number average weights ranging from about 200 to about 35,000 Daltons (or about 1,000 to about 15,000, and 2,000 to about 12,500) can be used. For example, the anti-v6 antibody or antigen-binding fragment thereof can be conjugated to a water soluble polymer, e.g., a hydrophilic polyvinyl polymer, e.g., polyvinylalcohol or polyvinylpyrrolidone. Examples of such polymers include polyalkylene oxide homopolymers such as polyethylene glycol (PEG) (see, e.g., Chapman et al., Nature Biotechnology, 17: 780-783 (1999), or polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and block copolymers thereof, provided that the water solubility of the block copolymers is maintained. Additional useful polymers include polyoxyalkylenes such as polyoxyethylene, polyoxypropylene, and block copolymers of polyoxyethylene and polyoxypropylene; polymethacrylates; carbomers; and branched or unbranched polysaccharides. The efficacy of a therapeutic antibody can be improved by increasing its serum persistence, thereby allowing higher circulating levels, less frequent administration, and reduced doses. The half-life of an IgG depends on its pH-dependent binding to the neonatal receptor FcRn. FcRn, which is expressed on the surface of endothelial cells, binds the IgG in a pH-dependent manner and protects it from degradation. Some antibodies that selectively bind the FcRn at pH 6.0, but not pH 7.4, exhibit a higher half-life in a variety of animal models. In certain embodiments, the antibodies of the present disclosure have one or more mutations at the interface between the CH2 and CH3 domains, such as T250Q/M428L and M252Y/S254T/T256E+H433K/N434F (the numbering is according to the EU index), which increase the binding affinity to FcRn and the half-life of IgG1 in vivo. In other embodiments, the antibodies herein have a modified Fc region comprising at least one modification relative to a wild-type human Fc region, where the modification is selected from the group consisting of 434S, 252Y/428L, 252Y/434S, and 428L/434S, and the numbering is according to the EU index.
(69) The antibodies or antigen-binding fragments thereof can also be conjugated to siRNAs, miRNAs, or anti-miRs to deliver the siRNA, miRNA, or anti-miR to cells expressing v6 (see, e.g., Song et al., Nat. Biotechnol., 23(6):709-17 (2005); Schneider et al., Molecular Therapy Nucleic Acids, 1:e46 (2012)). The siRNAs, miRNAs, or anti-miRs can target TGF- or components of the TGF- signaling pathway. In some embodiments, the siRNAs, miRNAs, or anti-miRs can target genes involved in the disease being treated (e.g., fibrosis, acute lung injury, acute kidney injury, cancer). For example, to treat fibrotic diseases, one or more of the following can be targeted to v6-expressing cells using humanized v6 antibodies or antigen-binding fragments thereof conjugated to: anti-miRs to microRNAs such as: miR-142-3p, miR-155, miR-192, miR-199a/b, miR-208, miR-21, miR-215, miR-216, miR-217, miR-23a, miR-27a, miR-27b, miR-32, miR-338, miR-34a, miR-377, miR-382; or conjugated to microRNAs such as: let-7d, miR-107, miR-132, miR-133, miR-141, miR-15b, miR-16, miR-150, miR-18a, miR-19a/b, miR-194, miR-200a/b, miR-204, miR-211, miR-26a/b, miR-29a/b/c, miR-30c, miR-335, miR-449a/b, and miR-590. In a specific embodiment, anti-miR-21 conjugated to humanized v6 antibodies or antigen-binding fragments thereof can be used to treat kidney fibrosis or cancer (e.g., hepatocellular carcinoma); and humanized v6 antibodies or antigen-binding fragments thereof conjugated to anti-miR-10b can be used to treat cancers such as glioblastoma.
(70) The antibodies or antigen-binding fragments thereof can also be conjugated to small molecules and other chemical moieties.
(71) The above-described conjugated antibodies can be prepared by performing chemical modifications on the antibodies or the lower molecular weight forms thereof described herein. Methods for modifying antibodies are well known in the art (e.g., U.S. Pat. No. 5,057,313 and U.S. Pat. No. 5,156,840).
(72) Methods of Producing Antibodies
(73) The v6 antibodies (or antibody binding fragments thereof) of this disclosure may be produced in bacterial or eukaryotic cells. Some antibodies, e.g., Fab's, can be produced in bacterial cells, e.g., E. coli cells. Antibodies can also be produced in eukaryotic cells such as transformed cell lines (e.g., CHO, 293E, COS). In addition, antibodies (e.g., scFv's) can be expressed in a yeast cell such as Pichia (see, e.g., Powers et al., J Immunol Methods. 251:123-35 (2001)), Hanseula, or Saccharomyces. To produce the antibody of interest, a polynucleotide encoding the antibody is constructed, introduced into an expression vector, and then expressed in suitable host cells. Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody.
(74) If the antibody is to be expressed in bacterial cells (e.g., E. coli), the expression vector should have characteristics that permit amplification of the vector in the bacterial cells. Additionally, when E. coli such as JM109, DH5, HB101, or XL1-Blue is used as a host, the vector must have a promoter, for example, a lacZ promoter (Ward et al., 341:544-546 (1989), araB promoter (Better et al., Science, 240:1041-1043 (1988)), or T7 promoter that can allow efficient expression in E. coli. Examples of such vectors include, for example, M13-series vectors, pUC-series vectors, pBR322, pBluescript, pCR-Script, pGEX-5X-1 (Pharmacia), QIAexpress system (QIAGEN), pEGFP, and pET (when this expression vector is used, the host is preferably BL21 expressing T7 RNA polymerase). The expression vector may contain a signal sequence for antibody secretion. For production into the periplasm of E. coli, the pelB signal sequence (Lei et al., J. Bacteriol., 169:4379 (1987)) may be used as the signal sequence for antibody secretion. For bacterial expression, calcium chloride methods or electroporation methods may be used to introduce the expression vector into the bacterial cell.
(75) If the antibody is to be expressed in animal cells such as CHO, COS, 293, 293T, and NIH3T3 cells, the expression vector includes a promoter necessary for expression in these cells, for example, an SV40 promoter (Mulligan et al., Nature, 277:108 (1979)), MMLV-LTR promoter, EF1 promoter (Mizushima et al., Nucleic Acids Res., 18:5322 (1990)), or CMV promoter. In addition to the nucleic acid sequence encoding the immunoglobulin or domain thereof, the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes. The selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017). For example, typically the selectable marker gene confers resistance to drugs, such as G418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced. Examples of vectors with selectable markers include pMAM, pDR2, pBK-RSV, pBK-CMV, pOPRSV, and pOP13.
(76) In one embodiment, antibodies are produced in mammalian cells. Exemplary mammalian host cells for expressing an antibody include Chinese Hamster Ovary (CHO cells) (including dhfr.sup. CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol. 159:601-621), human embryonic kidney 293 cells (e.g., 293, 293E, 293T), COS cells, NIH3T3 cells, lymphocytic cell lines, e.g., NS0 myeloma cells and SP2 cells, and a cell from a transgenic animal, e.g., a transgenic mammal. For example, the cell is a mammary epithelial cell.
(77) In an exemplary system for antibody expression, a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain of an anti-v6 antibody is introduced into dhfr.sup. CHO cells by calcium phosphate-mediated transfection. Within the recombinant expression vector, the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/AdMLP promoter regulatory element or an SV40 enhancer/AdMLP promoter regulatory element) to drive high levels of transcription of the genes. The recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification. The selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and the antibody is recovered from the culture medium.
(78) Antibodies can also be produced by a transgenic animal. For example, U.S. Pat. No. 5,849,992 describes a method of expressing an antibody in the mammary gland of a transgenic mammal A transgene is constructed that includes a milk-specific promoter and nucleic acids encoding the antibody of interest and a signal sequence for secretion. The milk produced by females of such transgenic mammals includes, secretedtherein, the antibody of interest. The antibody can be purified from the milk, or for some applications, used directly. Animals are also provided comprising one or more of the nucleic acids described herein.
(79) The antibodies of the present disclosure can be isolated from inside or outside (such as medium) of the host cell and purified as substantially pure and homogenous antibodies. Methods for isolation and purification commonly used for antibody purification may be used for the isolation and purification of antibodies, and are not limited to any particular method. Antibodies may be isolated and purified by appropriately selecting and combining, for example, column chromatography, filtration, ultrafiltration, salting out, solvent precipitation, solvent extraction, distillation, immunoprecipitation, SDS-polyacrylamide gel electrophoresis, isoelectric focusing, dialysis, and recrystallization. Chromatography includes, for example, affinity chromatography, ion exchange chromatography, hydrophobic chromatography, gel filtration, reverse-phase chromatography, and adsorption chromatography (Strategies for Protein Purification and Characterization: A Laboratory Course Manual. Ed Daniel R. Marshak et al., Cold Spring Harbor Laboratory Press, 1996). Chromatography can be carried out using liquid phase chromatography such as HPLC and FPLC. Columns used for affinity chromatography include protein A column and protein G column. Examples of columns using protein A column include Hyper D, POROS, and Sepharose FF (GE Healthcare Biosciences). The present disclosure also includes antibodies that are highly purified using these purification methods.
(80) Characterization of the Antibodies
(81) The v6-binding properties of the antibodies described herein may be measured by any standard method, e.g., one or more of the following methods: OCTET, Surface Plasmon Resonance (SPR), BIACORE analysis, Enzyme Linked Immunosorbent Assay (ELISA), EIA (enzyme immunoassay), RIA (radioimmunoassay), and Fluorescence Resonance Energy Transfer (FRET).
(82) The binding interaction of a protein of interest (an anti-v6 antibody) and a target (e.g., 6) can be analyzed using the OCTET systems. In this method, one of several variations of instruments (e.g., OCTET QK.sup.e and QK), made by the FortBio company are used to determine protein interactions, binding specificity, and epitope mapping. The OCTET systems provide an easy way to monitor real-time binding by measuring the changes in polarized light that travels down a custom tip and then back to a sensor.
(83) The binding interaction of a protein of interest (an anti-v6 antibody) and a target (e.g., 6) can be analyzed using Surface Plasmon Resonance (SPR). SPR or Biomolecular Interaction Analysis (BIA) detects biospecific interactions in real time, without labeling any of the interactants. Changes in the mass at the binding surface (indicative of a binding event) of the BIA chip result in alterations of the refractive index of light near the surface (the optical phenomenon of surface plasmon resonance (SPR)). The changes in the refractivity generate a detectable signal, which are measured as an indication of real-time reactions between biological molecules. Methods for using SPR are described, for example, in U.S. Pat. No. 5,641,640; Raether (1988) Surface Plasmons Springer Verlag; Sjolander and Urbaniczky (1991) Anal. Chem. 63:2338-2345; Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705 and on-line resources provide by BIAcore International AB (Uppsala, Sweden). Information from SPR can be used to provide an accurate and quantitative measure of the equilibrium dissociation constant (K.sub.d), and kinetic parameters, including K.sub.on and K.sub.off, for the binding of a biomolecule to a target.
(84) Epitopes can also be directly mapped by assessing the ability of different antibodies to compete with each other for binding to human v6 or 6 using BIACORE chromatographic techniques (Pharmacia BIAtechnology Handbook, Epitope Mapping, Section 6.3.2, (May 1994); see also Johne et al. (1993) J. Immunol. Methods, 160:191-198).
(85) When employing an enzyme immunoassay, a sample containing an antibody, for example, a culture supernatant of antibody-producing cells or a purified antibody is added to an antigen-coated plate. A secondary antibody labeled with an enzyme such as alkaline phosphatase is added, the plate is incubated, and after washing, an enzyme substrate such as p-nitrophenylphosphate is added, and the absorbance is measured to evaluate the antigen binding activity.
(86) Additional general guidance for evaluating antibodies, e.g., Western blots and immunoprecipitation assays, can be found in Antibodies: A Laboratory Manual, ed. by Harlow and Lane, Cold Spring Harbor press (1988)).
(87) Antibodies with Altered Effector Function
(88) The interaction of antibodies and antibody-antigen complexes with cells of the immune system triggers a variety of responses, referred to herein as effector functions. Immune-mediated effector functions include two major mechanisms: antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). Both of them are mediated by the constant region of the immunoglobulin protein. The antibody Fc domain is, therefore, the portion that defines interactions with immune effector mechanisms.
(89) IgG antibodies activate effector pathways of the immune system by binding to members of the family of cell surface Fc receptors and to Clq of the complement system. Ligation of effector proteins by clustered antibodies triggers a variety of responses, including release of inflammatory cytokines, regulation of antigen production, endocytosis, and cell killing. In some clinical applications these responses are crucial for the efficacy of a monoclonal antibody. In others they provoke unwanted side effects such as inflammation and the elimination of antigen-bearing cells. Accordingly, the present invention further relates to v6-binding proteins, including antibodies, with altered, e.g., increased or reduced effector functions.
(90) Effector function of an anti-v6 antibody of the present invention may be determined using one of many known assays. The anti-v6 antibody's effector function may be increased or reduced relative to a second anti-v6 antibody. In some embodiments, the second anti-v6 antibody may be any antibody that binds v6 specifically. In other embodiments, the second v6-specific antibody may be any of the antibodies of the invention, such as the antibodies described in Example 1. In other embodiments, where the anti-v6 antibody of interest has been modified to increase or reduce effector function, the second anti-v6 antibody may be the unmodified or parental version of the antibody.
(91) Effector functions include antibody-dependent cell-mediated cytotoxicity (ADCC), whereby antibodies bind Fc receptors on cytotoxic T cells, natural killer (NK) cells, or macrophages leading to cell death, and complement-dependent cytotoxicity (CDC), which is cell death induced via activation of the complement cascade (reviewed in Daeron, Annu. Rev. Immunol., 15:203-234 (1997); Ward and Ghetie, Therapeutic Immunol., 2:77-94 (1995); and Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991)). Such effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using standard assays that are known in the art (see, e.g., WO 05/018572, WO 05/003175, and U.S. Pat. No. 6,242,195).
(92) Effector functions can be avoided by using antibody fragments lacking the Fc domain such as Fab, Fab2, or single chain Fv. An alternative is to use the IgG4 subtype antibody, which binds to FcRI but which binds poorly to Clq and FcRII and RIII. The IgG2 subtype also has reduced binding to Fc receptors, but retains significant binding to the H131 allotype of FcRIIa and to Clq. Thus, additional changes in the Fc sequence are required to eliminate binding to all the Fc receptors and to Clq.
(93) Several antibody effector functions, including ADCC, are mediated by Fc receptors (FcRs), which bind the Fc region of an antibody. The affinity of an antibody for a particular FcR, and hence the effector activity mediated by the antibody, may be modulated by altering the amino acid sequence and/or post-translational modifications of the Fc and/or constant region of the antibody.
(94) FcRs are defined by their specificity for immunoglobulin isotypes; Fc receptors for IgG antibodies are referred to as FcR, for IgE as FcR, for IgA as FcR and so on. Three subclasses of FcR have been identified: FcRI (CD64), FcRII (CD32) and FcRIII (CD16). Both FcRII and FcRIII have two types: FcRIIA (CD32) and FcRIIB (CD32); and FcRIIIA (CD16a) and FcRIIIB (CD16b). Because each FcR subclass is encoded by two or three genes, and alternative RNA splicing leads to multiple transcripts, a broad diversity in FcR isoforms exists. For example, FcRII (CD32) includes the isoforms IIa, IIb1, IIb2 IIb3, and IIc.
(95) The binding site on human and murine antibodies for FcR has been previously mapped to the so-called lower hinge region consisting of residues 233-239 (EU index numbering as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), Woof et al., Molec. Immunol. 23:319-330 (1986); Duncan et al., Nature 332:563 (1988); Canfield and Morrison, J Exp. Med. 173:1483-1491 (1991); Chappel et al., Proc. Natl. Acad. Sci USA 88:9036-9040 (1991)). Of residues 233-239, P238 and 5239 are among those cited as possibly being involved in binding. Other previously cited areas possibly involved in binding to FcR are: G316-K338 (human IgG) for human FcRI (Woof et al., Mol. Immunol., 23:319-330 (1986)); K274-R301 (human IgG1) for human FcRIII (Sarmay et al., Molec. Immunol. 21:43-51 (1984)); and Y407-R416 (human IgG) for human FcRIII (Gergely et al., Biochem. Soc. Trans. 12:739-743 (1984) and Shields et al., J Biol Chem 276: 6591-6604 (2001), Lazar G A et al., Proc Natl Acad Sci 103: 4005-4010 (2006). These and other stretches or regions of amino acid residues involved in FcR binding may be evident to the skilled artisan from an examination of the crystal structures of Ig-FcR complexes (see, e.g., Sondermann et al. 2000 Nature 406(6793):267-73 and Sondermann et al. 2002 Biochem Soc Trans. 30(4):481-6). Accordingly, the anti-v6 antibodies of the present invention include modifications of one or more of the aforementioned residues (to increase or decrease effector function as needed).
(96) Another approach for altering monoclonal antibody effector function include mutating amino acids on the surface of the monoclonal antibody that are involved in effector binding interactions (Lund, J., et al. (1991) J. Immunol. 147(8): 2657-62; Shields, R. L. et al. (2001) J. Biol. Chem. 276(9): 6591-604).
(97) Methods of increasing effector function of antibodies are well known in the art (see, e.g., Kelley et al., Methods Mol. Biol., 901:277-93 (2012); Natsume et al., Drug Des Devel Ther., 3:7-16 (2009); U.S. Pat. No. 8,188,231, U.S. Pat. No. 7,960,512). In one embodiment, the v6 antibodies have one, two, three, four, five, six, seven, or more amino acid substitutions at a position selected from the group consisting of 221, 222, 223, 224, 225, 227, 228, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 246, 247, 249, 255, 258, 260, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 278, 280, 281, 282, 283, 284, 285, 286, 288, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 313, 317, 318, 320, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, and 337, wherein the numbering of the residues in the Fc region is that of the EU index as in Kabat. In certain embodiments, the v6 antibodies have one, two, three, four, five, six, seven, or more of the amino acid substitutions selected from the group consisting of: D221K, D221Y, K222E, K222Y, T223E, T223K, H224E, H224Y, T225E, T225K, T225W, P227E, P227G, P227K, P227Y, P228E, P228G, P228K, P228Y, P230A, P230E, P230G, P230Y, A231E, A231G, A231K, A231P, A231Y, P232E, P232G, P232K, P232Y, E233A, E233D, E233F, E233G, E233H, E233I, E233K, E233L, E233M, E233N, E233Q, E233R, E233S, E233T, E233V, E233W, E233Y, L234A, L234D, L234E, L234F, L234G, L234H, L234I, L234K, L234M, L234N, L234P, L234Q, L234R, L234S, L234T, L234V, L234W, L234Y, L235A, L235D, L235E, L235F, L235G, L235H, L235I, L235K, L235M, L235N, L235P, L235Q, L235R, L235S, L235T, L235V, L235W, L235Y, G236A, G236D, G236E, G236F, G236H, G236I, G236K, G236L, G236M, G236N, G236P, G236Q, G236R, G236S, G236T, G236V, G236W, G236Y, G237D, G237E, G237F, G237H, G237I, G237K, G237L, G237M, G237N, G237P, G237Q, G237R, G237S, G237T, G237V, G237W, G237Y, P238D, P238E, P238F, P238G, P238H, P238I, P238K, P238L, P238M, P238N, P238Q, P238R, P238S, P238T, P238V, P238W, P238Y, S239D, S239E, S239F, S239G, S239H, S239I, S239K, S239L, S239M, S239N, S239P, S239Q, S239R, S239T, S239V, S239W, S239Y, V240A, V240I, V240M, V240T, F241D, F241E, F241L, F241R, F241S, F241W, F241Y, F243E, F243H, F243L, F243Q, F243R, F243W, F243Y, P244H, P245A, K246D, K246E, K246H, K246Y, P247G, P247V, D249H, D249Q, D249Y, R255E, R255Y, E258H, E258S, E258Y, T260D, T260E, T260H, T260Y, V262A, V262E, V262F, V262I, V262T, V263A, V263I, V263M, V263T, V264A, V264D, V264E, V264F, V264G, V264H, V264I, V264K, V264L, V264M, V264N, V264P, V264Q, V264R, V264S, V264T, V264W, V264Y, D265F, D265G, D265H, D265I, D265K, D265L, D265M, D265N, D265P, D265Q, D265R, D265S, D265T, D265V, D265W, D265Y, V266A, V266I, V266M, V266T, S267D, S267E, S267F, S267H, S267I, S267K, S267L, S267M, S267N, S267P, S267Q, S267R, S267T, S267V, S267W, S267Y, H268D, H268E, H268F, H268G, H268I, H268K, H268L, H268M, H268P, H268Q, H268R, H268T, H268V, H268W, E269F, E269G, E269H, E269I, E269K, E269L, E269M, E269N, E269P, E269R, E269S, E269T, E269V, E269W, E269Y, D270F, D270G, D270H, D270I, D270L, D270M, D270P, D270Q, D270R, D270S, D270T, D270W, D270Y, P271A, P271D, P271E, P271F, P271G, P271H, P271I, P271K, P271L, P271M, P271N, P271Q, P271R, P271S, P271T, P271V, P271W, P271Y, E272D, E272F, E272G, E272H, E272I, E272K, E272L, E272M, E272P, E272R, E272S, E272T, E272V, E272W, E272Y, V273I, K274D, K274E, K274F, K274G, K274H, K274I, K274L, K274M, K274N, K274P, K274R, K274T, K274V, K274W, K274Y, F275L, F275W, N276D, N276E, N276F, N276G, N276H, N276I, N276L, N276M, N276P, N276R, N276S, N276T, N276V, N276W, N276Y, Y278D, Y278E, Y278G, Y278H, Y278I, Y278K, Y278L, Y278M, Y278N, Y278P, Y278Q, Y278R, Y278S, Y278T, Y278V, Y278W, D280G, D280K, D280L, D280P, D280W, G281D, G281E, G281K, G281N, G281P, G281Q, G281Y, V282E, V282G, V282K, V282P, V282Y, E283G, E283H, E283K, E283L, E283P, E283R, E283Y, V284D, V284E, V284L, V284N, V284Q, V284T, V284Y, H285D, H285E, H285K, H285Q, H285W, H285Y, N286E, N286G, N286P, N286Y, K288D, K288E, K288Y, K290D, K290H, K290L, K290N, K290W, P291D, P291E, P291G, P291H, P291I, P291Q, P291T, R292D, R292E, R292T, R292Y, E293F, E293G, E293H, E293I, E293L, E293M, E293N, E293P, E293R, E293S, E293T, E293V, E293W, E293Y, E294F, E294G, E294H, E294I, E294K, E294L, E294M, E294P, E294R, E294S, E294T, E294V, E294W, E294Y, Q295D, Q295E, Q295F, Q295G, Q295H, Q295I, Q295M, Q295N, Q295P, Q295R, Q295S, Q295T, Q295V, Q295W, Q295Y, Y296A, Y296D, Y296E, Y296G, Y296H, Y296I, Y296K, Y296L, Y296M, Y296N, Y296Q, Y296R, Y296S, Y296T, Y296V, N297D, N297E, N297F, N297G, N297H, N297I, N297K, N297L, N297M, N297P, N297Q, N297R, N297S, N297T, N297V, N297W, N297Y, S298D, S298E, S298F, S298H, S298I, S298K, S298M, S298N, S298Q, S298R, S298T, S298W, S298Y, T299A, T299D, T299E, T299F, T299G, T299H, T299I, T299K, T299L, T299M, T299N, T299P, T299Q, T299R, T299S, T299V, T299W, T299Y, Y300A, Y300D, Y300E, Y300G, Y300H, Y300K, Y300M, Y300N, Y300P, Y300Q, Y300R, Y300S, Y300T, Y300V, Y300W, R301D, R301E, R301H, R301Y, V3021, V303D, V303E, V303Y, S304D, S304H, S304L, S304N, S304T, V305E, V305T, V305Y, W313F, K317E, K317Q, E318H, E318L, E318Q, E318R, E318Y, K320D, K320F, K320G, K320H, K320I, K320L, K320N, K320P, K320S, K320T, K320V, K320W, K320Y, K322D, K322F, K322G, K322H, K322I, K322P, K322S, K322T, K322V, K322W, K322Y, V323I, S324D, S324F, S324G, S324H, S324I, S324L, S324M, S324P, S324R, S324T, S324V, S324W, S324Y, N325A, N325D, N325E, N325F, N325G, N325H, N325I, N325K, N325L, N325M, N325P, N325Q, N325R, N325S, N325T, N325V, N325W, N325Y, K326I, K326L, K326P, K326T, A327D, A327E, A327F, A327H, A327I, A327K, A327L, A327M, A327N, A327P, A327R, A327S, A327T, A327V, A327W, A327Y, L328A, L328D, L328E, L328F, L328G, L328H, L328I, L328K, L328M, L328N, L328P, L328Q, L328R, L328S, L328T, L328V, L328W, L328Y, P329D, P329E, P329F, P329G, P329H, P329I, P329K, P329L, P329M, P329N, P329Q, P329R, P329S, P329T, P329V, P329W, P329Y, A330E, A330F, A330G, A330H, A330I, A330L, A330M, A330N, A330P, A330R, A330S, A330T, A330V, A330W, A330Y, P331D, P331F, P331H, P331I, P331L, P331M, P331Q, P331R, P331T, P331V, P331W, P331Y, I332A, I332D, I332E, I332F, I332H, I332K, I332L, I332M, I332N, I332P, I332Q, I332R, I332S, I332T, I332V, I332W, I332Y, E333F, E333H, E333I, E333L, E333M, E333P, E333T, E333Y, K334F, K334I, K334L, K334P, K334T, T335D, T335F, T335G, T335H, T335I, T335L, T335M, T335N, T335P, T335R, T335S, T335V, T335W, T335Y, 1336E, I336K, I336Y, S337E, S337H, and S337N, wherein the numbering of the residues in the Fc region is that of the EU index as in Kabat. In a particular embodiment, the v6 antibodies comprise one, two, or three of the following mutations: S239D, S239D/I332E, S239D/I332E/A330L, S239D/I332E/G236A, S298A, A330L I332E, E333A, and K334A.
(98) The presence of oligosaccharidesspecifically, the N-linked oligosaccharide at asparigine-297 in the CH2 domain of IgG1is important for binding to FcR as well as Clq. Reducing the fucose content of antibodies improves effector function (see, e.g., U.S. Pat. No. 8,163,551). In certain embodiments the v6 antibodies have reduced fucosylation and amino acid substitutions that increase effector function (e.g., one, two, or three of the following mutations: S298A; E333A, and K334A). Effector function can also be achieved by preparing and expressing the anti-v6 antibodies described herein in the presence of alpha-mannosidase I inhibitors (e.g., kifunensine) at a concentration of the inhibitor of about 60-200 ng/mL (e.g., 60 ng/mL, 75 ng/mL, 100 ng/mL, 150 ng/ml). Antibodies expressed in the presence of alpha-mannosidase I inhibitors contain mainly oligomannose-type glycans and generally demonstrate increased ADCC activity and affinity for FcRIIIA, but reduced Clq binding.
(99) Anti-v6 antibodies of the present disclosure with increased effector function include antibodies with increased binding affinity for one or more Fc receptors (FcRs) relative to a parent or non-variant anti-v6 antibody. Accordingly, anti-v6 antibodies with increased FcR binding affinity includes anti-v6 antibodies that exhibit a 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, or 5-fold or higher increase in binding affinity to one or more Fc receptors compared to a parent or non-variant anti-v6 antibody. In some embodiments, an anti-v6 antibody with increased effector function binds to an FcR with about 10-fold greater affinity relative to a parent or non-variant antibody. In other embodiments, an anti-v6 antibody with increased effector function binds to an FcR with about 15-fold greater affinity or with about 20-fold greater affinity relative to a parent or non-variant antibody. The FcR receptor may be one or more of FcRI (CD64), FcRII (CD32), and FcRIII, and isoforms thereof, and FcR, FcR, FcR, and/or an FcR. In particular embodiments, an anti-v6 antibody with increased effector function exhibits a 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, or 5-fold or higher increase in binding affinity to FcRIIa.
(100) To reduce effector function, one can use combinations of different subtype sequence segments (e.g., IgG2 and IgG4 combinations) to give a greater reduction in binding to Fc receptors than either subtype alone (Armour et al., Eur. J. Immunol., 29:2613-1624 (1999); Mol. Immunol., 40:585-593 (2003)). In addition, sites of N-linked glycosylation can be removed as a means of reducing effector function. A large number of Fc variants having altered and/or reduced affinities for some or all Fc receptor subtypes (and thus for effector functions) are known in the art. See, e.g., US 2007/0224188; US 2007/0148171; US 2007/0048300; US 2007/0041966; US 2007/0009523; US 2007/0036799; US 2006/0275283; US 2006/0235208; US 2006/0193856; US 2006/0160996; US 2006/0134105; US 2006/0024298; US 2005/0244403; US 2005/0233382; US 2005/0215768; US 2005/0118174; US 2005/0054832; US 2004/0228856; US 2004/132101; US 2003/158389; see also U.S. Pat. Nos. 7,183,387; 6,737,056; 6,538,124; 6,528,624; 6,194,551; 5,624,821; 5,648,260. In certain embodiments amino acids at positions 232, 234, 235, 236, 237, 239, 264, 265, 267, 269, 270, 299, 325, 328, 329, and 330 (numbered according to Kabat) are substituted to reduce effector function. Non-limiting examples of substitutions that reduce effector function include one or more of: K322A; L234A/L235A; G236T; G236R; G236Q; H268A; H268Q; V309L; A330S; P331S; V234A/G237A/P238S/H268A/V309L/A330S/P331S; E233P/L234V/L235A/G236Q+A327G/A330S/P331S; and L235E+E318A/K320A/K322A.
(101) Anti-v6 antibodies of the present invention with reduced effector function include antibodies with reduced binding affinity for one or more Fc receptors (FcRs) relative to a parent or non-variant anti-v6 antibody. Accordingly, anti-v6 antibodies with reduced FcR binding affinity includes anti-v6 antibodies that exhibit a 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, or 5-fold or higher decrease in binding affinity to one or more Fc receptors compared to a parent or non-variant anti-v6 antibody. In some embodiments, an anti-v6 antibody with reduced effector function binds to an FcR with about 10-fold less affinity relative to a parent or non-variant antibody. In other embodiments, an anti-v6 antibody with reduced effector function binds to an FcR with about 15-fold less affinity or with about 20-fold less affinity relative to a parent or non-variant antibody. The FcR receptor may be one or more of FcRI (CD64), FcRII (CD32), and FcRIII, and isoforms thereof, and FcR, FcR, FcR, and/or an FcR. In particular embodiments, an anti-v6 antibody with reduced effector function exhibits a 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, or 5-fold or higher decrease in binding affinity to FcRIIa.
(102) In CDC, the antibody-antigen complex binds complement, resulting in the activation of the complement cascade and generation of the membrane attack complex. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen; thus the activation of the complement cascade is regulated in part by the binding affinity of the immunoglobulin to Clq protein. To activate the complement cascade, it is necessary for Clq to bind to at least two molecules of IgG1, IgG2, or IgG3, but only one molecule of IgM, attached to the antigenic target (Ward and Ghetie, Therapeutic Immunology 2:77-94 (1995) p. 80). To assess complement activation, a CDC assay, e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods, 202:163 (1996), may be performed.
(103) Various residues of the IgG molecule are involved in binding to Clq including the Glu318, Lys320 and Lys322 residues on the CH2 domain, amino acid residue 331 located on a turn in close proximity to the same beta strand, the Lys235 and Gly237 residues located in the lower hinge region, and residues 231 to 238 located in the N-terminal region of the CH2 domain (see e.g., Xu et al., J. Immunol. 150:152A (Abstract) (1993), WO94/29351; Tao et al, J. Exp. Med., 178:661-667 (1993); Brekke et al., Eur. J. Immunol., 24:2542-47 (1994); Burton et al; Nature, 288:338-344 (1980); Duncan and Winter, Nature 332:738-40 (1988); Idusogie et al J Immunol 164: 4178-4184 (2000; U.S. Pat. No. 5,648,260, and U.S. Pat. No. 5,624,821).
(104) Anti-v6 antibodies with improved Clq binding can comprise an amino acid substitution at one, two, three, or four of amino acid positions 326, 327, 333 and 334 of the human IgG Fc region, where the numbering of the residues in the IgG Fc region is that of the EU index as in Kabat. In one embodiment, the anti-v6 antibodies include the following amino acid substitutions: K326W/E333S, which are known to increase binding of an IgG1 antibody to Clq (Steurer W. et al., J Immunol., 155(3):1165-74 (1995)).
(105) Anti-v6 antibodies with reduced Clq binding can comprise an amino acid substitution at one, two, three, or four of amino acid positions 270, 322, 329 and 331 of the human IgG Fc region, where the numbering of the residues in the IgG Fc region is that of the EU index as in Kabat. As an example in IgG1, two mutations in the COOH terminal region of the CH2 domain of human IgG1K322A and P329Ado not activate the CDC pathway and were shown to result in more than a 100 fold decrease in Clq binding (U.S. Pat. No. 6,242,195).
(106) Accordingly, in certain embodiments, an anti-v6 antibody of the present invention exhibits increased or reduced binding to a complement protein relative to a second anti-v6 antibody. In certain embodiments, an anti-v6 antibody of the invention exhibits increased or reduced binding to Clq by a factor of about 1.5-fold or more, about 2-fold or more, about 3-fold or more, about 4-fold or more, about 5-fold or more, about 6-fold or more, about 7-fold or more, about 8-fold or more, about 9-fold or more, about 10-fold or more, or about 15-fold or more, relative to a second anti-v6 antibody.
(107) Thus, in certain embodiments of the invention, one or more of these residues may be modified, substituted, or removed or one or more amino acid residues may be inserted so as to increase or decrease CDC activity of the anti-v6 antibodies provided herein.
(108) In certain other embodiments, the present invention provides an anti-v6 antibody that exhibits reduced binding to one or more FcR receptors but that maintains its ability to bind complement (e.g., to a similar or, in some embodiments, to a lesser extent than a native, non-variant, or parent anti-v6 antibody). Accordingly, an anti-v6 antibody of the present invention may bind and activate complement while exhibiting reduced binding to an FcR, such as, for example, FcRIIa (e.g., FcRIIa expressed on platelets). Such an antibody with reduced or no binding to FcRIIa (such as FcRIIa expressed on platelets, for example) but that can bind Clq and activate the complement cascade to at least some degree will reduce the risk of thromboembolic events while maintaining perhaps desirable effector functions. In alternative embodiments, an anti-v6 antibody of the present invention exhibits reduced binding to one or more FcRs but maintains its ability to bind one or more other FcRs. See, for example, US 2007-0009523, 2006-0194290, 2005-0233382, 2004-0228856, and 2004-0191244, which describe various amino acid modifications that generate antibodies with reduced binding to FcRI, FcRII, and/or FcRIII, as well as amino acid substitutions that result in increased binding to one FcR but decreased binding to another FcR.
(109) Accordingly, effector functions involving the constant region of an anti-v6 antibody may be modulated by altering properties of the constant region, and the Fc region in particular. In certain embodiments, the anti-v6 antibody having increased or decreased effector function is compared with a second antibody with effector function and which may be a non-variant, native, or parent antibody comprising a native constant or Fc region that mediates effector function.
(110) A native sequence Fc or constant region comprises an amino acid sequence identical to the amino acid sequence of a Fc or constant chain region found in nature. Preferably, a control molecule used to assess relative effector function comprises the same type/subtype Fc region as does the test or variant antibody. A variant or altered Fc or constant region comprises an amino acid sequence which differs from that of a native sequence heavy chain region by virtue of at least one amino acid modification (such as, for example, post-translational modification, amino acid substitution, insertion, or deletion). Accordingly, the variant constant region may contain one or more amino acid substitutions, deletions, or insertions that results in altered post-translational modifications, including, for example, an altered glycosylation pattern. A parent antibody or Fc region is, for example, a variant having normal effector function used to construct a constant region (i.e., Fc) having altered, e.g., increased effector function.
(111) Antibodies with altered (e.g., increased) effector function(s) may be generated by engineering or producing antibodies with variant constant, Fc, or heavy chain regions. Recombinant DNA technology and/or cell culture and expression conditions may be used to produce antibodies with altered function and/or activity. For example, recombinant DNA technology may be used to engineer one or more amino acid substitutions, deletions, or insertions in regions (such as, for example, Fc or constant regions) that affect antibody function including effector functions. Alternatively, changes in post-translational modifications, such as, e.g. glycosylation patterns, may be achieved by manipulating the host cell and cell culture and expression conditions by which the antibody is produced.
(112) Certain embodiments of the present invention relate to an anti-v6 antibody comprising one or more heavy chain CDR sequences selected from VH CDR1 of SEQ ID NO:15, VH CDR2 of SEQ ID NO:16, and VH CDR3 of SEQ ID NO:17, wherein the antibody further comprises a variant Fc region that confers increased or reduced effector function compared to a native or parental Fc region. In further embodiments, the anti-v6 antibody comprises at least two of the CDRs, and in other embodiments the antibody comprises all three of the heavy chain CDR sequences.
(113) Other embodiments of the present invention relate to an anti-v6 antibody comprising one or more light chain CDR sequences selected from VL CDR1 of SEQ ID NO:18, VL CDR2 of SEQ ID NO:19, and VL CDR3 of SEQ ID NO:20 the antibody further comprising a variant Fc region that confers increased or reduced effector function compared to a native or parental Fc region. In further embodiments, the anti-v6 antibody comprises at least two of the light chain CDRs, and in other embodiments the antibody comprises all three of the light chain CDR sequences.
(114) In further embodiments of the present invention, the anti-v6 antibody with increased or reduced effector function comprises all three light chain CDR sequences (CDRs 1, 2, and 3) of SEQ ID NO:9 and comprises all three heavy chain CDR sequences (CDRs 1, 2, and 3) of SEQ ID NO:1. In certain embodiments, the anti-v6 antibody with increased or reduced effector function comprises: three or fewer, two or fewer, or one amino acid substitution in one, two, or three CDRs of SEQ ID NO:9 and three or fewer, two or fewer, or one amino acid substitution in one, two, or three CDRs of SEQ ID NO:1.
(115) In other embodiments, the invention relates to an anti-v6 antibody comprising a VL sequence selected from the group consisting of: SEQ ID NOs:9, 11, and 13, the antibody further comprising a variant Fc region that confers reduced effector function compared to a native or parental Fc region. In yet other embodiments, the invention relates to an anti-v6 antibody comprising a VH sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, and 7, the antibody further comprising a variant Fc region that confers reduced effector function compared to a native or parental Fc region.
(116) Anti-v6 Antibodies with Altered Glycosylation
(117) Glycan removal produces a structural change that should greatly reduce binding to all members of the Fc receptor family across species. In glycosylated antibodies, including anti-v6 antibodies, the glycans (oligosaccharides) attached to the conserved N-linked site in the CH2 domains of the Fc dimer are enclosed between the CH2 domains, with the sugar residues making contact with specific amino acid residues on the opposing CH2 domain. Different glycosylation patterns are associated with different biological properties of antibodies (Jefferis and Lund, 1997, Chem. Immunol., 65: 111-128; Wright and Morrison, 1997, Trends Biotechnol., 15: 26-32). Certain specific glycoforms confer potentially advantageous biological properties. Loss of the glycans changes spacing between the domains and increases their mobility relative to each other and is expected to have an inhibitory effect on the binding of all members of the Fc receptor family. For example, in vitro studies with various glycosylated antibodies have demonstrated that removal of the CH2 glycans alters the Fc structure such that antibody binding to Fc receptors and the complement protein C1Q are greatly reduced. Another known approach to reducing effector functions is to inhibit production of or remove the N-linked glycans at position 297 (EU numbering) in the CH2 domain of the Fc (Nose et al., 1983 PNAS 80: 6632; Leatherbarrow et al., 1985 Mol. Immunol. 22: 407; Tao et al., 1989 J. Immunol. 143: 2595; Lund et al., 1990 Mol. Immunol. 27: 1145; Dorai et al., 1991 Hybridoma 10:211; Hand et al., 1992 Cancer Immunol. Immunother. 35:165; Leader et al., 1991 Immunology 72: 481; Pound et al., 1993 Mol. Immunol. 30:233; Boyd et al., 1995 Mol. Immunol. 32: 1311). It is also known that different glycoforms can profoundly affect the properties of a therapeutic, including pharmacokinetics, pharmacodynamics, receptor-interaction and tissue-specific targeting (Graddis et al., 2002, Curr Pharm Biotechnol. 3: 285-297). In particular, for antibodies, the oligosaccharide structure can affect properties relevant to protease resistance, the serum half-life of the antibody mediated by the FcRn receptor, phagocytosis and antibody feedback, in addition to effector functions of the antibody (e.g., binding to the complement complex C1, which induces CDC, and binding to FcR receptors, which are responsible for modulating the ADCC pathway) (Nose and Wigzell, 1983; Leatherbarrow and Dwek, 1983; Leatherbarrow et al., 1985; Walker et al., 1989; Carter et al., 1992, PNAS, 89: 4285-4289).
(118) Accordingly, another means of modulating effector function of antibodies includes altering glycosylation of the antibody constant region. Altered glycosylation includes, for example, a decrease or increase in the number of glycosylated residues, a change in the pattern or location of glycosylated residues, as well as a change in sugar structure(s). The oligosaccharides found on human IgGs affects their degree of effector function (Raju, T. S. BioProcess International April 2003. 44-53); the microheterogeneity of human IgG oligosaccharides can affect biological functions such as CDC and ADCC, binding to various Fc receptors, and binding to Clq protein (Wright A. & Morrison S L. TIBTECH 1997, 15 26-32; Shields et al. J Biol Chem. 2001 276(9):6591-604; Shields et al. J Biol Chem. 2002; 277(30):26733-40; Shinkawa et al. J Biol Chem. 2003 278(5):3466-73; Umana et al. Nat Biotechnol. 1999 February; 17(2): 176-80). For example, the ability of IgG to bind Clq and activate the complement cascade may depend on the presence, absence or modification of the carbohydrate moiety positioned between the two CH2 domains (which is normally anchored at Asn297) (Ward and Ghetie, Therapeutic Immunology 2:77-94 (1995).
(119) Glycosylation sites in an Fc-containing polypeptide, for example an antibody such as an IgG antibody, may be identified by standard techniques. The identification of the glycosylation site can be experimental or based on sequence analysis or modeling data. Consensus motifs, that is, the amino acid sequence recognized by various glycosyl transferases, have been described. For example, the consensus motif for an N-linked glycosylation motif is frequently NXT or NXS, where X can be any amino acid except proline. Several algorithms for locating a potential glycosylation motif have also been described. Accordingly, to identify potential glycosylation sites within an antibody or Fc-containing fragment, the sequence of the antibody is examined, for example, by using publicly available databases such as the website provided by the Center for Biological Sequence Analysis (see NetNGlyc services for predicting N-linked glycosylation sites and NetOGlyc services for predicting O-linked glycosylation sites).
(120) In vivo studies have confirmed the reduction in the effector function of aglycosyl antibodies. For example, an aglycosyl anti-CD8 antibody is incapable of depleting CD8-bearing cells in mice (Isaacs, 1992 J. Immunol. 148: 3062) and an aglycosyl anti-CD3 antibody does not induce cytokine release syndrome in mice or humans (Boyd, 1995 supra; Friend, 1999 Transplantation 68:1632).
(121) Importantly, while removal of the glycans in the CH2 domain appears to have a significant effect on effector function, other functional and physical properties of the antibody remain unaltered. Specifically, it has been shown that removal of the glycans had little to no effect on serum half-life and binding to antigen (Nose, 1983 supra; Tao, 1989 supra; Dorai, 1991 supra; Hand, 1992 supra; Hobbs, 1992 Mol. Immunol. 29:949).
(122) Although there is in vivo validation of the aglycosyl approach, there are reports of residual effector function with aglycosyl mAbs (see, e.g., Pound, J. D. et al. (1993) Mol. Immunol. 30(3): 233-41; Dorai, H. et al. (1991) Hybridoma 10(2): 211-7). Armour et al. show residual binding to FcRIIa and FcRIIb proteins (Eur. J. Immunol. (1999) 29: 2613-1624; Mol. Immunol. 40 (2003) 585-593). Thus a further decrease in effector function, particularly complement activation, may be important to guarantee complete ablation of activity in some instances. For that reason, aglycosyl forms of IgG2 and IgG4 and a G1/G4 hybrid are envisioned as being useful in methods and antibody compositions of the invention having reduced effector functions.
(123) The anti-v6 antibodies of the present invention may be modified or altered to elicit reduced effector function(s) (compared to a second v6-specific antibody) while optionally retaining the other valuable attributes of the Fc portion.
(124) Accordingly, in certain embodiments, the present invention relates to aglycosyl anti-v6 antibodies with decreased effector function, which are characterized by a modification at the conserved N-linked site in the CH2 domains of the Fc portion of the antibody. A modification of the conserved N-linked site in the CH2 domains of the Fc dimer can lead to aglycosyl anti-v6 antibodies. Examples of such modifications include mutation of the conserved N-linked site in the CH2 domains of the Fc dimer, removal of glycans attached to the N-linked site in the CH2 domains, and prevention of glycosylation. For example, an aglycosyl anti-v6 antibody may be created by changing the canonical N-linked Asn site in the heavy chain CH2 domain to a Gln residue (see, for example, WO 05/03175 and US 2006-0193856).
(125) In one embodiment of present invention, the modification comprises a mutation at the heavy chain glycosylation site to prevent glycosylation at the site. Thus, in one embodiment of this invention, the aglycosyl anti-v6 antibodies are prepared by mutation of the heavy chain glycosylation site, i.e., mutation of N298Q (N297 using Kabat EU numbering) and expressed in an appropriate host cell. For example, this mutation may be accomplished by following the manufacturer's recommended protocol for unique site mutagenesis kit from Amersham-Pharmacia Biotech (Piscataway, N.J., USA).
(126) The mutated antibody can be stably expressed in a host cell (e.g. NSO or CHO cell) and then purified. As one example, purification can be carried out using Protein A and gel filtration chromatography. It will be apparent to those of skill in the art that additional methods of expression and purification may also be used.
(127) In another embodiment of the present invention, the aglycosyl anti-v6 antibodies have decreased effector function, wherein the modification at the conserved N-linked site in the CH2 domains of the Fc portion of said antibody or antibody derivative comprises the removal of the CH2 domain glycans, i.e., deglycosylation. These aglycosyl anti-v6 antibodies may be generated by conventional methods and then deglycosylated enzymatically. Methods for enzymatic deglycosylation of antibodies are well known to those of skill in the art (Williams, 1973; Winkelhake & Nicolson, 1976 J. Biol Chem. 251:1074-80.).
(128) In another embodiment of this invention, deglycosylation may be achieved by growing host cells which produce the antibodies in culture medium comprising a glycosylation inhibitor such as tunicamycin (Nose & Wigzell, 1983). That is, the modification is the reduction or prevention of glycosylation at the conserved N-linked site in the CH2 domains of the Fc portion of said antibody.
(129) In other embodiments of this invention, recombinant X polypeptides (or cells or cell membranes containing such polypeptides) may be used as an antigen to generate an anti-v6 antibody or antibody derivatives, which may then be deglycosylated.
(130) In alternative embodiments, agyclosyl anti-v6 antibodies or anti-v6 antibodies with reduced glycosylation may be produced by the method described in Taylor et al. (WO 05/18572 and US 2007-0048300). For example, in one embodiment, an anti-v6 aglycosyl antibody may be produced by altering a first amino acid residue (e.g., by substitution, insertion, deletion, or by chemical modification), wherein the altered first amino acid residue inhibits the glycosylation of a second residue by either steric hindrance or charge or both. In certain embodiments, the first amino acid residue is modified by amino acid substitution. In further embodiments, the amino acid substitution is selected from the group consisting of Gly, Ala, Val, Leu, Ile, Phe, Asn, Gln, Trp, Pro, Ser, Thr, Tyr, Cys, Met, Asp, Glu, Lys, Arg, and His. In other embodiments, the amino acid substitution is a non-traditional amino acid residue. The second amino acid residue may be near or within a glycosylation motif, for example, an N-linked glycosylation motif that contains the amino acid sequence NXT or NXS. In one exemplary embodiment, the first amino acid residue is amino acid 299 and the second amino acid residue is amino acid 297, according to the Kabat numbering. For example, the first amino acid substitution may be T299A, T299N, T299G, T299Y, T299C, T299H, T299E, T299D, T299K, T299R, T299G, T299I, T299L, T299M, T299F, T299P, T299W, and T299V, according to the Kabat numbering. In particular embodiments, the amino acid substitution is T299C.
(131) Effector function may also be reduced by modifying an antibody of the present invention such that the antibody contains a blocking moiety. Exemplary blocking moieties include moieties of sufficient steric bulk and/or charge such that reduced glycosylation occurs, for example, by blocking the ability of a glycosidase to glycosylate the polypeptide. The blocking moiety may additionally or alternatively reduce effector function, for example, by inhibiting the ability of the Fc region to bind a receptor or complement protein. In some embodiments, the present invention relates to an v6-binding protein, e.g., an anti-v6 antibody, comprising a variant Fc region, the variant Fc region comprising a first amino acid residue and an N-glycosylation site, the first amino acid residue modified with side chain chemistry to achieve increased steric bulk or increased electrostatic charge compared to the unmodified first amino acid residue, thereby reducing the level of or otherwise altering glycosylation at the N-glycosylation site. In certain of these embodiments, the variant Fc region confers reduced effector function compared to a control, non-variant Fc region. In further embodiments, the side chain with increased steric bulk is a side chain of an amino acid residue selected from the group consisting of Phe, Trp, His, Glu, Gln, Arg, Lys, Met and Tyr. In yet further embodiments, the side chain chemistry with increased electrostatic charge is a side chain of an amino acid residue selected from the group consisting of Asp, Glu, Lys, Arg, and His.
(132) Accordingly, in one embodiment, glycosylation and Fc binding can be modulated by substituting T299 with a charged side chain chemistry such as D, E, K, or R. The resulting antibody will have reduced glycosylation as well as reduced Fc binding affinity to an Fc receptor due to unfavorable electrostatic interactions.
(133) In another embodiment, a T299C variant antibody, which is both aglycosylated and capable of forming a cysteine adduct, may exhibit less effector function (e.g., FcRI binding) compared to its aglycosylated antibody counterpart (see, e.g., WO 05/18572). Accordingly, alteration of a first amino acid proximal to a glycosylation motif can inhibit the glycosylation of the antibody at a second amino acid residue; when the first amino acid is a cysteine residue, the antibody may exhibit even further reduced effector function. In addition, inhibition of glycosylation of an antibody of the IgG4 subtype may have a more profound affect on FcRI binding compared to the effects of agycosylation in the other subtypes.
(134) In additional embodiments, the present invention relates to anti-v6 antibodies with altered glycosylation that exhibit reduced binding to one or more FcR receptors and that optionally also exhibit increased or normal binding to one or more Fc receptors and/or complemente.g., antibodies with altered glycosylation that at least maintain the same or similar binding affinity to one or more Fc receptors and/or complement as a native, control anti-v6 antibody). For example, anti-v6 antibodies with predominantly Man.sub.5GlcNAc.sub.2N-glycan as the glycan structure present (e.g., wherein Man.sub.5GlcNAc.sub.2N-glycan structure is present at a level that is at least about 5 mole percent more than the next predominant glycan structure of the Ig composition) may exhibit altered effector function compared to an anti-v6 antibody population wherein Man.sub.5GlcNAc.sub.2N-glycan structure is not predominant Antibodies with predominantly this glycan structure exhibit decreased binding to FcRIIa and FcRIIb, increased binding to FcRIIIa and FcRIIIb, and increased binding to Clq subunit of the C1 complex (see US 2006-0257399). This glycan structure, when it is the predominant glycan structure, confers increased ADCC, increased CDC, increased serum half-life, increased antibody production of B cells, and decreased phagocytosis by macrophages.
(135) In general, the glycosylation structures on a glycoprotein will vary depending upon the expression host and culturing conditions (Raju, T S. BioProcess International April 2003. 44-53). Such differences can lead to changes in both effector function and pharmacokinetics (Israel et al. Immunology. 1996; 89(4):573-578; Newkirk et al. P. Clin. Exp. 1996; 106(2):259-64). For example, galactosylation can vary with cell culture conditions, which may render some immunoglobulin compositions immunogenic depending on their specific galactose pattern (Patel et al., 1992. Biochem J. 285: 839-845). The oligosaccharide structures of glycoproteins produced by non-human mammalian cells tend to be more closely related to those of human glycoproteins. Further, protein expression host systems may be engineered or selected to express a predominant Ig glycoform or alternatively may naturally produce glycoproteins having predominant glycan structures. Examples of engineered protein expression host systems producing a glycoprotein having a predominant glycoform include gene knockouts/mutations (Shields et al., 2002, JBC, 277: 26733-26740); genetic engineering in (Umana et al., 1999, Nature Biotech., 17: 176-180) or a combination of both. Alternatively, certain cells naturally express a predominant glycoformfor example, chickens, humans and cows (Raju et al., 2000, Glycobiology, 10: 477-486). Thus, the expression of an anti-v6 antibody or antibody composition having altered glycosylation (e.g., predominantly one specific glycan structure) can be obtained by one skilled in the art by selecting at least one of many expression host systems. Protein expression host systems that may be used to produce anti-v6 antibodies of the present invention include animal, plant, insect, bacterial cells and the like. For example, US 2007-0065909, 2007-0020725, and 2005-0170464 describe producing aglycosylated immunoglobulin molecules in bacterial cells. As a further example, Wright and Morrison produced antibodies in a CHO cell line deficient in glycosylation (1994 J Exp Med 180: 1087-1096) and showed that antibodies produced in this cell line were incapable of complement-mediated cytolysis. Other examples of expression host systems found in the art for production of glycoproteins include: CHO cells: Raju WO 99/22764 and Presta WO 03/35835; hybridoma cells: Trebak et al., 1999, J. Immunol. Methods, 230: 59-70; insect cells: Hsu et al., 1997, JBC, 272:9062-970, and plant cells: Gerngross et al., WO 04/74499. To the extent that a given cell or extract has resulted in the glycosylation of a given motif, art recognized techniques for determining if the motif has been glycosylated are available, for example, using gel electrophoresis and/or mass spectroscopy.
(136) Additional methods for altering glycosylation sites of antibodies are described, e.g., in U.S. Pat. No. 6,350,861 and U.S. Pat. No. 5,714,350, WO 05/18572 and WO 05/03175; these methods can be used to produce anti-v6 antibodies of the present invention with altered, reduced, or no glycosylation.
(137) The aglycosyl anti-v6 antibodies with reduced effector function may be antibodies that comprise modifications or that may be conjugated to comprise a functional moiety. Such moieties include a blocking moiety (e.g., a PEG moiety, cysteine adducts, etc.), a detectable moiety (e.g., fluorescent moieties, radioisotopic moieties, radiopaque moieties, etc., including diagnostic moieties), a therapeutic moiety (e.g., cytotoxic agents, anti-inflammatory agents, immunomodulatory agents, anti-infective agents, anti-cancer agents, anti-neurodegenerative agents, radionuclides, etc.), and/or a binding moiety or bait (e.g., that allows the antibody to be pre-targeted to a tumor and then to bind a second molecule, composed of the complementary binding moiety or prey and a detectable moiety or therapeutic moiety, as described above).
(138) Indications
(139) The anti-v6 antibodies or antigen-binding fragments thereof described herein can be used in the diagnosis and treatment, including prevention, of v6-mediated diseases. The antibodies or antigen-binding fragments thereof can be conjugated to an agent (e.g., cytotoxic agent, siRNA, miRNA, anti-miR, small molecule, or other chemical moiety) that is useful to treat or prevent the disease being treated or prevented with the anti-v6 antibodies or antigen-binding fragments thereof. In some embodiments, the antibodies or antigen-binding fragments thereof described herein can be used as anti-fibrotics. In other embodiments, the antibodies or antigen-binding fragments thereof described herein can be used to protect against epithelial (e.g., acute tissue injury of the lung, kidney, or liver) and/or endothelial cell injury. In certain embodiments, the antibodies or antigen-binding fragments thereof described herein can be used to reduce or prevent alveolar epithelial injury. In yet other embodiments, the antibodies or antigen-binding fragments thereof described herein can be used to treat cancer.
(140) The antibodies or antigen-binding fragments thereof of this disclosure can be used to diagnose, treat, or prevent fibrosis (e.g., lung fibrosis (e.g., idiopathic pulmonary fibrosis (IPF); usual interstitial pneumonia (UIP)), kidney fibrosis, or liver fibrosis), acute lung injury, acute kidney injury, acute liver injury, Alport's Syndrome, scleroderma, sarcoidosis, amyloidosis, histiocytosis X, idiopathic nephrotic syndrome, idiopathic membranoproliferative glomerulonephritis, idiopathic restrictive cardiomyopathy, and cancer (e.g., pancreatic, lung, breast, colorectal, head and neck, esophageal, skin, prostate, cervical, ovarian, kidney, or endometrial cancer) among other diseases and disorders.
(141) In some embodiments, the antibodies or antigen-binding fragments thereof described herein can be used to treat lung diseases associated with injury/fibrosis such as, but not limited to, idiopathic pulmonary fibrosis, radiation induced fibrosis, flu induced fibrosis, coagulation induced fibrosis, vascular injury induced fibrosis, lung disease with usual interstitial pneumonia, chronic obstructive pulmonary disease (COPD), scleroderma, bleomycin induced fibrosis, asthma (e.g., chronic asthma), silicosis, asbestos induced fibrosis, acute lung injury and acute respiratory distress, (including bacterial pneumonia induced, trauma induced, viral pneumonia induced, ventilator induced, non-pulmonary sepsis induced and aspiration induced). The antibodies described herein can also be used to treat chronic nephropathies associated with injury/fibrosis such as, but not limited to, lupus, diabetes, scleroderma, glomerular nephritis, focal segmental glomerular sclerosis, IgA nephropathy, hypertension, allograft and Alport's disease. The antibodies can also be used to treat gut fibrosis, scleroderma, and radiation-induced fibrosis. The antibodies can also be used to treat liver fibrosis such as, but not limited to, biliary duct injury induced fibrosis. The antibodies described herein can also be used to treat kidney fibrosis disease, such as in a human subject with diabetes or focal segmental glomerular sclerosis (FSGS). In certain embodiments, the antibodies described herein can also be used to treat acute exacerbations of idiopathic pulmonary fibrosis. Other indications which the antibodies described herein can be used to treat include head and neck fibrosis, radiation induced fibrosis, corneal scarring, LASIX, corneal transplant, trabeculectomy, hypertrophic scarring, burn induced fibrosis, surgical fibrosis, sarcoidosis, psoriasis, and spinal cord injury/fibrosis.
(142) The antibodies or antigen-binding fragments thereof described herein are also useful in treating cancer or cancer metastasis (including tumor growth and invasion), particularly epithelial cancers. A subset of epithelial cancers includes squamous cell carcinoma, e.g., head and neck (including oral, laryngeal, pharyngeal, esophageal), breast, lung, prostate, cervical, colon, pancreatic, skin (basal cell carcinomas) and ovarian cancers. v6 is highly expressed in many epithelial cancers, especially on the leading edge of the tumors.
(143) The present disclosure includes methods of treating or preventing metastatic cancers by identifying pre-invasive lesions or carcinomas in patients, and treating the patient to eliminate the pre-invasive lesion before it has the opportunity to evolve into an invasive form. Such methods comprise, for example, (a) obtaining a tissue sample that is suspected of containing a cancer or a pre-invasive lesion, and a tissue sample that does not contain a cancer or pre-invasive lesion (preferably from the same tissue or organ as that suspected of containing a cancer or pre-invasive lesion); (b) contacting the tissue samples with one or more v6-binding ligands, such as one or more v6-binding antibodies or antigen-binding fragments thereof, under conditions favoring the binding of the one or more v6-binding antibodies or antigen-binding fragments thereof to v6 integrins in the tissue wherever present; and (c) detecting the level or pattern of binding of the v6-binding ligand(s) to the tissue, wherein an increase in the localized binding of the v6-binding ligand in the myoepithelium surrounding a hyperplasia (e.g., a tumor) relative to the binding in the hyperplasia itself (or cells thereof), or an increase in the level of binding of the v6-binding ligand in the tissue sample containing the cancerous or pre-invasive lesion relative to the binding in the non-cancerous tissue sample (or cells thereof), is indicative of carcinoma that is more likely to become invasive and potentially metastasize. In other related embodiments, the invention contemplates methods of reducing or preventing the progression of a pre-metastatic or pre-invasive tumor to a metastatic or invasive tumor in a patient, comprising administering to the patient a therapeutically effective amount of one or more ligands that bind to one or more subunits of integrin v6 on one or more cells in the pre-metastatic or pre-invasive tumor, wherein the binding of the ligand to the integrin results in the reduction or prevention of invasion of cells of the pre-metastatic or pre-invasive cancer into tissue areas surrounding the primary tumor. In other embodiments, the methods of the invention are suitable for eliminating residual tumor cells, e.g., of residual metastatic cells, following removal, treatment or eradication of a tumor by a different approach. For example, such methods can be used to eliminate residual tumor cells or metastatic cells that may remain in the patient following surgical excision of a tumor, or tumor eradication by methods such as irradiation, chemotherapy and the like. In such therapeutic regimens, the methods of the invention may comprise administering the v6-binding antibodies or antigen-binding fragments thereof, to a patient prior to, during, and/or following surgical, radiological and/or chemotherapeutic ablation of the tumor.
(144) The efficacy of the antibodies of the invention can be assessed in various animal models. Mouse models for lung fibrosis include bleomycin(Pittet et al., J. Clin. Invest., 107(12):1537-1544 (2001); and Munger et al., Cell, 96:319-328 (1999)) and irradiation-inducible lung fibrosis (Franko et al., Rad. Res., 140:347-355 (1994)). Mouse models for kidney fibrosis include COL4A3/ mice (see, e.g., Cosgrove et al., Amer. J Path., 157:1649-1659 (2000), mice with adriamycin-induced injury (Wang et al., Kidney International, 58: 1797-1804 (2000); Deman et al., Nephrol Dial Transplant, 16: 147-150 (2001)), db/db mice (Ziyadeh et al., Proc. Natl. Acad. Sci. USA, 97:8015-8020 (2000)), and mice with unilateral ureteral obstruction (Fogo et al., Lab Investigation, 81: 189A (2001); and Fogo et al., Journal of the American Society of Nephrology, 12:819 A (2001)). v6 antibodies described herein can be assessed for their ability to inhibit tumor growth, progression, and metastasis in standard in vivo tumor growth and metastasis models. See, e.g., Rockwell et al., J. Natl. Cancer Inst., 49:735 (1972); Guy et al., Mol. Cell Biol., 12:954 (1992); Wyckoff et al., Cancer Res., 60:2504 (2000); and Oft et al., Curr. Biol., 8:1243 (1998).
(145) The efficacy of treatments may be measured by a number of available diagnostic tools, including physical examination, blood tests, proteinuria measurements, creatinine levels and creatinine clearance, pulmonary function tests, plasma blood urea nitrogen (BUN) levels, observation and scoring of scarring or fibrotic lesions, deposition of extracellular matrix such as collagen, smooth muscle actin and fibronectin, kidney function tests, ultrasound, magnetic resonance imaging (MRI), and CT scan.
(146) Pharmaceutical Compositions
(147) An anti-v6 antibody or antigen-binding fragment thereof described herein can be formulated as a pharmaceutical composition for administration to a subject, e.g., to treat a disorder described herein. The anti-v6 antibody or antigen-binding fragment thereof may be conjugated (e.g., to a cytotoxic agent, siRNA, miRNA, anti-miR, small molecule, or other chemical moiety). Typically, a pharmaceutical composition includes a pharmaceutically acceptable carrier. As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. The composition can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19).
(148) Pharmaceutical formulation is a well-established art, and is further described, e.g., in Gennaro (ed.), Remington: The Science and Practice of Pharmacy, 20.sup.th ed., Lippincott, Williams & Wilkins (2000) (ISBN: 0683306472); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7.sup.th Ed., Lippincott Williams & Wilkins Publishers (1999) (ISBN: 0683305727); and Kibbe (ed.), Handbook of Pharmaceutical Excipients American Pharmaceutical Association, 3.sup.rd ed. (2000) (ISBN: 091733096X).
(149) The pharmaceutical compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. The preferred form can depend on the intended mode of administration and therapeutic application. Typically compositions for the agents described herein are in the form of injectable or infusible solutions.
(150) In one embodiment, an anti-v6 antibody described herein is formulated with excipient materials, such as sodium citrate, sodium dibasic phosphate heptahydrate, sodium monobasic phosphate, Tween-80, and a stabilizer. It can be provided, for example, in a buffered solution at a suitable concentration and can be stored at 2-8 C. In some other embodiments, the pH of the composition is between about 5.5 and 7.5 (e.g., 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5).
(151) The pharmaceutical compositions can also include agents that reduce aggregation of the v6 antibody or antigen-binding fragment thereof when formulated. Examples of aggregation reducing agents include one or more amino acids selected from the group consisting of methionine, arginine, lysine, aspartic acid, glycine, and glutamic acid. These amino acids may be added to the formulation to a concentration of about 0.5 mM to about 145 mM (e.g., 0.5 mM, 1 mM, 2 mM, 5 mM, 10 mM, 25 mM, 50 mM, 100 mM). The pharmaceutical compositions can also include a sugar (e.g., sucrose, trehalose, mannitol, sorbitol, or xylitol) and/or a tonicity modifier (e.g., sodium chloride, mannitol, or sorbitol) and/or a surfactant (e.g., polysorbate-20 or polysorbate-80).
(152) Such compositions can be administered by a parenteral mode (e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection). In one embodiment, the anti-v6 antibody or antigen-binding fragment thereof compositions are administered by inhalation. In one embodiment, the anti-v6 antibody or antigen-binding fragment thereof compositions are administered subcutaneously. In one embodiment, the anti-v6 antibody or antigen-binding fragment thereof compositions are administered intravenously. The phrases parenteral administration and administered parenterally as used herein mean modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
(153) The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable for stable storage at high concentration. Sterile injectable solutions can be prepared by incorporating an agent described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating an agent described herein into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze drying that yield a powder of an agent described herein plus any additional desired ingredient from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
(154) In certain embodiments, the anti-v6 antibody or antigen-binding fragment thereof may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York (1978).
(155) In one embodiment, the pharmaceutical formulation comprises an anti-v6 antibody or antigen-binding fragment thereof at a concentration of about 0.5 mg/mL to 500 mg/mL (e.g., 0.5 mg/mL, 1 mg/mL, 5 mg/mL, 10 mg/mL, 25 mg/mL, 30 mg/mL, 35 mg/mL, 40 mg/mL, 45 mg/mL, 50 mg/mL, 55 mg/mL, 60 mg/mL, 65 mg/mL, 70 mg/mL, 75 mg/mL, 80 mg/mL, 85 mg/mL, 90 mg/mL, 95 mg/mL, 100 mg/mL, 125 mg/mL, 150 mg/mL, 175 mg/mL, 200 mg/mL, 250 mg/mL, 300 mg/mL, 350 mg/mL, 400 mg/mL, 450 mg/mL, 500 mg/mL), formulated with a pharmaceutically acceptable carrier. In some embodiments, the anti-v6 antibody or antigen-binding fragment thereof is formulated in sterile distilled water or phosphate buffered saline. The pH of the pharmaceutical formulation may be between 5.5 and 7.5 (e.g., 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2 6.3, 6.4 6.5, 6.6 6.7, 6.8, 6.9 7.0, 7.1, 7.3, 7.4, 7.5).
(156) Administration
(157) The anti-v6 antibody or antigen-binding fragment thereof can be administered to a subject, e.g., a subject in need thereof, for example, a human subject, by a variety of methods. For many applications, the route of administration is one of: intravenous injection or infusion (IV), subcutaneous injection (SC), intraperitoneally (IP), or intramuscular injection. It is also possible to use intra-articular delivery or delivery using inhaled versions of the antibody. Other modes of parenteral administration can also be used. Examples of such modes include: intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, and epidural and intrasternal injection. In some cases, administration can be oral. In some cases, administration can be via inhalation.
(158) The route and/or mode of administration of the antibody or antigen-binding fragment thereof can also be tailored for the individual case, e.g., by monitoring the subject, e.g., using tomographic imaging, e.g., to visualize a tumor.
(159) The antibody or antigen-binding fragment thereof can be administered as a fixed dose, or in a mg/kg dose. The dose can also be chosen to reduce or avoid production of antibodies against the anti-v6 antibody. Dosage regimens are adjusted to provide the desired response, e.g., a therapeutic response or a combinatorial therapeutic effect. Generally, doses of the anti-v6 antibody or antigen binding fragment thereof (and optionally a second agent) can be used in order to provide a subject with the agent in bioavailable quantities. For example, doses in the range of 0.1-100 mg/kg, 0.5-100 mg/kg, 1 mg/kg-100 mg/kg, 0.5-20 mg/kg, 0.1-10 mg/kg, or 1-10 mg/kg can be administered. Other doses can also be used. In certain embodiments, a subject in need of treatment with an anti-v6 antibody or antigen binding fragment thereof is administered the antibody at a dose of 1 mg/kg to 30 mg/kg. In some embodiments, a subject in need of treatment with an anti-v6 antibody or antigen-binding fragment thereof is administered the antibody at a dose of 1 mg/kg, 2 mg/kg, 4 mg/kg, 5 mg/kg, 7 mg/kg 10 mg/kg, 12 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 28 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, or 50 mg/kg. In certain embodiments, a subject in need of treatment with a toxin-conjugated anti-v6 antibody or antigen binding fragment thereof is administered the toxin-conjugated antibody or antigen binding fragment thereof at a dose of 0.1 mg/kg to 30 mg/kg. In some embodiments, a subject in need of treatment with a toxin-conjugated anti-v6 antibody or antigen-binding fragment thereof is administered the toxin-conjugated antibody or antigen binding fragment thereof at a dose of 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.75 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 2 mg/kg, 4 mg/kg, 5 mg/kg, 7 mg/kg 10 mg/kg, 12 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 28 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, or 50 mg/kg. In a specific embodiment, the antibodies or antigen-binding fragments thereof are administered subcutaneously at a dose of 1 mg/kg to 3 mg/kg. In another embodiment, the antibodies or antigen-binding fragments thereof are administered intravenously at a dose of 4 mg/kg to 30 mg/kg. In certain embodiments, the toxin-conjugated versions of the antibodies or antigen-binding fragments thereof are administered intravenously at a dose of 0.1 mg/kg to 30 mg/kg.
(160) A composition may comprise about 1 mg/mL to 100 mg/ml or about 10 mg/mL to 100 mg/ml or about 50 to 250 mg/mL or about 100 to 150 mg/ml or about 100 to 250 mg/ml of anti-v6 antibody or an antigen-binding fragment thereof. In certain embodiments, the anti-v6 antibody or antigen-binding fragment thereof in a composition is predominantly in monomeric form, e.g., at least about 90%, 92%, 94%, 96%, 98%, 98.5% or 99% in monomeric form. Certain anti-v6 antibody or antigen-binding fragment thereof compositions may comprise less than about 5, 4, 3, 2, 1, 0.5, 0.3 or 0.1% aggregates, as detected, e.g., by UV at A280 nm. Certain anti-v6 antibody or antigen-binding fragment thereof compositions comprise less than about 5, 4, 3, 2, 1, 0.5, 0.3, 0.2 or 0.1% fragments, as detected, e.g., by UV at A280 nm.
(161) Dosage unit form or fixed dose as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of anti-v6 antibody calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier and optionally in association with the other agent. Single or multiple dosages may be given. Alternatively, or in addition, the antibody may be administered via continuous infusion.
(162) An anti-v6 antibody or antigen-binding fragment thereof dose can be administered, e.g., at a periodic interval over a period of time (a course of treatment) sufficient to encompass at least 2 doses, 3 doses, 5 doses, 10 doses, or more, e.g., once or twice daily, or about one to four times per week, or preferably weekly, biweekly (every two weeks), every three weeks, monthly, e.g., for between about 1 to 12 weeks, preferably between 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks. Factors that may influence the dosage and timing required to effectively treat a subject, include, e.g., the severity of the disease or disorder, formulation, route of delivery, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of a compound can include a single treatment or, preferably, can include a series of treatments.
(163) If a subject is at risk for developing a disorder described herein, the antibody can be administered before the full onset of the disorder, e.g., as a preventative measure. The duration of such preventative treatment can be a single dosage of the antibody or the treatment may continue (e.g., multiple dosages). For example, a subject at risk for the disorder or who has a predisposition for the disorder may be treated with the antibody for days, weeks, months, or even years so as to prevent the disorder from occurring or fulminating.
(164) A pharmaceutical composition may include a therapeutically effective amount of an agent described herein. Such effective amounts can be determined based on the effect of the administered agent, or the combinatorial effect of agents if more than one agent is used. A therapeutically effective amount of an agent may also vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual, e.g., amelioration of at least one disorder parameter or amelioration of at least one symptom of the disorder. A therapeutically effective amount is also one in which any toxic or detrimental effects of the composition are outweighed by the therapeutically beneficial effects.
(165) In certain embodiments, the anti-v6 antibody or antigen-binding fragment thereof is administered subcutaneously at a concentration of about 1 mg/mL to about 500 mg/mL (e.g., 1 mg/mL, 2 mg/mL, 3 mg/mL, 4 mg/mL, 5 mg/mL, 10 mg/mL, 15 mg/mL, 20 mg/mL, 25 mg/mL, 30 mg/mL, 35 mg/mL, 40 mg/mL, 45 mg/mL, 50 mg/mL, 55 mg/mL, 60 mg/mL, 65 mg/mL, 70 mg/mL, 75 mg/mL, 80 mg/mL, 85 mg/mL, 90 mg/mL, 95 mg/mL, 100 mg/mL, 125 mg/mL, 150 mg/mL, 175 mg/mL, 200 mg/mL, 225 mg/mL, 250 mg/mL, 275 mg/mL, 300 mg/mL, 325 mg/mL, 350 mg/mL, 400 mg/mL, 450 mg/mL). In one embodiment, the anti-v6 antibody or antigen-binding fragment thereof is administered subcutaneously at a concentration of 50 mg/mL. In another embodiment, the anti-v6 antibody or antigen-binding fragment thereof is administered intravenously at a concentration of about 1 mg/mL to about 500 mg/mL. In a particular embodiment, the anti-v6 antibody or antigen-binding fragment thereof is administered intravenously at a concentration of 50 mg/mL.
(166) The anti-v6 antibody or antigen-binding fragment thereof can be administered to a patient in need thereof (e.g., a patient with a fibrotic disorder) in combination with an antagonist (e.g., antibodies, polypeptide antagonists, and/or small molecule antagonists) of one or more: other integrin receptors (e.g., 11, 41, v8, v5, v1, v3, etc.); cytokines (e.g., TGF-, IL-4, IL-13, IL-17); chemokines (e.g., CCL2, CXCL8, CXCL12); growth factors (e.g., Connective tissue growth factor (CTGF), Platelet-derived growth factor (PDGF), Vascular endothelial growth factor (VEGF), Fibroblast growth factor (FGF), Insulin-like growth factor-1 (IGF-1)), and/or small secreted signaling proteins (e.g., Wnt proteins, endothelin-1). In certain embodiments, the anti-v6 antibody or antigen-binding fragment thereof is conjugated to a miRNA, siRNA, anti-miR, small molecule, cytotoxic agent, or other chemical moiety.
(167) Devices and Kits for Therapy
(168) Pharmaceutical compositions that include the anti-v6 antibody or antigen-binding fragment thereof can be administered with a medical device. The device can be designed with features such as portability, room temperature storage, and ease of use so that it can be used in emergency situations, e.g., by an untrained subject or by emergency personnel in the field, removed from medical facilities and other medical equipment. The device can include, e.g., one or more housings for storing pharmaceutical preparations that include anti-v6 antibody or antigen-binding fragment thereof, and can be configured to deliver one or more unit doses of the antibody. The device can be further configured to administer a second agent, e.g., a chemo therapeutic agent, either as a single pharmaceutical composition that also includes the anti-v6 antibody or antigen-binding fragment thereof or as two separate pharmaceutical compositions.
(169) The pharmaceutical composition may be administered with a syringe. The pharmaceutical composition can also be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. Many other devices, implants, delivery systems, and modules are also known.
(170) An anti-v6 antibody or antigen-binding fragment thereof can be provided in a kit. In one embodiment, the kit includes (a) a container that contains a composition that includes anti-v6 antibody, and optionally (b) informational material. The informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of the agents for therapeutic benefit.
(171) In an embodiment, the kit also includes a second agent for treating a disorder described herein (e.g., an antagonist (e.g., antibodies, polypeptide antagonists, and/or small molecule antagonists) of one or more: other integrin receptors (e.g., 11, 41, v8, v5, v1, v3, etc.); cytokines (e.g., TGF-, IL-4, IL-13, IL-17); chemokines (e.g., CCL2, CXCL8, CXCL12); growth factors (e.g., Connective tissue growth factor (CTGF), Platelet-derived growth factor (PDGF), Vascular endothelial growth factor (VEGF), Fibroblast growth factor (FGF), Insulin-like growth factor-1 (IGF-1)), LPA1 (lysophosphatidic acid receptor), LOX (lysyloxidase), LOXL2 (lysyloxidase 2), small secreted signaling proteins (e.g., Wnt proteins, endothelin-1) a steroid, a cytotoxic compound, a radioisotope, a prodrug-activating enzyme, colchicine, oxygen, an antioxidant (e.g., N-acetylcysteine), a metal chelator (e.g., terathiomolybdate), IFN-, IFN-, alpha-antitrypsin). For example, the kit includes a first container that contains a composition that includes the anti-v6 antibody, and a second container that includes the second agent.
(172) The informational material of the kits is not limited in its form. In one embodiment, the informational material can include information about production of the compound, molecular weight of the compound, concentration, date of expiration, batch or production site information, and so forth. In one embodiment, the informational material relates to methods of administering the anti-v6 antibody or antigen-binding fragment thereof, e.g., in a suitable dose, dosage form, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein), to treat a subject who has had or who is at risk for an immunological disorder described herein. The information can be provided in a variety of formats, include printed text, computer readable material, video recording, or audio recording, or information that provides a link or address to substantive material, e.g., on the internet.
(173) In addition to the antibody, the composition in the kit can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative. The antibody can be provided in any form, e.g., liquid, dried or lyophilized form, preferably substantially pure and/or sterile. When the agents are provided in a liquid solution, the liquid solution preferably is an aqueous solution. In certain embodiments, the antibody or antigen binding fragment thereof in the liquid solution is at a concentration of about 25 mg/mL to about 250 mg/mL (e.g., 40 mg/mL, 50 mg/mL, 60 mg/mL, 75 mg/mL, 85 mg/mL, 100 mg/mL, 125 mg/mL, 150 mg/mL, 200 mg/mL). When the antibody or antigen binding fragment is provided as a lyophilized product, the antibody or antigen binding fragment is at about 75 mg/vial to about 200 mg/vial (e.g., 100 mg/vial, 108.5 mg/vial, 125 mg/vial, 150 mg/vial). The lyophilized powder is generally reconstituted by the addition of a suitable solvent. The solvent, e.g., sterile water or buffer (e.g., PBS), can optionally be provided in the kit. In certain embodiments, the lyophilized product is at 108.5 mg/vial and reconstituted to a liquid solution at a concentration of 75 mg/mL.
(174) The kit can include one or more containers for the composition or compositions containing the agents. In some embodiments, the kit contains separate containers, dividers or compartments for the composition and informational material. For example, the composition can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet. In other embodiments, the separate elements of the kit are contained within a single, undivided container. For example, the composition is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label. In some embodiments, the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of the agents. The containers can include a combination unit dosage, e.g., a unit that includes both the anti-v6 antibody or antigen-binding fragment thereof and the second agent, e.g., in a desired ratio. For example, the kit includes a plurality of syringes, ampules, foil packets, blister packs, or medical devices, e.g., each containing a single combination unit dose. The containers of the kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
(175) The kit optionally includes a device suitable for administration of the composition, e.g., a syringe or other suitable delivery device. The device can be provided pre-loaded with one or both of the agents or can be empty, but suitable for loading.
(176) Diagnostic Uses
(177) Anti-v6 antibodies or antigen-binding fragments thereof can be used in a diagnostic method for detecting the presence of v6 in vivo (e.g., in vivo imaging in a subject). For example, anti-v6 antibodies can be administered to a subject to detect v6 within the subject. For example, the antibody can be labeled, e.g., with an MRI detectable label or a radiolabel. The subject can be evaluated using a means for detecting the detectable label. For example, the subject can be scanned to evaluate localization of the antibody within the subject. For example, the subject is imaged, e.g., by NMR or other tomographic means.
(178) Examples of labels useful for diagnostic imaging include radiolabels such as .sup.131I, .sup.111In, .sup.123I, .sup.99mTc, .sup.32P, .sup.33P, .sup.125I, .sup.3H, .sup.14C, and .sup.188Rh, fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance active labels, positron emitting isotopes detectable by a positron emission tomography (PET) scanner, chemiluminescers such as luciferin, and enzymatic markers such as peroxidase or phosphatase. Short-range radiation emitters, such as isotopes detectable by short-range detector probes, can also be employed. The protein ligand can be labeled with such reagents using known techniques. For example, see Wensel and Meares (1983) Radioimmunoimaging and Radioimmunotherapy, Elsevier, New York for techniques relating to the radiolabeling of antibodies and Colcher et al. (1986) Meth. Enzymol. 121: 802-816.
(179) The subject can be imaged in vivo using known techniques such as radionuclear scanning using e.g., a gamma camera or emission tomography. See e.g., A. R. Bradwell et al., Developments in Antibody Imaging, Monoclonal Antibodies for Cancer Detection and Therapy, R. W. Baldwin et al., (eds.), pp 65-85 (Academic Press 1985). Alternatively, a positron emission transaxial tomography scanner, such as designated Pet VI located at Brookhaven National Laboratory, can be used where the radiolabel emits positrons (e.g., .sup.11C, .sup.18F, .sup.15O, and .sup.13N).
(180) Magnetic Resonance Imaging (MRI) uses NMR to visualize internal features of living subject, and is useful for prognosis, diagnosis, treatment, and surgery. MRI can be used without radioactive tracer compounds for obvious benefit. Some MRI techniques are summarized in EPO 502 814 A. Generally, the differences related to relaxation time constants T1 and T2 of water protons in different environments are used to generate an image. However, these differences can be insufficient to provide sharp high resolution images.
(181) The differences in these relaxation time constants can be enhanced by contrast agents. Examples of such contrast agents include a number of magnetic agents, paramagnetic agents (which primarily alter T1) and ferromagnetic or superparamagnetic agents (which primarily alter T2 response). Chelates (e.g., EDTA, DTPA and NTA chelates) can be used to attach (and reduce toxicity) of some paramagnetic substances (e.g., Fe.sup.3+, Mn.sup.2+, Gd.sup.3+). Other agents can be in the form of particles, e.g., less than 10 m to about 10 nm in diameter). Particles can have ferromagnetic, anti-ferromagnetic or superparamagnetic properties. Particles can include, e.g., magnetite (Fe.sub.3O.sub.4), -Fe.sub.2O.sub.3, ferrites, and other magnetic mineral compounds of transition elements. Magnetic particles may include one or more magnetic crystals with and without nonmagnetic material. The nonmagnetic material can include synthetic or natural polymers (such as sepharose, dextran, dextrin, starch and the like).
(182) The anti-v6 antibodies or antigen-binding fragments thereof can also be labeled with an indicating group containing the NMR-active .sup.19F atom, or a plurality of such atoms inasmuch as (i) substantially all of naturally abundant fluorine atoms are the .sup.19F isotope and, thus, substantially all fluorine-containing compounds are NMR-active; (ii) many chemically active polyfluorinated compounds such as trifluoracetic anhydride are commercially available at relatively low cost, and (iii) many fluorinated compounds have been found medically acceptable for use in humans such as the perfluorinated polyethers utilized to carry oxygen as hemoglobin replacements. After permitting such time for incubation, a whole body MRI is carried out using an apparatus such as one of those described by Pykett (1982) Scientific American, 246:78-88 to locate and image v6 distribution.
(183) In another aspect, the disclosure provides a method for detecting the presence of v6 in a sample in vitro (e.g., a biological sample, such as serum, plasma, tissue, biopsy). This method can be used to diagnose a disorder, e.g., fibrosis (e.g., lung fibrosis or kidney fibrosis) or cancer (e.g., pancreatic, lung, breast, colorectal, head and neck, esophageal, skin, cervical, prostate, ovarian, kidney, or endometrial). The method includes: (i) contacting the sample or a control sample with the anti-v6 antibody; and (ii) evaluating the sample for the presence of v6, e.g., by detecting formation of a complex between the anti-v6 antibody and v6, or by detecting the presence of the antibody or v6. For example, the antibody can be immobilized, e.g., on a support, and retention of the antigen on the support is detected, and/or vice versa. The antibody used may be labeled e.g., with a fluorophore. A control sample can be included. The positive control can be a sample known to have the disease or disorder being assessed, and a negative control can be a sample from a subject who does not have the disease or disorder being assessed. A statistically significant change in the formation of the complex in the sample relative to the control sample can be indicative of the presence of v6 in the sample. Generally, an anti-v6 antibody can be used in applications that include fluorescence polarization, microscopy, ELISA, centrifugation, chromatography, and cell sorting (e.g., fluorescence activated cell sorting). In certain embodiments, the anti-v6 antibody is a humanized 2E5 antibody or an antigen-binding fragment thereof. The tissue sample can be, e.g., skin biopsies from human patients with cancer, e.g., pancreatic, lung, breast, colorectal, head and neck, esophageal, skin, cervical, prostate, ovarian, kidney, or endometrial.
(184) Cells from certain tumors that are metastatic express significantly enhanced levels of integrin v6 when compared to cells that are less metastatic or non-metastatic. In addition, certain forms of in situ carcinoma, e.g., ductal carcinoma in situ (DCIS) or lobular carcinoma in situ (LCIS) of the breast, the myoepithelium surrounding the tumor expresses significantly enhanced levels of integrin v6 relative to the tumor cells of the carcinoma and relative to normal breast tissue. Thus, the invention provides a method useful in diagnosing the metastatic potential of a tumor cell, including tumors from carcinomas such as an adenocarcinoma. In more particular embodiments, the carcinoma is a breast carcinoma, an endometrial carcinoma, a pancreatic carcinoma, a colorectal carcinoma, a lung carcinoma, an ovarian carcinoma, a cervical carcinoma, a prostatic carcinoma, a liver carcinoma, an esophageal carcinoma, a head and neck carcinoma, a stomach carcinoma or a splenic carcinoma. More particularly, the carcinoma is a breast carcinoma (including but not limited to an in situ breast carcinoma, such as ductal carcinoma in situ (DCIS) or lobular carcinoma in situ (LCIS)), an endometrial carcinoma, a pancreatic carcinoma, a colorectal carcinoma, a cervical carcinoma, or a lung carcinoma.
(185) Methods according to this aspect of the invention involve assaying the level of expression of v6 in the tumor cells or in the myoepithelium in a tissue sample, and comparing these expression levels with a control v6 expression level (e.g., in normal cells, non-metastatic cells, or normal tissue, preferably obtained from the same animal, such as a human patient), wherein an increase in the expression of v6 in a tumor or in the cells thereof is indicative of a higher invasive and/or metastatic potential of that tumor or cells thereof, or wherein an increase in the expression of v6 in the myoepithelium surrounding a tumor or epithelial cell cluster in a tissue section is indicative of the presence of an in situ carcinoma, e.g., DCIS or LCIS, that is more likely to become invasive and potentially form metastases.
(186) Where a diagnosis of a cancer has already been made according to conventional methods, the present invention is useful as a prognostic indicator, whereby tumor cells exhibiting increased levels of expression of v6 will be predicted to be more likely to become invasive and to metastasize from the primary tumor site to a distal, metastatic site. Similarly, where a suspected diagnosis of an in situ carcinoma has been made according to conventional methods (e.g., mammographic detection of calcified nodules in the breast), the present invention is useful as a confirmatory indicator, whereby biopsied tissue from the area of calcification exhibiting increased levels of expression of v6 in the myoepithelium indicates the presence of an in situ carcinoma, e.g., DCIS or LCIS that will become invasive and may respond to v6 antibody treatment. Based on such prognostic and diagnostic outcomes, the treating physician can then adjust the treatment regimen accordingly, thereby providing for earlier detection of a pre-metastatic or pre-cancerous condition and thus a more favorable clinical outcome for the patient.
(187) By assaying the levels of expression of v6 is intended qualitatively or quantitatively measuring or estimating the levels of v6 in a first biological sample (e.g., a tumor sample, a tissue biopsy or aspirate, etc.) either directly (e.g., by determining or estimating absolute amount of v6 in the sample) or relatively (e.g., by comparing the level of expression of v6 in a first biological sample to that in a second biological sample). Preferably, the level of v6 in the first biological sample is measured or estimated and compared to that in a standard taken from a second biological sample obtained from an individual not having a cancer or pre-cancerous lesion. As will be appreciated by one of ordinary skill in the art, once a standard v6 expression level is known for a given non-cancerous tissue, it can be used repeatedly as a standard for comparison.
(188) By biological sample is intended any biological sample obtained from an individual (such as a patient), cell line, tissue culture, or other source which may contain cells or cellular products such as extracellular matrix. Such biological samples include mammalian body tissues and cells, including leukocyte, ovary, prostate, heart, placenta, pancreas, liver, spleen, lung, breast, head and neck tissues (e.g., oral, pharyngeal, lingual and laryngeal tissues), endometrium, colon (or colorectal), cervix, stomach and umbilical tissues which may express v6. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art. Exemplary mammals include monkeys, apes, cats, dogs, cows, pigs, horses, rabbits and humans. In one embodiment, the mammal is a human.
(189) Assaying v6 expression levels in a biological sample can occur using any art-known method. Preferred for assaying v6 expression levels in a biological sample are immunological techniques. For example, v6 expression in tissues can be studied with classical immunohistological methods. In these, the specific recognition is provided by a primary ligand, e.g., an antibody (polyclonal or monoclonal), that binds to v6. This primary ligand can be labeled, e.g., with a fluorescent, chemiluminescent, phosphorescent, enzymatic or radioisotopic label. Alternatively, these methods of the invention can use a secondary detection system in which a second ligand that recognizes and binds to the v6-binding ligand, e.g., a so-called secondary antibody which recognizes and binds to a first v6-binding antibody, is detectably labeled as described above. As a result, an immunohistological staining of tissue section for pathological examination is obtained. Alternatively, tissues and cell samples can also be extracted, e.g., with urea and neutral detergent, for the liberation of v6 protein for Western-blot or dot/slot assay (Jalkanen, M., et al., J. Cell. Biol., 101:976-985 (1985); Jalkanen, M., et al., J. Cell. Biol., 105:3087-3096 (1987)) for direct quantitation, relative to a standard tissue or cell sample known to have lower levels of expression of v6.
(190) As noted above, the methods of the present invention are useful for detecting metastatic cancers in mammals, for determining the metastatic potential of a tumor cell (i.e., predicting the likelihood that a given tumor cell will metastasize from the primary tumor site to a distal metastatic site), and for determining the likelihood that a noninvasive or in situ carcinoma will progress to an invasive or metastatic carcinoma. In particular the methods of the invention are useful in detecting invasive and/or metastatic cancers of epithelial tissues (i.e., invasive and/or metastatic carcinomas), including of the breast, ovary, prostate, liver, lung, pancreas, colon (or colorectal), head and neck tissues (e.g., oral, pharyngeal, lingual and laryngeal tissues), endometrium, cervix, stomach and spleen. Particularly suitable to detection by the methods of the present invention are invasive and/or metastatic adenocarcinomas, including but not limited to breast carcinomas, pancreatic carcinomas, colorectal carcinomas, cervical carcinomas, lung carcinomas, and in situ carcinomas, such as certain ductal carcinoma in situ (DCIS) or lobular carcinoma in situ (LCIS) of the breast, that are of increased likelihood to progress to an invasive and/or metastatic phenotype. Early identification and treatment of such carcinomas is associated with a better long-term prognosis for patients. For example, it has been reported that if left untreated, a significant proportion of DCIS tumors become invasive and can lead to metastatic cancers which have a much poorer prognosis (see Sakorafas, G. H., and Tsiotou, A. G. H., Cancer Treatment Rev., 26:103-125 (2000)).
(191) The following are examples of the practice of the invention. They are not to be construed as limiting the scope of the invention in any way.
EXAMPLES
(192) The following examples are provided to better illustrate the claimed invention and are not to be interpreted as limiting the scope of the invention. To the extent that specific materials are mentioned, it is merely for purposes of illustration and is not intended to limit the invention. One skilled in the art can develop equivalent means or reactants without the exercise of inventive capacity and without departing from the scope of the invention.
Example 1: Humanized 2E5 Heavy and Light Chains
(193) Structural models of the V regions of the mouse anti-v6 antibody 2E5 were produced using Swiss PDB and analyzed in order to identify important constraining amino acids in the V regions that were likely to be essential for the binding properties of the antibody. Residues contained within the CDRs (using Kabat definition) together with a number of framework residues were considered to be important. Both the VH and V sequences of 2E5 contain typical framework residues and the CDR 1, 2 and 3 motifs are comparable to many murine antibodies.
(194) A set of sequence segments that could be used to create 2E5 Composite Human Antibody variants was selected and analyzed using iTope technology for in silico analysis of peptide binding to human MHC class II alleles (Perry et al., Drugs R D, 9(6):385-396 (2008)), and using the TCED of known antibody sequence-related T cell epitopes (Bryson et al., Biodrugs, 24(1):1-8 (2010)). Sequence segments that were identified as significant non-human germline binders to human MHC class II or that scored significant hits against the TCED were discarded. This resulted in a reduced set of segments, and combinations of these were again analyzed, as above, to ensure that the junctions between segments did not contain potential T cell epitopes. Selected segments were then combined to produce the four heavy and the three light chain V region sequences shown below.
(195) TABLE-US-00005 2E5VH1HeavyChainAminoAcidSequence (SEQIDNO:1) QVQLVQSGAELKKPGSSVKVSCKASGYVFTNYLIEWVKQAPGQGLEWIG VINPGTSITNYNEKFKGRATLTADKSTSTAYMQLSSLTSEDSAVYFCAT IYYGEFSHAVDSWGQGTSVTVSS 2E5VH1HeavyChainNucleotideSequence (SEQIDNO:2) CAGGTCCAGCTGGTGCAGTCTGGAGCTGAACTGAAAAAGCCTGGGTCTT CAGTGAAGGTGTCCTGCAAGGCTTCTGGATACGTCTTCACTAATTACTT GATAGAGTGGGTAAAGCAGGCCCCTGGACAGGGCCTTGAGTGGATTGGA GTGATTAATCCTGGAACCAGTATTACTAACTACAATGAGAAGTTCAAGG GCAGGGCAACACTGACTGCAGACAAGTCCACCAGCACTGCCTACATGCA GCTCAGCAGCCTGACATCTGAGGACTCTGCGGTTTATTTCTGTGCGACG ATCTACTATGGTGAATTTTCCCATGCTGTGGACTCCTGGGGTCAAGGAA CCTCAGTCACCGTCTCCTCA 2E5VH2HeavyChainAminoAcidSequence (SEQIDNO:3) QVQLVQSGAEVKKPGSSVKVSCKASGYVFTNYLIEWVRQAPGQGLEWIG VINPGTSITNYNEKFKGRATLTADKSTSTAYMELSSLRSEDTAVYFCAT IYYGEFSHAVDSWGQGTLVTVSS 2E5VH2HeavyChainNucleotideSequence (SEQIDNO:4) CAGGTCCAGCTGGTGCAGTCTGGAGCTGAAGTGAAAAAGCCTGGGTCTT CAGTGAAGGTGTCCTGCAAGGCTTCTGGATACGTCTTCACTAATTACTT GATAGAGTGGGTAAGGCAGGCCCCTGGACAGGGCCTTGAGTGGATTGGA GTGATTAATCCTGGAACCAGTATTACTAACTACAATGAGAAGTTCAAGG GCAGGGCAACACTGACTGCAGACAAGTCCACCAGCACTGCCTACATGGA GCTCAGCAGCCTGAGATCTGAGGACACTGCGGTTTATTTCTGTGCGACG ATCTACTATGGTGAATTTTCCCATGCTGTGGACTCCTGGGGTCAAGGAA CCCTGGTCACCGTCTCCTCA 2E5VH3HeavyChainAminoAcidSequence (SEQIDNO:5) QVQLVQSGAEVKKPGSSVKVSCKASGYVFTNYLIEWVRQAPGQGLEWIG VINPGTSITNYNEKFKGRATLTADKSTSTAYMELSSLRSEDTAVYYCAT IYYGEFSHAVDSWGQGTLVTVSS 2E5VH3HeavyChainNucleotideSequence (SEQIDNO:6) CAGGTCCAGCTGGTGCAGTCTGGAGCTGAAGTGAAAAAGCCTGGGTCTT CAGTGAAGGTGTCCTGCAAGGCTTCTGGATACGTCTTCACTAATTACTT GATAGAGTGGGTAAGGCAGGCCCCTGGACAGGGCCTTGAGTGGATTGGA GTGATTAATCCTGGAACCAGTATTACTAACTACAATGAGAAGTTCAAGG GCAGGGCAACACTGACTGCAGACAAGTCCACCAGCACTGCCTACATGGA GCTCAGCAGCCTGAGATCTGAGGACACTGCGGTTTATTACTGTGCGACG ATCTACTATGGTGAATTTTCCCATGCTGTGGACTCCTGGGGTCAAGGAA CCCTGGTCACCGTCTCCTCA 2E5VH4HeavyChainAminoAcidSequence (SEQIDNO:7) QVQLVQSGAEVKKPGSSVKVSCKASGYVFTNYLIEWVRQAPGQGLEWIG VINPGTSITNYNEKFKGRATITADKSTSTAYMELSSLRSEDTAVYYCAT IYYGEFSHAVDSWGQGTLVTVSS 2E5VH4HeavyChainNucleotideSequence (SEQIDNO:8) CAGGTCCAGCTGGTGCAGTCTGGAGCTGAAGTGAAAAAGCCTGGGTCTT CAGTGAAGGTGTCCTGCAAGGCTTCTGGATACGTCTTCACTAATTACTT GATAGAGTGGGTAAGGCAGGCCCCTGGACAGGGCCTTGAGTGGATTGGA GTGATTAATCCTGGAACCAGTATTACTAACTACAATGAGAAGTTCAAGG GCAGGGCAACAATCACTGCAGACAAGTCCACCAGCACTGCCTACATGGA GCTCAGCAGCCTGAGATCTGAGGACACTGCGGTTTATTACTGTGCGACG ATCTACTATGGTGAATTTTCCCATGCTGTGGACTCCTGGGGTCAAGGAA CCCTGGTCACCGTCTCCTCA 2E5V1LightChainAminoAcidSequence (SEQIDNO:9) DIVMTQSHSFMSASVGDRVTITCKASQGVSSAVAWYQQKPGKAPKLLIF SASYRYTGVPDRFTGSGSGTDFTLTISSLQAEDVAVYYCQQHYGSPWTF GQGTKLEIK 2E5V1LightChainNucleotideSequence (SEQIDNO:10) GACATTGTGATGACCCAGTCTCACAGCTTCATGTCCGCATCAGTAGGAG ACAGGGTCACCATCACCTGCAAGGCCAGTCAGGGTGTGAGTTCTGCTGT AGCCTGGTATCAACAGAAACCAGGAAAAGCTCCTAAACTACTGATTTTC TCGGCATCCTACCGTTACACTGGAGTCCCTGATCGCTTCACTGGCAGTG GATCTGGGACGGATTTCACTCTCACCATCAGCAGTCTGCAGGCTGAAGA CGTGGCAGTTTATTACTGTCAGCAACATTATGGTTCTCCGTGGACGTTC GGTCAAGGCACCAAACTGGAAATCAAA 2E5V2LightChainAminoAcidSequence (SEQIDNO:11) DIVMTQSPSSMSASVGDRVTITCKASQGVSSAVAWYQQKPGKAPKLLIF SASYRYTGVPDRFTGSGSGTDFTLTISSLQAEDVAVYYCQQHYGSPWTF GQGTKLEIK 2E5V2LightChainNucleotideSequence (SEQIDNO:12) GACATTGTGATGACCCAGTCTCCCAGCTCCATGTCCGCATCAGTAGGAG ACAGGGTCACCATCACCTGCAAGGCCAGTCAGGGTGTGAGTTCTGCTGT AGCCTGGTATCAACAGAAACCAGGAAAAGCTCCTAAACTACTGATTTTC TCGGCATCCTACCGTTACACTGGAGTCCCTGATCGCTTCACTGGCAGTG GATCTGGGACGGATTTCACTCTCACCATCAGCAGTCTGCAGGCTGAAGA CGTGGCAGTTTATTACTGTCAGCAACATTATGGTTCTCCGTGGACGTTC GGTCAAGGCACCAAACTGGAAATCAAA 2E5V3LightChainAminoAcidSequence (SEQIDNO:13) DIQMTQSPSSMSASVGDRVTITCKASQGVSSAVAWYQQKPGKAPKLLIF SASYRYTGVPDRFTGSGSGTDFTLTISSLQAEDVAVYYCQQHYGSPWTF GQGTKLEIK 2E5V3LightChainNucleotideSequence (SEQIDNO:14) GACATTCAGATGACCCAGTCTCCCAGCTCCATGTCCGCATCAGTAGGAG ACAGGGTCACCATCACCTGCAAGGCCAGTCAGGGTGTGAGTTCTGCTGT AGCCTGGTATCAACAGAAACCAGGAAAAGCTCCTAAACTACTGATTTTC TCGGCATCCTACCGTTACACTGGAGTCCCTGATCGCTTCACTGGCAGTG GATCTGGGACGGATTTCACTCTCACCATCAGCAGTCTGCAGGCTGAAGA CGTGGCAGTTTATTACTGTCAGCAACATTATGGTTCTCCGTGGACGTTC GGTCAAGGCACCAAACTGGAAATCAAA
(196) Alignments of the four VH amino acid sequences and the three VL amino acid sequences with the counterpart murine 2E5 antibody VH and VL sequences are shown in
Other Embodiments
(197) While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.