Enterokinase cleavable polypeptides

09982287 ยท 2018-05-29

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to Enterokinase-cleavable polypeptides comprising an Enterokinase cleavage site connected to a polypeptide and their use for making the target polypeptide by expression. The invention also relates to DNA sequences, vectors and host cells for use in expressing the Enterokinase-cleavable polypeptides.

Claims

1. A method for making a target polypeptide, said method comprising the steps: a) expressing an enterokinase-cleavable fusion polypeptide comprising a polypeptide of formula I:
Z.sub.2-X.sub.6-X.sub.5-X.sub.4-G-D-R-Z.sub.1(I) SEQ ID NO: 1 wherein Z.sub.1 is a polypeptide comprising at least 2 amino acid residues; X.sub.4 is an amino acid selected from the group consisting of E, Q, L, D, G, A, S, F, H, Y, W, T and M; X.sub.5 is an amino acid selected from the group consisting of genetically encoded amino acids other than S and I; X.sub.6 is absent or an amino acid selected from the group consisting of genetically encoded amino acids; Z.sub.2 is optionally a polypeptide or an amino acid residue; wherein said target polypeptide is Z.sub.1 in formula (I); b) contacting said enterokinase-cleavable fusion polypeptide with an enterokinase under conditions facilitating cleavage of said fusion polypeptide; and c) optionally isolating said target polypeptide from said cleavage reaction in b).

2. The method according to claim 1, wherein X.sub.4 is E, Q, L, D, G or A.

3. The method according to claim 2, wherein X.sub.5-X.sub.4 is selected from the group consisting of DD, DE, DL, DQ, EE, and EQ.

4. The method according to claim 3, wherein X.sub.5-X.sub.4 is DD or DE.

5. The method according to claim 1, wherein Z.sub.2 is a polypeptide facilitating the expression of said enterokinase-cleavable fusion polypeptide in a host cell.

6. The method according to claim 1, wherein Z.sub.2 is a polypeptide having from 2 to 50 amino acid residues, Z.sub.2 is an amino acid residue, or Z.sub.2 is absent.

7. The method according to claim 1, wherein Z.sub.1 comprises a pharmaceutically active polypeptide or an enzyme.

8. The method according to claim 7, wherein Z.sub.1 is a GLP-1 peptide or a functional variant thereof.

9. The method according to claim 7, wherein Z.sub.1 is a glucagon peptide or a functional variant thereof.

10. The method according to claim 1, wherein said contacting in step b) is carried out in an aqueous solution comprising an organic solvent.

Description

DESCRIPTION

(1) In one embodiment the invention relates to an enterokinase-cleavable fusion polypeptide comprising the polypeptide of the formula (I):
Z.sub.2-X.sub.6-X.sub.5-X.sub.4-G-D-R-Z.sub.1(I) SEQ ID NO: 1

(2) wherein

(3) Z.sub.1 is a polypeptide comprising at least 2 amino acid residues;

(4) X.sub.4 is E, Q, L, D, G, A, S, F, H, Y, W, T or M;

(5) X.sub.5 is selected from the genetically encoded amino acids but S and I;

(6) X.sub.6 is absent or selected from the genetically encoded amino acids; and

(7) Z.sub.2 is an optional polypeptide or amino acid residue. In one embodiment the Enterokinase-cleavable fusion polypeptide consists of formula (I).

(8) The term Enterokinase as used herein is intended to mean a pancreatic hydrolase which catalyses the activation by cleavage of trypsinogen into trypsin as part of the catalytic cascade involved in the digestive process. Enterokinase includes the native enzyme isolated from any sources as well as the enzyme produced by recombinant expression. One non-limiting example of Enterokinase is the naturally occurring dimer comprising a disulphide-linked heavy chain of approx. 115 kDa and a smaller light chain of approx. 35 kDa. Another non-limiting example of Enterokinase is the light chain alone which comprises the catalytic domain. The light chain alone as well as functional variants thereof has been described to perform well as Enterokinase enzyme, c.f. WO2013/092855A1.

(9) The term fusion polypeptide as used herein is intended to mean a polypeptide which comprises two or more polypeptides fused together such as to constitute a non-naturally occurring polypeptide. The size of the polypeptides being fused may vary and depends on the purpose of the fusion polypeptide. Fusion polypeptides are frequently used during the recombinant expression of proteins for reasons of increasing expression, to facilitate the maintenance of a soluble expression product, to facilitate the excretion of the fusion polypeptide or part thereof to the extracellular medium, to protect a polypeptide from being unintentionally processed by proteases or peptidases and the like. In such fusion polypeptides one of the at least two constituent polypeptides is often designated the target polypeptide or mature protein, i.e. being the polypeptide which is to be manufactured by the recombinant expression process.

(10) The term Enterokinase-cleavable fusion polypeptide as used herein is intended to mean a fusion polypeptide comprising two polypeptides fused together in each end of an Enterokinase cleavage site such as to constitute a non-naturally occurring polypeptide which under suitable conditions can be cleaved by an Enterokinase at the Enterokinase cleavage site linking the two polypeptides. Thus the Enterokinase-cleavable fusion polypeptide is a non-naturally occurring polypeptide. It is to be understood that each of the two polypeptides comprised by the Enterokinase-cleavable fusion polypeptide may contain secondary sites which are also recognized and cleaved by Enterokinase. However, such secondary cleavage sites will undergo cleavage by Enterokinase at a rate which is lower than the rate at which Enterokinase cleaves the intended cleavage site according to the present invention. In one embodiment all secondary Enterokinase cleavage sites in the Enterokinase-cleavable fusion polypeptide are cleaved by Enterokinase at a rate which is lower than the rate of cleavage of a corresponding D4K site.

(11) In the present context the terms protein, polypeptide and peptide may be used interchangeably to designate a polypeptide. It is to be understood that the particular term used has no limitation as to the size of the molecule (unless directly stated in the particular context).

(12) Amino acid residues are designated according to single letter abbreviation according to IUPAC nomenclature, e.g. D meaning aspartic acid (Asp) and G meaning glycine (Gly).

(13) Genetically encoded amino acids as used herein is intended to mean the group consisting of the following amino acids: G, P, A, V, L, I, M, C, F, Y, W, H, K, R, Q, N, E, D, S, T as well as any biological modification hereof. In one embodiment amino acids suitable for use in the present invention comprises isosteres of genetically encoded amino acids. Non-limiting examples of such biological modifications are e.g. amidation, glycosylation and disulphide bond formation.

(14) Analogues as used herein is intended to mean proteins which are derived from another protein by means of substitution, deletion and/or addition of one or more amino acid residues from the protein. A non-limiting example of analogues of GLP-1(7-37) (SEQ ID NO: 4) are K34R-GLP-1(7-37) (SEQ ID NO: 5) where residue 34 has been substituted by an arginine residue and K34R-GLP-1(9-37) (SEQ ID NO: 6) where residue 34 has been substituted with an arginine residue and amino acid residues 7-8 have been deleted (using the common numbering of amino acid residues for GLP-1 peptides). In one embodiment GLP-1(7-37) (SEQ ID NO: 4) is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG.

(15) Functional variant as used herein is intended to mean a chemical variant of a certain protein which retains substantially the same main function as the original protein. Hence a functional variant is typically a modified version of a protein wherein as few modifications are introduced as necessary for the modified protein to obtain some desirable property while preserving substantially the same main function of the original protein. Non-limiting examples of functional variants are e.g. extended proteins, truncated proteins, fusion proteins and analogues. Non-limiting examples of functional variants of bovine Enterokinase light chain are e.g. C112A bovine Enterokinase light chain. A non-limiting example of a functional variant of GLP-1(7-37) is K34R-GLP-1(7-37).

(16) In one embodiment, a functional variant of a protein comprises from 1-2 amino acid substitutions, deletions or additions as compared said protein. In another embodiment, a functional variant comprises from 1-5 amino acid substitutions, deletions or additions as compared to said protein. In another embodiment, a functional variant comprises from 1-15 amino acid substitution, deletion or additions relative to the corresponding naturally occurring protein or naturally occurring sub-sequence of a protein.

(17) In one embodiment Z.sub.2 comprises a solubilisation domain. Solubilisation domain as used herein is intended to mean a protein which is part of a fusion protein and which is to render said fusion protein more soluble than the fusion partner protein itself under certain conditions. Non-limiting examples of solubilisation domains which may be used as Z.sub.2 in formula (I) are DsbC (Thiol:disulfide interchange protein), RL9 (Ribosomal Protein L9) as described in WO2008/043847, MPB (Maltose-binding Protein), NusA (Transcription termination/antitermination protein) and Trx (Thioredoxin).

(18) Non-naturally occurring polypeptide as used herein is intended to mean a polypeptide which is not known to occur or does not occur in nature without the intervention of man. A non-limiting example of a non-naturally occurring polypeptide is e.g. a fusion polypeptide where two proteins from different sources are fused together as one polypeptide.

(19) The term GLP-1 peptide, as used herein, is intended to designate GLP-1 (7-37), GLP-1 (7-36) amide as well as analogues thereof, which are capable of being produced by conventional recombinant DNA techniques as well as conventional synthetic methods. Such GLP-1 peptides include but are not limited to native glucagon-like peptide-1, which may also be referred to as human GLP-1, for instance such peptide fragments which comprises GLP-1 (7-37) and functional variants thereof as disclosed in WO 87/06941; such peptide fragments which comprise GLP-1 (7-36) and functional derivatives thereof as disclosed in WO 90/11296; such analogues of the active GLP-1 peptides 7-34, 7-35, 7-36, and 7-37 as disclosed in WO 91/11457; such N-terminal truncated fragments of GLP-1 as disclosed in EP 0699686-A2; and such GLP-1 analogues and derivatives that include an N-terminal imidazole group as disclosed in EP 0708179-A2. Non-limiting examples of a GLP-1 peptide is GLP-1(7-37), K34R-GLP-1(7-37) and exendin-4(1-39) (SEQ ID NO: 7). In one embodiment exendin-4(1-39) (SEQ ID NO: 7) is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS.

(20) Glucagon peptide as used herein is intended to mean a polypeptide from the preproglucagon family having affinity for the glucagon receptor. Non-limiting examples of a glucagon peptide is glucagon(1-29) (SEQ ID NO: 8) and analogues thereof. In one embodiment glucagon(1-29) (SEQ ID NO: 8) is HSQGTFTSDYSKYLDSRRAQDFVQWLMNT.

(21) Insulin precursor as used herein is intended to mean a polypeptide which comprises the A-chain and the B-chain of an insulin and optionally an intervening C-peptide. It is to be understood that the insulin can be human insulin or a functional variant thereof, such as an analogue or a truncated version. A non-limiting example of an insulin precursor is e.g. A(1-21)-AAK-B(1-29)-human insulin (SEQ ID NO: 9). A(1-21)-AAK-B(1-29)-human insulin (SEQ ID NO: 9) is GIVEQCCTSICSLYQLENYCNAAKFVN QHLCGSHLVEALYLVCGERGFFYTPK.

(22) The term exendin as used herein, is intended to designate exendin as well as functional variants thereof, including analogues and fragments thereof, e.g. exendin-3 and -4. Exendin as well as analogues and fragments thereof are described in, for example WO 99/43708, the contents of which are herein incorporated by reference in their entirety.

(23) It is preferred that the Enterokinase site in the Enterokinase-cleavable fusion polypeptide be a site which is also robust in terms of chemical stability. Since certain subsequences of amino acid residues in the Enterokinase site are more prone to being less chemically stable, it is generally preferred that the sequence of the Enterokinase site (X.sub.6-X.sub.5-X.sub.4-GDR be one that is chemically stable under the intended conditions.

(24) In the Enterokinase-cleavable fusion polypeptides according to formula (I) X.sub.4 is in one embodiment selected from E, Q, L, D, G, A, S, F, H, Y, W or T. In another embodiment X.sub.4 is selected from E, Q, L, D, G or A. X.sub.4 may be E. X.sub.4 may be Q or L. X.sub.4 may be D. X.sub.4 may be D, G or A. In another embodiment X.sub.5 is D or E. In yet another embodiment X.sub.5 is D. In one embodiment X.sub.5 is not S or I. In one embodiment X.sub.5-X.sub.4 is selected from the group consisting of DD, DE, DL, DQ, EE, and EQ. In another embodiment X.sub.5-X.sub.4 is DE or DD. X.sub.5-X.sub.4 may be DL, DQ or DG. X.sub.5-X.sub.4 may be DA, DS or EE. X.sub.5-X.sub.4 may be EQ, EL or ED. X.sub.5-X.sub.4 may be EG, EA or ES. X.sub.5-X.sub.4 may be QE, HE, NE or ME. The presence and identity of X.sub.6 is lenient. In one embodiment X.sub.6 is I, G, L, T, R or S. In another embodiment X.sub.6 is absent. X.sub.6 may be I, G, L, T, R, S, M, H, F, P, V, W, K, E, Y or Q. X.sub.6 may be I, G, L, T, R, S, M, H, F, P, V or W. X.sub.6 may be I or G.

(25) In one embodiment Z.sub.2 is absent. In another embodiment Z.sub.2 is a polypeptide having from 0-10 amino acid residues or having from about 8 to about 200 amino acid residues. Smaller Z.sub.2 polypeptides are often used when Z.sub.2 is a polypeptide facilitating the expression of the Enterokinase-cleavable fusion polypeptide in a host cell, or when Z.sub.2 is to protect a polypeptide being expressed from being proteolytically processed in the N-terminal. In one embodiment Z.sub.2 is selected from the group consisting of EEK, EEAEK (SEQ ID NO: 20), HK, EEAHK (SEQ ID NO: 21), E(EA)2HK (SEQ ID NO: 22), E(EA)3HK (SEQ ID NO: 23), EEGHK (SEQ ID NO: 24), EHPK (SEQ ID NO: 63), EEGEPK (SEQ ID NO: 25), EEAHELK (SEQ ID NO: 26), EEAHEVK (SEQ ID NO: 27), EEAHEMK (SEQ ID NO: 28), EEAHEFK (SEQ ID NO: 29), EEAHEYK (SEQ ID NO: 30), EEAHEWKEEGNTTPK (SEQ ID NO: 31) and EELDARLEALK (SEQ ID NO: 32). Z.sub.2 may comprise the sequence EEK, EEAEK (SEQ ID NO: 20), or HK. Z.sub.2 may comprise the sequence EEAHK (SEQ ID NO: 21), E(EA)2HK (SEQ ID NO: 22) or E(EA)3HK (SEQ ID NO: 23). Z.sub.2 may comprise the sequence EEGHK (SEQ ID NO: 24), EHPK (SEQ ID NO: 63) or EEGEPK (SEQ ID NO: 25). Z.sub.2 may comprise the sequence EEAHELK (SEQ ID NO: 26), EEAHEVK (SEQ ID NO: 27) or EEAHEMK (SEQ ID NO: 28). Z.sub.2 may comprise the sequence EEAHEFK (SEQ ID NO: 29), EEAHEYK (SEQ ID NO: 30), EEAHEWKEEGNTTPK (SEQ ID NO: 31) or EELDARLEALK (SEQ ID NO: 32). In another embodiment Z.sub.2 comprises a sequence selected from the group consisting of DV, DVKPGQPLA (SEQ ID NO: 47), DVKPGQPEY (SEQ ID NO: 48), DVKPGEPLY (SEQ ID NO: 49), DVKPGQPLY (SEQ ID NO: 50), DVKPGQPLE (SEQ ID NO: 51) and DVKPGQPMY (SEQ ID NO: 52). In another embodiment Z.sub.2 comprises a sequence selected from the group consisting of DVKPGQPLY (SEQ ID NO: 50), DVKPGQELY (SEQ ID NO: 53), DVKPGEPLY (SEQ ID NO: 49), DVKPEQPLY (SEQ ID NO: 54), DVKPGQPEY (SEQ ID NO: 48), DVKEGQPLY (SEQ ID NO: 55), DVKPGQPLA (SEQ ID NO: 47), DVKPGQPLE (SEQ ID NO: 51) and DVEPGQPLY (SEQ ID NO: 64). Z.sub.2 may comprise the sequence DVKPGQPLY (SEQ ID NO: 50), DVKPGQELY (SEQ ID NO: 53) or DVKPGEPLY (SEQ ID NO: 49). Z.sub.2 may comprise the sequence DVKPEQPLY (SEQ ID NO: 54), DVKPGQPEY (SEQ ID NO: 48), or DVKEGQPLY (SEQ ID NO: 55). Z.sub.2 may comprise the sequence DVKPGQPLA (SEQ ID NO: 47), DVKPGQPLE (SEQ ID NO: 51) or DVEPGQPLY (SEQ ID NO: 64). In another embodiment Z.sub.2 comprises a sequence selected from the group consisting of QPMYKR (SEQ ID NO: 33), GQPMYK (SEQ ID NO: 34), PGQPMY (SEQ ID NO: 35), KPGQPM (SEQ ID NO: 36), LKPGQP (SEQ ID NO: 37), QLKPGQ (SEQ ID NO: 38), LQLKPG (SEQ ID NO: 39), WLQLKP (SEQ ID NO: 40), HWLQLK (SEQ ID NO: 41), WHWLQL (SEQ ID NO: 42), AWHWLQ (SEQ ID NO: 43), EAWHWL (SEQ ID NO: 44), AEAWHW (SEQ ID NO: 45) and EAEAWH (SEQ ID NO: 46). Z.sub.2 may comprise the sequence QPMYKR (SEQ ID NO: 33), GQPMYK (SEQ ID NO: 34) or PGQPMY (SEQ ID NO: 35). Z.sub.2 may comprise the sequence KPGQPM (SEQ ID NO: 36), LKPGQP (SEQ ID NO: 37) or QLKPGQ (SEQ ID NO: 38). Z.sub.2 may comprise the sequence LQLKPG (SEQ ID NO: 39), WLQLKP (SEQ ID NO: 40) or HWLQLK (SEQ ID NO: 41). Z.sub.2 may comprise the sequence WHWLQL (SEQ ID NO: 42), AWHWLQ (SEQ ID NO: 43) or EAWHWL (SEQ ID NO: 44). Z.sub.2 may comprise the sequence AEAWHW (SEQ ID NO: 45) or EAEAWH (SEQ ID NO: 46). Z.sub.2 may be a polypeptide facilitating the expression of said Enterokinase-cleavable fusion polypeptide in a host cell. In one embodiment Z.sub.2 is a polypeptide having from 2 to 50 amino acid residues, such as from 3 to 40, from 4 to 30 or from 5 to 20 amino acid residues. Z.sub.2 may be a polypeptide having from 2 to 8 amino acid residues. Z.sub.2 may be a polypeptide having at least 8 amino acid residues. Z.sub.2 may comprise or consist of 40 or less amino acid residues. Z.sub.2 may be a polypeptide having from about 10 to about 25 amino acid residues.

(26) In one embodiment the invention relates to a peptide comprising the amino acid sequence Z.sub.2-X.sub.8-X.sub.7, wherein Z.sub.2 is as defined herein; X.sub.8 is absent or a peptide comprising an enterokinase cleavage site; and X.sub.7 is a polypeptide comprising at least 1 amino acid. In one embodiment Z.sub.2 increases recombinant expression of Z.sub.2-X.sub.8-X.sub.7, facilitates maintenance of a soluble expression product Z.sub.2-X.sub.8-X.sub.7, facilitates excretion of Z.sub.2-X.sub.8-X.sub.7 or part thereof to the extracellular medium, protects X.sub.7 or part thereof from being unintentionally processed by proteases or peptidases, and/or provides improved properties for capture of Z.sub.2-X.sub.8-X.sub.7 (e.g. by purification by chromatography, such as HPLC). X.sub.8 may be absent. X.sub.8 may comprise at least 2 amino acids, such as at least 3 amino acids, at least 4 amino acids, or at least 5 amino acids. X.sub.8 may comprise 1-30 amino acids, such as 3-20 amino acids, 4-15 amino acids, or at least 5-10 amino acids. X.sub.7 may comprise at least 5 amino acids, at least 10 amino acids, or at least 15 amino acids. X.sub.7 may comprise 1-100 amino acids, such as 10-70 amino acids or 20-50 amino acids. X.sub.7 may be Z.sub.1 as defined herein. For example, Z.sub.1 may be a GLP-1 peptide or a functional variant thereof. In one embodiment Z.sub.2-X.sub.8-X.sub.7 is an Enterokinase-cleavable fusion polypeptide. X.sub.8 may comprise the amino acid sequence X.sub.6-X.sub.5-X.sub.4-G-D-R, wherein X.sub.6, X.sub.5, and X.sub.4 are as defined herein. X.sub.8 may comprise the amino acid sequence DDGDR (SEQ ID NO: 56) or DEGDR (SEQ ID NO: 57).

(27) In the Enterokinase-cleavable fusion polypeptides according to formula (I) Z.sub.1 is often the target polypeptide to be manufactured by the recombinant expression. In one embodiment Z.sub.1 is a pharmaceutically active polypeptide, or a precursor for a pharmaceutically active polypeptide. In an embodiment Z.sub.1 is a polypeptide having from about 15 to about 100 amino acid residues. In yet another embodiment Z.sub.1 is a polypeptide having from about 15 to about 50 amino acid residues. In another embodiment Z.sub.1 is a GLP-1 peptide or a functional variant thereof, such as K34R-GLP-1(7-37) or K34R-GLP-1(9-37). In one embodiment K34R-GLP-1(7-37) is HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO: 5). In one embodiment K34R-GLP-1(9-37) is EGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO: 6). Z.sub.1 may comprise the N-terminal sequence HAEGT (SEQ ID NO: 10) or EGTFT (SEQ ID NO: 13). Z.sub.1 may comprise the N-terminal sequence HAEGTFTSDVSSYLE (SEQ ID NO: 58), EGTFTSDVSSYLE (SEQ ID NO: 59), or a fragment thereof comprising at least 5 amino acids. In another embodiment Z.sub.1 is a glucagon peptide or a functional variant thereof. Z.sub.1 may be a glucagon peptide or a functional variant thereof comprising the N-terminal sequence HGTFT (SEQ ID NO: 15). Z.sub.1 may be an analogue of GLP-1 (7-37) selected from the group consisting of: (des7-8, 31H, 34Q, 37K); (des7-8, 34R, 37K, 38E); (des7-8, 34R, 37K); (des7-8, 9G, 34R, 37K); (des7-8, 23R, 34R, 37K); (31H, 34Q, 37K); (9Q, 34R, 37K); (30E, 34R, 37K); (34R, 37K, 38G); (34R, 36G, 37K); and (34R, 37K, 38E). Z.sub.1 may be an analogue of GLP-1 (7-37) selected from the group consisting of: (i) des7-8, 18K, 34R; (ii) des7-8, 18K, 34Q; (iii) des7-8, 18K, 22E, 34R; (iv) des7-8, 18K, 22E, 34Q; (v) des7-8, 12L, 18K, 34Q; (vi) des7, 18K, 22E, 34Q; (vii) 18K, 34R; (iix) 18K, 34Q; (ix) 18K, 22E, 34R; (x) 18K, 22E, 34Q; (xi) 18K, 26R, 31K, 34R; (xii) 18K, 26H, 31K, 34R; (xiii) 18K, 26H, 27K, 34Q; (xiv) 18K, 22K, 26R, 34Q; (xv) 18K, 25V, 26R, 31K, 34R; (xvi) 18K, 22E, 26R, 31K, 34R; (xvii) 18K, 22E, 26H, 27K, 34R; (iixx) 18K, 22E, 26H, 27K, 34Q; (ixx) 18K, 22E, 26H, 27K, 31H, 34R; (xx) 18K, 22E, 26H, 27K, 31H, 34Q; (xxi) 18K, 22E, 25V, 26R, 31K, 34R; (xxii) 18K, 22E, 25V, 26R, 31K, 34Q; (xxiii) 18K, 22E, 25V, 26R, 31K, 34G; (xxiv) 18K, 22E, 25V, 26R, 27K, 34R; (xxv) 18K, 22E, 25V, 26R, 27K, 34Q; (xxvi) 18K, 22E, 25V, 26R, 27K, 31H, 34R; (xxvii) 18K, 22E, 25V, 26R, 27K, 31H, 34Q; (iixxx) 18K, 22E, 23E, 25V, 26R, 27K, 34R; (ixxx) 18K, 22E, 23E, 25V, 26R, 27K, 34Q; (xxx) 18K, 22E, 25V, 26R, 31K, 34G, des35-37; (xxxi) 18K, 22E, 25V, 26R, 31H, des35-37; (xxxii) 18K, 22E, 25V, 26R, 30K, 34G, des35-37; (xxxiii) 18K, 22E, 25V, 26R, 30K, 31H, 34G, des35-37; (xxxiv) 18K, 22E, 25V, 26R, 27L, 30K, 34G, des35-37); (xxxv) 18K, 22E, 26R, 31K, 34G, des35-37; (xxxvi) 18K, 22E, 26R, 27K, 31H, 34G, des35-37; (xxxvii) des7, 18K, 22E, 26R, 34R, 37K; (iixxxx) des7, 18K, 22E, 26R, 27K, 31H, 34G, des35-37; (ixxxx) 7Imp, 18K, 22E, 25V, 26R, 31K, 34G, des35-37; (xxxx) des7-8, 18K, 22E, 25V, 26R, 31K, 34G, des35-37; (xxxxi) 8S, 18K, 22E, 25V, 26R, 31K, 34G, des35-37; (xxxxii) des7-8, 18K, 26V, 27K, 34R; (xxxxiii) des7-8, 18K, 26H, 30K, 34R, des36-37; (xxxxiv) des7-8, 18K, 25V, 26R, 31K, 34R; (xxxxv) des7-8, 18K, 22E, 34R, des36-37; (xxxxvi) des7-8, 18K, 22E, 26R, 34R, 37K; (xxxxvii) des7-8, 18K, 22E, 26R, 31K, 34R; (iixxxxx) des7-8, 18K, 22E, 26R, 31K, 34G, des35-37; (ixxxxx) des7-8, 18K, 22E, 26R, 30K, 34R, des36-37; (xxxxx) des7-8, 18K, 22E, 26R, 30K, 34R; (xxxxxi) des7-8, 18K, 22E, 26R, 27K, 31H, 34R, des36-37; (xxxxxii) des7-8, 18K, 22E, 25V, 26R, 31K, des34-37; (xxxxxiii) des7-8, 18K, 22E, 25V, 26R, 31K, 34R; (xxxxxiv) des7-8, 18K, 22E, 25V, 26R, 31K, 34G, des35-37; (xxxxxv) des7-8, 18K, 22E, 25V, 26R, 30E, 31K, 34G, des35-37; (xxxxxvi) des7-8, 18K, 22E, 25V, 26R, 27L, des35-37; (xxxxxvii) des7-8, 18K, 22E, 25V, 26R, 27K, 34Q; (iixxxxxx) des7-8, 18K, 22E, 25V, 26R, 27K, 31H, 34G, des35-37; (ixxxxxx) des7-8, 18K, 22E, 25V, 26R, 27H, 31K, 34G, des35-37; (xxxxxx) des7-8, 18K, 22E, 25V, 26H, 31K, 34G, des35-37; (xxxxxxi) des7-8, 18K, 22E, 23R, 25V, 26R, 31K, 34G, des35-37; (xxxxxxii) 18K, 22E, 25V, 26R, 27L, 30K, 34G, des35-37; (xxxxxxiii) des7, 18K, 22E, 26R, 27K, 34Q; (xxxxxxiv) 34H; and (xxxxxxv) des7-8, 18K, 34H. Z.sub.1 may be an analogue of GLP-1 (7-37) selected from the group consisting of: (i) 22E, 26R, 27K, 34R, 37K; (ii) 22E, 26R, 27K, 30E, 34R, 36K, 38E, 39G; (iii) 22E, 26R, 27K, 34R, 36K, des37; (iv) 22E, 25V, 26R, 27K, 34R, 37K; (v) des7-8, 20K, 22E, 26R, 27K, 30E, 34G, des35-37; (vi) 26R, 27K, 30E, 34R, 36K, 38E; (vii) des7-8, 22K, 25V, 26R, 27K, 31H, 34R; (iix) des7-8, 22K, 25V, 26R, 27K, 34R, des35-37; (ix) des7-8, 22K, 25V, 26R, 27K, 34R, des36-37; (x) 26H, 27K, 30E, 34R, 36K, 38E; (xi) 22K, 25V, 26R, 27K, 30E, 34Q; (xii) 25V, 26R, 27K, 30E, 34R, 36K, 38Q; (xiii) 25V, 26R, 27K, 30E, 34Q, 36K, 38E; (xiv) 22K, 26R, 27K, 31H, 34G, des35-37; (xv) des7-8, 25V, 26R, 27K, 31H, 34Q, 37K; (xvi) 25V, 26R, 27K, 31H, 34Q, 37K; (xvii) 22E, 23E, 25V, 26R, 27K, 31H, 34Q, 37K; (iixx) des7-8, 12K, 22E, 26R, 27K, 31H, 34Q; (ixx) des7-8, 22K, 26R, 27K, 31H, 34G, des35-37; (xx) 22E, 26H, 27K, 30E, 34R, 36K, 38E; (xxi) 22E, 24K, 26R, 27K, 31H, 34G, des35-37; (xxii) 25V, 26R, 27K, 34Q, 36K; (xxiii) 22E, 24K, 25V, 26R, 27K, 31H, 34R; (xxiv) 22E, 24K, 25V, 26R, 27K, 34G, des35-37; (xxv) 22E, 24K, 25V, 26R, 27K, 34R; (xxvi) des7-8, 22E, 24K, 25V, 26R, 27K, 31H, 34Q; and (xxvii) des7-8, 22E, 26R, 27K, 30E, 34R, 36K, 38E, 39G. Z.sub.1 may be GLP-1 (7-37) or an analogue of GLP-1 (9-37) selected from the group consisting of (iii) (22E) and (iv) 22E, 30E. Z.sub.1 may be an analogue of GLP-1 (9-37) selected from the group consisting of: i) (22E, 26R, 27K, 34R, 38G, 39G, 40G, 41S, 42K); ii) (22E, 26R, 31K, 34R, 38G, 39G, 40G, 41S, 42K); iii) (22E, 26R, 34R, 38K, 39G, 40G, 41S, 42K); iv (22E, 23K, 26R, 34R, 38G, 39G, 40G, 41S, 42K); v) (22E, 26R, 34R, 36K, 38G, 39G, 40G, 41S, 42K); and vi) (18K, 22E, 26R, 34R, 38G, 39G, 40G, 41S, 42K). In yet another embodiment Z.sub.1 is an insulin precursor or a functional variant thereof, such as A(1-21)-AAK-B(1-29)-human insulin. In another embodiment Z.sub.1 is selected from the group consisting of exendin, PYY, leptin and functional variant thereof.

(28) In one embodiment Z.sub.1 and Z.sub.2 are derived from different origins, i.e. from different species and/or synthetic origin.

(29) Manufacture of the Fusion Polypeptide

(30) The Enterokinase-cleavable fusion polypeptide may be produced by means of recombinant nucleic acid techniques. In general, nucleic acid sequences encoding Z.sub.2, X.sub.6-X.sub.5-X.sub.4-GDR and Z.sub.1 are obtained synthetically (for smaller polypeptides) or as cloned DNA modified to encode the desired polypeptide. The nucleic acid sequence encoding Z.sub.2 may often be obtained by cloning the wild-type DNA, but when Z.sub.2 is a polypeptide of limited size it can also be obtained synthetically. The nucleic acid sequence encoding the Enterokinase site, X.sub.6-X.sub.5-X.sub.4-GDR being a polypeptide of only 5-6 amino acid residues, will usually be obtained synthetically. It may even be encoded by the same nucleic acid sequence encoding Z.sub.2, in particular in the situations where Z.sub.2 is a rather small polypeptide. The nucleic acid sequences encoding the different parts of Z.sub.2, X.sub.6-X.sub.5-X.sub.4-GDR and Z.sub.1, are fused in-frame such as to constitute one nucleic acid sequence encoding at least the Enterokinase-cleavable fusion polypeptide of formula (I). Such a fusion polypeptide can be the Enterokinase-cleavable fusion polypeptide, with or without N- or C-terminal extensions (as or within Z.sub.1 and Z.sub.2) such as a tag or the like, e.g. a His-tag or a solubilisation domain (such as DsbC, RL9, MBP, NusA or Trx). This modified nucleic acid sequence is then inserted into an expression vector, which is in turn transformed or transfected into the expression host cells.

(31) The nucleic acid construct encoding the Enterokinase-cleavable fusion polypeptide may suitably be of genomic, cDNA or synthetic origin. Often, it will comprise nucleic acid sequences having different origins. Amino acid sequence alterations are accomplished by modification of the genetic code by well-known techniques.

(32) In a further aspect the present invention provides a DNA sequence encoding the Enterokinase-cleavable fusion polypeptide of the invention.

(33) The DNA sequence encoding the Enterokinase-cleavable fusion polypeptide is usually inserted into a recombinant vector which may be any vector, which may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e. a vector, which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g. a plasmid. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.

(34) The vector is preferably an expression vector in which the DNA sequence encoding the Enterokinase-cleavable fusion polypeptide is operably linked to additional segments required for transcription of the DNA. The term, operably linked indicates that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in a promoter and proceeds through the DNA sequence coding for the polypeptide until it terminates within a terminator.

(35) Thus, expression vectors for use in expressing the Enterokinase-cleavable fusion polypeptide will comprise a promoter capable of initiating and directing the transcription of a cloned gene or cDNA. The promoter may be any DNA sequence, which shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell.

(36) Additionally, expression vectors for expression of the Enterokinase-cleavable fusion polypeptide will also comprise a terminator sequence, a sequence recognized by a host cell to terminate transcription. The terminator sequence is operably linked to the 3 terminus of the nucleic acid sequence encoding the polypeptide. Any terminator which is functional in the host cell of choice may be used in the present invention.

(37) Expression of the Enterokinase-cleavable fusion polypeptide can be aimed for either intracellular expression in the cytosol of the host cell or be directed into the secretory pathway for extracellular expression into the growth medium. Alternatively, expression of the Enterokinase-cleavable fusion polypeptide can be targeted to an organelle.

(38) Intracellular expression is the default pathway and requires an expression vector with a DNA sequence comprising a promoter followed by the DNA sequence encoding the Enterokinase-cleavable fusion polypeptide followed by a terminator.

(39) To direct the Enterokinase-cleavable fusion polypeptide into the secretory pathway of the host cells, a secretory signal sequence (also known as signal peptide or a pre sequence) is needed as an N-terminal extension of the Enterokinase-cleavable fusion polypeptide. A DNA sequence encoding the signal peptide is joined to the 5 end of the DNA sequence encoding the Enterokinase-cleavable fusion polypeptide in the correct reading frame. The signal peptide may be that normally associated with the protein or may be from a gene encoding another secreted protein.

(40) The procedures used to ligate the DNA sequences coding for the Enterokinase-cleavable fusion polypeptide, the promoter, the terminator and/or secretory signal sequence, respectively, and to insert them into suitable vectors containing the information necessary for replication, are well known to persons skilled in the art (cf., for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N.Y., 1989).

(41) The host cell into which the DNA sequence encoding the Enterokinase-cleavable fusion polypeptide is introduced may be any cell that is capable of expressing the Enterokinase-cleavable fusion polypeptide either intracellularly or extracellularly. If posttranslational modifications are needed, suitable host cells include yeast, fungi, insects and higher eukaryotic cells such as mammalian cells.

(42) Bacterial Expression:

(43) Examples of suitable promoters for directing the transcription of the nucleic acid constructs in a bacterial host cell are, for expression in E. coli, the promoters obtained from the lac operon, the trp operon and hybrids thereof trc and tac, all from E. coli (DeBoer et al., 1983, Proceedings of the National Academy of Sciences USA 80: 21-25). Other even stronger promoters for use in E. coli are the bacteriophage promoters from T7 and T5 phages. The T7 promoter requires the presence of the T7 polymerase in the E. coli host (Studier and Moffatt, J. Mol. Biol. 189, 113, (1986)). All these promoters are regulated by induction with IPTG, lactose or tryptophan to initiate transcription at strategic points in the bacterial growth period. E. coli also has strong promoters for continuous expression, e.g. the synthetic promoter used to express hGH in Dalbge et al, 1987, Biotechnology 5, 161-164.

(44) For the expression in Bacillus, the promoters from Bacillus subtilis levansucrase gene (sacB), Bacillus licheniformis alpha-amylase gene (amyL), Bacillus stearothermophilus maltogenic amylase gene (amyM), Bacillus amyloliquefaciens alpha-amylase gene (amyQ), Bacillus licheniformis penicillinase gene (penP), Bacillus subtilis xylA and xylB genes are suitable examples. Further promoters are described in Useful proteins from recombinant bacteria in Scientific American, 1980, 242: 74-94; and in Sambrook et al., 1989, supra.

(45) Effective signal peptide coding regions for bacterial host cells are, for E. coli, the signal peptides obtained from the genes DegP, OmpA, OmpF, OmpT, PhoA and Enterotoxin STII, all from E. coli. For Bacillus the signal peptide regions obtained from Bacillus NCIB 11837 maltogenic amylase, Bacillus stearothermophilus alpha-amylase, Bacillus licheniformis subtilisin, Bacillus licheniformis beta-lactamase, Bacillus stearothermophilus neutral proteases (nprT, nprS, nprM) and Bacillus subtilis prsA. Further signal peptides are described by Simonen and Palva, 1993, Microbiological Reviews 57: 109-137. For both E. coli and Bacillus, signal peptides can be created de novo according to the rules outlined in the algorithm SignalP (Nielsen et al, 1997, Protein Eng. 10, 1-6, Emanuelsen et al, 2007, Nature Protocols 2, 953-971). The signal sequences are adapted to the given context and checked for SignalP score.

(46) Examples of strong terminators for transcription are the aspartase aspA as in the Thiofusion Expression System, the T7 gene 10 terminator in the pET vectors (Studier et al) and the terminators of the ribosomal RNA genes rrnA, rrnD.

(47) In one embodiment the invention relates to a host cell comprising the expression vector comprising the DNA sequence encoding the Enterokinase-cleavable fusion polypeptide according to formula (I). In one embodiment the host cell comprising the expression vector is a yeast, a bacterium or a fungi. In another embodiment the host cell is selected from the group consisting of Saccharomyces spp., Pichia spp., Hansenula spp. and Kluyveromyces spp. The host cell may be Saccharomyces cerevisiae. In a further embodiment the host cell is selected from the group consisting of Escherichia coli and Bacillus spp.

(48) Examples of preferred expression hosts are E. coli K12 W3110, E. coli K12 with a trace of B, MC1061 and E. coli B BL21 DE3, harbouring the T7 polymerase by lysogenization with bacteriophage . These hosts are selectable with antibiotics when transformed with plasmids for expression. For antibiotics free selection the preferred host is e.g. E. coli B BL21 DE3 3xKO with deletion of the 2 D,L-alanine racemase genes alr, dadX, and deletion of the Group II capsular gene cluster (kpsM-kpsF), specific for E. coli B and often associated with pathogenic behaviour. The deletion of the Group II gene cluster brings E. coli B BL21 DE3 3xKO into the same safety category as E. coli K12. Selection is based on non-requirement of D-alanine provided by the alr gene inserted in the expression plasmid instead of the AmpR gene.

(49) Once the Enterokinase-cleavable fusion polypeptide has been expressed in a host organism it may be recovered and purified to the required purity by conventional techniques. Non-limiting examples of such conventional recovery and purification techniques are centrifugation, solubilisation, filtration, precipitation, ion-exchange chromatography, immobilized metal affinity chromatography (IMAC), RP-HPLC, gel-filtration and freeze drying.

(50) Examples of recombinant expression and purification of HRV14 3C may be found in e.g. Cordingley et al., 3. Virol. 1989, 63, pp 5037-5045, Birch et al., Protein Expr Purif., 1995, 6, pp 609-618 and in WO2008/043847.

(51) Examples of microbial expression and purification of XaaProDAP from Lactococcus lactis may be found in e.g. Chich et al, Anal. Biochem, 1995, 224, pp 245-249 and Xin et al., Protein Expr. Purif. 2002, 24, pp 530-538.

(52) In a further aspect the present invention provides a method for cleaving an Enterokinase-cleavable fusion polypeptide, said method comprising the steps: a) expressing the Enterokinase-cleavable fusion polypeptide comprising the polypeptide of the formula:
Z.sub.2-X.sub.6-X.sub.5-X.sub.4-G-D-R-Z.sub.1(I) SEQ ID NO: 1 wherein Z.sub.1 is a polypeptide comprising at least 2 amino acid residues; X.sub.4 is E, Q, L, D, G, A, S, F, H, Y, W, T or M; X.sub.5 is selected from the genetically encoded amino acids but S and I; X.sub.6 is absent or selected from the genetically encoded amino acids; Z.sub.2 is an optional polypeptide or amino acid residue; wherein said target polypeptide is Z.sub.1 in formula (I); b) contacting said Enterokinase-cleavable fusion polypeptide with an Enterokinase under conditions facilitating cleavage.

(53) In a further aspect the present invention provides a method for making a target polypeptide, said method comprising the steps: a) expressing the Enterokinase-cleavable fusion polypeptide according to the present invention, wherein said target polypeptide is Z.sub.1 in formula (I), b) contacting said Enterokinase-cleavable fusion polypeptide with an Enterokinase under conditions facilitating cleavage, and c) isolating said target polypeptide.

(54) Enterokinases useful for this method are any mammalian Enterokinase, such as bovine Enterokinase, human Enterokinase or functional variants thereof. Enterokinases may also be referred to as enteropeptidases. Since the light chain of Enterokinase comprises the catalytic domain and is active in the absence of the heavy chain, other useful Enterokinases are the bovine light chain or functional variants thereof. Such bovine light chain variants are disclosed in e.g. WO2013/092855A1, e.g. the (C112A) variant and the (C112A, L134K, I135K) variant.

(55) The Enterokinase cleavage according to the above method may be performed under a number of cleavage conditions. In one embodiment the method is conducted wherein the contacting in step b) is carried out in an aqueous solution comprising an organic solvent. This organic solvent may e.g. be selected from methanol, ethanol, i-propanol, n-propanol, acetone, glycerol or a mixture thereof. In one embodiment said organic solvent is ethanol in a concentration from about 10% w/w to about 25% w/w. In one embodiment said organic solvent is methanol, ethanol, i-propanol, n-propanol, acetone, glycerol or a mixture thereof in a concentration from about 10% w/w to about 25% w/w.

EMBODIMENTS OF THE INVENTION

(56) The invention is further described by the following non-limiting embodiments: 1. Enterokinase-cleavable fusion polypeptide comprising the polypeptide of the formula:
Z.sub.2-X.sub.6-X.sub.5-X.sub.4-G-D-R-Z.sub.1(I) SEQ ID NO: 1 wherein Z.sub.1 is a polypeptide comprising at least 2 amino acid residues; X.sub.4 is E, Q, L, D, G, A, S, F, H, Y, W, T or M; X.sub.5 is selected from the genetically encoded amino acids but S and I; X.sub.6 is absent or selected from the genetically encoded amino acids; Z.sub.2 is an optional polypeptide or amino acid residue. 2. Enterokinase-cleavable fusion polypeptide comprising the polypeptide of the formula:
Z.sub.2-X.sub.6-X.sub.5-X.sub.4-G-D-R-Z.sub.1(I) SEQ ID NO: 1 wherein Z.sub.1 is a polypeptide comprising at least 2 amino acid residues; X.sub.4 is E, Q, L, D, G, A, S, F, H, Y, W, T or M; X.sub.5 is selected from the genetically encoded amino acids but S and I; X.sub.6 is absent or selected from the genetically encoded amino acids; Z.sub.2 is an optional polypeptide or amino acid residue; and wherein i) Z.sub.1 comprises a functional polypeptide, such as a pharmaceutically active polypeptide or an enzyme, ii) said Enterokinase-cleavable fusion polypeptide consists of formula (I) and Z.sub.2 comprises 40 or less amino acid residues, or iii) Z.sub.2 comprises a solubilisation domain. 3. The Enterokinase-cleavable fusion polypeptide according to embodiment 1 or 2, wherein X.sub.5 is G, P, A, V, L, M, C, F, Y, W, H, K, R, Q, N, E, D and T. 4. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-3, wherein X.sub.4 is E, Q, L, D, G, A, S, F, H, Y, W or T. 5. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-4, wherein X.sub.4 is E, Q, L, D, G or A. 6. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.4 is E. 7. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.4 is Q. 8. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.4 is L. 9. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.4 is D. 10. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.4 is G. 11. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.4 is A. 12. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5 is D or E. 13. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5 is D. 14. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5 is E. 15. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DE. 16. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DD. 17. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DL. 18. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DQ. 19. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DG. 20. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DA. 21. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is DS. 22. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is EE. 23. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is EQ. 24. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is EL. 25. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is ED. 26. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is EG. 27. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is EA. 28. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is ES. 29. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is QE. 30. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is HE. 31. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is NE. 32. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-5, wherein X.sub.5-X.sub.4 is ME. 33. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein X.sub.6 is I, G, L, T, R, S, M, H, F, P, V, W, K, E, Y or Q. 34. The Enterokinase-cleavable fusion polypeptide according to embodiment 33, wherein X.sub.6 is I, G, L, T, R, S, M, H, F, P, V or W. 35. The Enterokinase-cleavable fusion polypeptide according to embodiment 34, wherein X.sub.6 is I, G, L, T, R or S. 36. The Enterokinase-cleavable fusion polypeptide according to embodiment 35, wherein X.sub.6 is I. 37. The Enterokinase-cleavable fusion polypeptide according to embodiment 35, wherein X.sub.6 is G. 38. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-32, wherein X.sub.6 is absent. 39. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.2 is a polypeptide facilitating the expression of said Enterokinase-cleavable fusion polypeptide in a host cell. 40. The Enterokinase-cleavable fusion polypeptide according to embodiment 39, wherein said host cell is E. coli. 41. The Enterokinase-cleavable fusion polypeptide according to embodiment 39, wherein said host cell is a yeast. 42. The Enterokinase-cleavable fusion polypeptide according to embodiments 39-40, wherein said host cell is Saccharomyces cerevisiae. 43. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.2 is absent. 44. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.2 is a polypeptide having from 0 to 10 amino acid residues. 45. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is a polypeptide having from 2 to 8 amino acid residues. 46. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is a polypeptide having at least 8 amino acid residues. 47. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 comprises 40 or less amino acid residues. 48. The Enterokinase-cleavable fusion polypeptide according any to embodiments claim 1-42, wherein Z.sub.2 is an amino acid residue or Z.sub.2 is a polypeptide comprising 2-40 amino acid residues. 49. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is a polypeptide having from about 8 to about 200 amino acid residues. 50. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is a polypeptide having from about 10 to about 25 amino acid residues. 51. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is selected from the group consisting of EEK, EEAEK (SEQ ID NO: 20), HK, EEAHK (SEQ ID NO: 21), E(EA)2HK (SEQ ID NO: 22), E(EA)3HK (SEQ ID NO: 23), EEGHK (SEQ ID NO: 24), EHPK (SEQ ID NO: 63), EEGEPK (SEQ ID NO: 25), EEAHELK (SEQ ID NO: 26), EEAHEVK (SEQ ID NO: 27), EEAHEMK (SEQ ID NO: 28), EEAHEFK (SEQ ID NO: 29), EEAHEYK (SEQ ID NO: 30), EEAHEWKEEGNTTPK (SEQ ID NO: 31) and EELDARLEALK (SEQ ID NO: 32). 52. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is selected from the group consisting of DV, DVKPGQPLA (SEQ ID NO: 47), DVKPGQPEY (SEQ ID NO: 48), DVKPGEPLY (SEQ ID NO: 49), DVKPGQPLY (SEQ ID NO: 50), DVKPGQPLE (SEQ ID NO: 51) and DVKPGQPMY (SEQ ID NO: 52). 53. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-42, wherein Z.sub.2 is selected from the group consisting of DVKPGQPLY (SEQ ID NO: 50), DVKPGQELY (SEQ ID NO: 53), DVKPGEPLY (SEQ ID NO: 49), DVKPEQPLY (SEQ ID NO: 54), DVKPGQPEY (SEQ ID NO: 48), DVKEGQPLY (SEQ ID NO: 55), DVKPGQPLA (SEQ ID NO: 47), DVKPGQPLE (SEQ ID NO: 51) and DVEPGQPLY (SEQ ID NO: 64). 54. The Enterokinase-cleavable fusion polypeptide according to embodiment 1-42, wherein Z.sub.2 comprises a sequence selected from the group consisting of QPMYKR (SEQ ID NO: 33), GQPMYK (SEQ ID NO: 34), PGQPMY (SEQ ID NO: 35), KPGQPM (SEQ ID NO: 36), LKPGQP (SEQ ID NO: 37), QLKPGQ (SEQ ID NO: 38), LQLKPG (SEQ ID NO: 39), WLQLKP (SEQ ID NO: 40), HWLQLK (SEQ ID NO: 41), WHWLQL (SEQ ID NO: 42), AWHWLQ (SEQ ID NO: 43), EAWHWL (SEQ ID NO: 44), AEAWHW (SEQ ID NO: 45) and EAEAWH (SEQ ID NO: 46). 55. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.2 comprises a solubilisation domain. 56. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.1 comprises functional polypeptide, such as a pharmaceutically active polypeptide or an enzyme. 57. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.1 is a pharmaceutically active polypeptide, an enzyme, or a precursor hereof. 58. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.1 is a GLP-1 peptide or a functional variant thereof. 59. The Enterokinase-cleavable fusion polypeptide according to embodiment 58, wherein Z.sub.1 is K34R-GLP-1(7-37) or K34R-GLP-1(9-37). 60. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-57, wherein Z.sub.1 is a glucagon peptide or a functional variant thereof. 61. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-57, wherein Z.sub.1 is an insulin precursor or a functional variant thereof. 62. The Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-57, wherein Z.sub.1 is selected from the group consisting of exendin, PYY, leptin and functional variants thereof. 63. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.1 is a polypeptide having from about 15 to about 100 amino acid residues. 64. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.1 is a polypeptide having from about 15 to about 50 amino acid residues. 65. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, which is a non-naturally occurring polypeptide. 66. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein Z.sub.1 and Z.sub.2 are derived from different origins, i.e. different species or synthetic. 67. The Enterokinase-cleavable fusion polypeptide according to any of the preceding embodiments, wherein said Enterokinase-cleavable fusion polypeptide consists of formula (I). 68. DNA sequence encoding the Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-67. 69. Expression vector comprising the DNA sequence according to embodiment 68 operatively linked to an upstream promotor and a downstream terminator. 70. Host cell comprising the expression vector according to embodiment 69. 71. The host cell according to embodiment 70, which is a yeast, a bacterium or a fungi. 72. The host cell according to any of embodiments 70-71, which is selected from the group consisting of Saccharomyces spp., Pichia spp., Hansenula spp. and Kluyveromyces spp. 73. The host cell according to any of embodiments 70-72, which is Saccharomyces cerevisiae. 74. The host cell according to any of embodiments 70-71, which is selected from the group consisting of Escherichia coli and Bacillus spp. 75. Method for cleaving an Enterokinase-cleavable fusion polypeptide, said method comprising the steps: a) expressing the Enterokinase-cleavable fusion polypeptide comprising the polypeptide of the formula:
Z.sub.2-X.sub.6-X.sub.5-X.sub.4-G-D-R-Z.sub.1(I) SEQ ID NO: 1 wherein Z.sub.1 is a polypeptide comprising at least 2 amino acid residues; X.sub.4 is E, Q, L, D, G, A, S, F, H, Y, W, T or M; X.sub.5 is selected from the genetically encoded amino acids but S and I; X.sub.6 is absent or selected from the genetically encoded amino acids; Z.sub.2 is an optional polypeptide or amino acid residue; wherein said target polypeptide is Z.sub.1 in formula (I); b) contacting said Enterokinase-cleavable fusion polypeptide with an Enterokinase under conditions facilitating cleavage. 76. Method for making a target polypeptide, said method comprising the steps: a) expressing the Enterokinase-cleavable fusion polypeptide according to any of embodiments 1-67 wherein said target polypeptide is Z.sub.1 in formula (I), b) contacting said Enterokinase-cleavable fusion polypeptide with an Enterokinase under conditions facilitating cleavage, and c) isolating said target polypeptide. 77. The method according to embodiment 75 or 76, wherein said Enterokinase used in step b) is selected from bovine Enterokinase, the bovine Enterokinase light chain or a functional variant thereof. 78. The method according to any of embodiments 75-78, wherein said Enterokinase is the bovine Enterokinase light chain variant (C112A), (C112A, L134K, I135K) or a functional variant thereof. 79. The method according to any of embodiments 75-77, wherein said contacting in step b) is carried out in an aqueous solution comprising an organic solvent. 80. The method according to embodiment 78, wherein said organic solvent is selected from methanol, ethanol, i-propanol, n-propanol, acetone, glycerol or a mixture thereof. 81. The method according to embodiment 79, wherein said organic solvent is ethanol in a concentration from about 10% w/w to about 25% w/w. 82. The method according to any of embodiments 76-80, wherein said step c) is optional. 83. A peptide comprising the amino acid sequence Z.sub.2-X.sub.8-X.sub.7, wherein Z.sub.2 is as defined in any of the preceding embodiments; X.sub.8 is absent or a peptide comprising an enterokinase cleavage site; and X.sub.7 is a polypeptide comprising at least 1 amino acid. 84. A peptide according to embodiment 83, wherein X.sub.8 is absent. 85. A peptide according to embodiment 83, wherein X.sub.8 comprises at least 2 amino acids, such as at least 3 amino acids, at least 4 amino acids, or at least 5 amino acids. 86. A peptide according to embodiment 83, wherein X.sub.8 comprises 1-30 amino acids, such as 3-20 amino acids, 4-15 amino acids, or at least 5-10 amino acids. 87. A peptide according to any of embodiments 83-86, wherein X.sub.7 comprises at least 5 amino acids, at least 10 amino acids, or at least 15 amino acids. 88. A peptide according to any of embodiments 83-86, wherein X.sub.7 comprises 1-100 amino acids, such as 10-70 amino acids or 20-50 amino acids. 89. A peptide according to any of embodiments 83-86, wherein X.sub.7 is Z.sub.1 as defined in any of the preceding embodiments. 90. A peptide according embodiment 89, wherein Z.sub.1 is a GLP-1 peptide or a functional variant thereof. 91. A peptide according to any of embodiments 83-90, wherein Z.sub.2-X.sub.8-X.sub.7 is an Enterokinase-cleavable fusion polypeptide. 92. A peptide according to any of embodiments 83-91, wherein X.sub.8 comprises the amino acid sequence X.sub.6-X.sub.5-X.sub.4-G-D-R, wherein X.sub.6, X.sub.5, and X.sub.4 are as defined in any of the preceding embodiments. 93. A peptide according to any of embodiments 83-91, wherein X.sub.8 comprises the amino acid sequence DDGDR (SEQ ID NO: 56) or DEGDR (SEQ ID NO: 57).

(57) All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference in their entirety and to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein (to the maximum extent permitted by law). All headings and sub-headings are used herein for convenience only and should not be construed as limiting the invention in any way. The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention. The citation and incorporation of patent documents herein is done for convenience only and does not reflect any view of the validity, patentability, and/or enforceability of such patent documents. This invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law.

EXAMPLES

List of Abbreviations

(58) EK: Enterokinase or enterokinase light chain

(59) D4K: DDDDK (SEQ ID NO:2)

(60) NMP: N-Methyl-2-Pyrrolidone.

(61) Abz: 2-aminobenzoyl

(62) Dnp: 2,4-dinitrophenyl

(63) Materials and Methods

(64) General Methods of Preparation

(65) Method: SPPS_I (Solid Phase Peptide Synthesis) Intramolecularly quenched fluorogenic peptide substrates having a C-terminal Lys(Abz)amide fluorophor and a N-terminal Lys(Dnp) quencher, were synthesized by Solid Phase Peptide Synthesis.

(66) These peptide substrates have the following general structure:
Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*Formula (II) wherein X.sub.6-X.sub.5-X.sub.4 have the same meaning as in formula (I) (each being an amino acid, however X.sub.6 being optional), Z.sub.2 is Lys(Dnp) and Z.sub.1* is Z.sub.1-Lys(Abz)amide, where Z.sub.1 is as defined in formula (I). SPPS_I was performed on a Multipep RSi synthesizer from Intavis Bioanalytical Instruments AG (Koeln, Germany) at 3-mol scale in parallel using 2.5 fold excess of Fmoc-amino acids (300 mM in NMP with 300 mM Oxyma Pure) relative to resin loading e.g. Rinkamide-Chematrix (0.5 mmol/g). Fmoc-deprotection was performed using 20% piperidine in NMP. Coupling was performed using 1:1:1:1 amino acid/Oxyma Pure/DIC/collidine in NMP. All amino acids were double or triple coupled, meaning that after the first coupling (60 min), the resin is drained and more reagents are added (amino acid, Oxyma Pure, DIC, and collidine), and the mixture allowed to react again (60 min).

(67) Method: EK Purification Preparations of purified enterokinase enzyme was prepared according to the procedure described in WO2013/092855A1.
General Methods of Detection and Characterisation

(68) Method: EK-Kinetics_1 EK-kinetics_1 was performed by measuring initial rates of hydrolysis of intramolecularly quenched fluorogenic peptides: Lys(Dnp)-peptide-Lys(Abz)amide according to formula (II). After measuring the background fluorescence of peptides, generally at a substrate concentration in the range of 1 to 50 M, initial rates of hydrolysis was measured by addition of purified enterokinase enzyme at a concentration enabling reading the initial rate of hydrolysis, i.e. less than 5% hydrolysis in 30 min. Typically an enzyme concentration of 1 to 10 nM may be used. After up to one hour of hydrolysis additional enzyme was added to enable measurement of the fluorescence level at total hydrolysis. Hydrolysis rates were generally measured in 50 mM MOPS buffer, 1 mM EDTA, pH 7.5 at 25 C. using a Perkin Elmer Enspire fluorescence plate reader using 320 nm for excitation and 420 nm for emission.

(69) Method: EK-kinetics_2 EK-kinetics_2 was performed by calculating initial rates of hydrolysis of full length GLP-1 with an N-terminal extension. Substrate concentrations were in the range 150-300 M. The hydrolysis reaction was started by adding an amount of enterokinase giving a final concentration of 9.5 nM. Samples were taken after 6.2 min, 18.7 min, 43.7 min, 86.3 min, 151.3 min, and 243.8 min and quenched by a 1+9 dilution into 5% acetic acid. A suitable method was used on a Waters iClass UPLC to separate and individually quantify remaining substrate and formed product on an analytical reversed-phase column by integrating peak areas. An equation of the following form was fitted to the raw data:

(70) c S t = c S 0 - k cat * c E * c S 0 K m * ( 1 + c P t K i + c S 0 ) * t

(71) wherein t is time, c.sub.s0 is initial substrate concentration, c.sub.E is enzyme concentration, c.sub.Pt is product concentration at time t, c.sub.St is substrate concentration at time t, k.sub.cat and K.sub.m are hydrolysis parameters, and K.sub.i is product inhibition constant. A constant K.sub.i of 0.1 M was used for all reactions. Initial hydrolysis rates were calculated based on the parameters determined for a initial substrate concentration of 1 mg/ml for all peptides. All reactions were performed in 50 mM Tris buffer, 1 mM EDTA, pH 8.5.

(72) Enterokinase Enzymes

(73) The Enterokinase enzymes used for examples herein was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

Examples 1-39

(74) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of GLP-1(7-37).

(75) For all of Examples 1-39 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is HAEGT (SEQ ID NO: 10), i.e. the N-terminal pentapeptide from GLP-1(7-37), X.sub.6 is absent and X.sub.5-X.sub.4 is as specified in Table 1. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics_1 method. The Enterokinase enzymes used for Examples 1-39 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(76) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(77) For instance, for Example 1 the substrate has the following structure Lys(Dnp)-AEGDR-HAEGT-Lys(Abz)amide (SEQ ID NO: 11) which is a model substrate for Enterokinase-cleavable fusion polypeptides comprising the Enterokinase cleavage site AEGDR (SEQ ID NO: 12).

(78) TABLE-US-00001 TABLE 1 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide HAEGT (SEQ ID NO: 10) (D4K site being 100%). Example Z.sub.1 X.sub.5-X.sub.4 Activity (%) 1 HAEGT (SEQ ID NO: 10) AE 382 2 HAEGT (SEQ ID NO: 10) DA 496 3 HAEGT (SEQ ID NO: 10) DD 604 4 HAEGT (SEQ ID NO: 10) DD 601 5 HAEGT (SEQ ID NO: 10) DE 1096 6 HAEGT (SEQ ID NO: 10) DE 942 7 HAEGT (SEQ ID NO: 10) DF 550 8 HAEGT (SEQ ID NO: 10) DG 431 9 HAEGT (SEQ ID NO: 10) DH 545 10 HAEGT (SEQ ID NO: 10) DL 795 11 HAEGT (SEQ ID NO: 10) DL 722 12 HAEGT (SEQ ID NO: 10) DQ 770 13 HAEGT (SEQ ID NO: 10) DS 504 14 HAEGT (SEQ ID NO: 10) DS 380 15 HAEGT (SEQ ID NO: 10) DT 434 16 HAEGT (SEQ ID NO: 10) DW 513 17 HAEGT (SEQ ID NO: 10) DY 505 18 HAEGT (SEQ ID NO: 10) EA 582 19 HAEGT (SEQ ID NO: 10) ED 632 20 HAEGT (SEQ ID NO: 10) EE 988 21 HAEGT (SEQ ID NO: 10) EF 486 22 HAEGT (SEQ ID NO: 10) EG 586 23 HAEGT (SEQ ID NO: 10) EH 549 24 HAEGT (SEQ ID NO: 10) EL 659 25 HAEGT (SEQ ID NO: 10) EQ 808 26 HAEGT (SEQ ID NO: 10) ES 557 27 HAEGT (SEQ ID NO: 10) ET 475 28 HAEGT (SEQ ID NO: 10) EW 456 29 HAEGT (SEQ ID NO: 10) EY 539 30 HAEGT (SEQ ID NO: 10) FE 397 31 HAEGT (SEQ ID NO: 10) HE 468 32 HAEGT (SEQ ID NO: 10) LE 398 33 HAEGT (SEQ ID NO: 10) ME 419 34 HAEGT (SEQ ID NO: 10) NE 457 35 HAEGT (SEQ ID NO: 10) PE 441 36 HAEGT (SEQ ID NO: 10) QE 551 37 HAEGT (SEQ ID NO: 10) TE 393 38 HAEGT (SEQ ID NO: 10) VE 388 39 HAEGT (SEQ ID NO: 10) YE 377

Examples 40-59

(79) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of a GLP-1(9-37) Variant.

(80) For all of the Examples 40-59 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is EGTFT (SEQ ID NO: 13), i.e. the N-terminal pentapeptide from GLP-1(9-37), X.sub.6 is absent and X.sub.5-X.sub.4 is as specified in Table 2. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics_1 method. The Enterokinase enzymes used for Examples 40-59 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(81) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(82) TABLE-US-00002 TABLE 2 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide EGTFT (SEQ ID NO: 13) (D4K site being 100%). Example Z.sub.1 X.sub.5-X.sub.4 Activity (%) 40 EGTFT (SEQ ID NO: 13) DD 428 41 EGTFT (SEQ ID NO: 13) DE 890 42 EGTFT (SEQ ID NO: 13) DF 419 43 EGTFT (SEQ ID NO: 13) DG 322 44 EGTFT (SEQ ID NO: 13) DH 398 45 EGTFT (SEQ ID NO: 13) DL 438 46 EGTFT (SEQ ID NO: 13) DQ 412 47 EGTFT (SEQ ID NO: 13) DS 342 48 EGTFT (SEQ ID NO: 13) DW 410 49 EGTFT (SEQ ID NO: 13) DY 373 50 EGTFT (SEQ ID NO: 13) EA 355 51 EGTFT (SEQ ID NO: 13) ED 505 52 EGTFT (SEQ ID NO: 13) EE 580 53 EGTFT (SEQ ID NO: 13) EG 380 54 EGTFT (SEQ ID NO: 13) EH 339 55 EGTFT (SEQ ID NO: 13) EL 396 56 EGTFT (SEQ ID NO: 13) EQ 442 57 EGTFT (SEQ ID NO: 13) ES 362 58 EGTFT (SEQ ID NO: 13) EY 353 59 EGTFT (SEQ ID NO: 13) QE 411

Examples 60-79

(83) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of Exendin-4.

(84) For all of the Examples 60-79 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is HGEGT (SEQ ID NO: 14), i.e. the N-terminal pentapeptide from Exendin-4, X.sub.6 is absent and X.sub.5-X.sub.4 is as specified in Table 3. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics.sub.1 method. The Enterokinase enzymes used for Examples 60-79 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(85) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(86) TABLE-US-00003 TABLE 3 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide HGEGT (SEQ ID NO: 14) (D4K site being 100%). Example Z.sub.1 X.sub.5-X.sub.4 Activity (%) 60 HGEGT (SEQ ID NO: 14) DD 439 61 HGEGT (SEQ ID NO: 14) DE 736 62 HGEGT (SEQ ID NO: 14) DF 253 63 HGEGT (SEQ ID NO: 14) DG 301 64 HGEGT (SEQ ID NO: 14) DH 526 65 HGEGT (SEQ ID NO: 14) DL 438 66 HGEGT (SEQ ID NO: 14) DQ 467 67 HGEGT (SEQ ID NO: 14) DS 282 68 HGEGT (SEQ ID NO: 14) DW 338 69 HGEGT (SEQ ID NO: 14) DY 469 70 HGEGT (SEQ ID NO: 14) EA 275 71 HGEGT (SEQ ID NO: 14) ED 462 72 HGEGT (SEQ ID NO: 14) EE 641 73 HGEGT (SEQ ID NO: 14) EG 279 74 HGEGT (SEQ ID NO: 14) EH 491 75 HGEGT (SEQ ID NO: 14) EL 502 76 HGEGT (SEQ ID NO: 14) EQ 432 77 HGEGT (SEQ ID NO: 14) ES 221 78 HGEGT (SEQ ID NO: 14) EY 338 79 HGEGT (SEQ ID NO: 14) QE 275

Examples 80-83

(87) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of a Glucagon Analogue.

(88) For all of Examples 80-83 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is HGTFT (SEQ ID NO: 15), i.e. the N-terminal pentapeptide from a glucagon analogue, and X.sub.5-X.sub.4 is as specified in Table 4. The substrates were synthesized by the SPPS-I method, purified by EKpurification and their initial Enterokinase cleavage rates were determined by the EK-kinetics_1 method. The Enterokinase enzymes used for Examples 80-83 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(89) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(90) TABLE-US-00004 TABLE 4 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide HGTFT (SEQ ID NO: 15) (D4K site being 100%). Example Z.sub.1 X.sub.5-X.sub.4 Activity (%) 80 HGTFT (SEQ ID NO: 15) DD 402 81 HGTFT (SEQ ID NO: 15) DE 392 82 HGTFT (SEQ ID NO: 15) DL 216 83 HGTFT (SEQ ID NO: 15) DS 172

Examples 84-87

(91) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of a Glucagon Analogue.

(92) For all of Examples 84-87 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is QGTFT (SEQ ID NO: 16), i.e. the N-terminal pentapeptide from a glucagon analogue, X.sub.6 is absent and X.sub.5-X.sub.4 is as specified in Table 5. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics_1 method. The Enterokinase enzymes used for Examples 84-87 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(93) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(94) TABLE-US-00005 TABLE 5 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide QGTFT (SEQ ID NO: 16) (D4K site being 100%). Example Z.sub.1 X.sub.5-X.sub.4 Activity (%) 84 QGTFT (SEQ ID NO: 16) DD 338 85 QGTFT (SEQ ID NO: 16) DE 411 86 QGTFT (SEQ ID NO: 16) DL 222 87 QGTFT (SEQ ID NO: 16) DS 125

Examples 88-91

(95) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of Human Glucagon.

(96) For all of Examples 88-91 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is HSQGT (SEQ ID NO: 17), i.e. the N-terminal pentapeptide from human glucagon, X.sub.6 is absent and X.sub.5-X.sub.4 is as specified in Table 6. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics.sub.1 method. The Enterokinase enzymes used for Examples 88-91 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(97) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(98) TABLE-US-00006 TABLE 6 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide HSQGT (SEQ ID NO: 17) (D4K site being 100%). Example Z.sub.1 X.sub.5-X.sub.4 Activity (%) 88 HSQGT (SEQ ID NO: 17) DD 310 89 HSQGT (SEQ ID NO: 17) DE 621 90 HSQGT (SEQ ID NO: 17) DL 268 91 HSQGT (SEQ ID NO: 17) DS 200

Examples 92-110

(99) Relative Cleavage Rate of Reference Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of GLP-1(7-37) and Different X.sub.6.

(100) For all of Examples 92-110 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is HAEGT (SEQ ID NO: 10), i.e. the N-terminal pentapeptide from GLP-1(7-37), X.sub.5-X.sub.4 is DE and X.sub.6 is as specified in Table 7. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics_1 method. The Enterokinase enzymes used for Examples 92-110 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(101) The initial rate of Enterokinase cleavage is normalised against the substrate having X.sub.6-X.sub.5-X.sub.4=ADE (100%).

(102) TABLE-US-00007 TABLE 7 Relative Enterokinase cleavage rate of substrates having as Z.sub.1 the peptide HAEGT (SEQ ID NO: 10), X.sub.6 as specified in the table and X.sub.5-X.sub.4 = DE (X.sub.6-X.sub.5-X.sub.4 = ADE being 100%). Example Z.sub.1 X.sub.6-X.sub.5-X.sub.4 Activity (%) 92 HAEGT (SEQ ID NO: 10) ADE 100 93 HAEGT (SEQ ID NO: 10) DDE 113 94 HAEGT (SEQ ID NO: 10) EDE 159 95 HAEGT (SEQ ID NO: 10) FDE 200 96 HAEGT (SEQ ID NO: 10) GDE 267 97 HAEGT (SEQ ID NO: 10) HDE 204 98 HAEGT (SEQ ID NO: 10) IDE 283 99 HAEGT (SEQ ID NO: 10) KDE 175 100 HAEGT (SEQ ID NO: 10) LDE 259 101 HAEGT (SEQ ID NO: 10) MDE 209 102 HAEGT (SEQ ID NO: 10) NED 114 103 HAEGT (SEQ ID NO: 10) PDE 194 104 HAEGT (SEQ ID NO: 10) QDE 141 105 HAEGT (SEQ ID NO: 10) RDE 222 106 HAEGT (SEQ ID NO: 10) SDE 222 107 HAEGT (SEQ ID NO: 10) TDE 237 108 HAEGT (SEQ ID NO: 10) VDE 184 109 HAEGT (SEQ ID NO: 10) WDE 181 110 HAEGT (SEQ ID NO: 10) YDE 153

Examples 111-117

(103) Relative Cleavage Rate of Reference Enterokinase-Cleavable Fusion Polypeptides Comprising the N-Terminal of GLP-1(7-37).

(104) For all of the Examples 111-117 the substrate is Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1*, wherein Z.sub.1 is HAEGT (SEQ ID NO: 10), i.e. the N-terminal pentapeptide from GLP-1(7-37), X.sub.6 is absent and the Enterokinase site corresponding to X.sub.5-X.sub.4-GDR is as specified in Table 8. The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics_1 method.

(105) The EK-site as specified in Table 8 designates the pentapeptide corresponding to the X.sub.5-X.sub.4-GDR sequence. Hence, in Example 111 the substrate has the structure Lys(Dnp)-IMGDRHAEGT-Lys(Abz)amide (SEQ ID NO: 18), and in Example 112 the substrate has the structure Lys(Dnp)-INDDRHAEGT-Lys(Abz)amide (SEQ ID NO: 19). Thus, in Example 112 the Enterokinase site does not include the GDR sequence but rather a DDR sequence. The Enterokinase enzymes used for Examples 111-117 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(106) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(107) TABLE-US-00008 TABLE 8 Relative Enterokinase cleavage rate of reference substrates having as Z.sub.1 the peptide HAEGT (SEQ ID NO: 10) (D4K site being 100%). EK-site (corresponding Example Z.sub.1 to X.sub.5-X.sub.4-GDR) Activity (%) 111 HAEGT (SEQ ID NO: 10) IMGDR 125 112 HAEGT (SEQ ID NO: 10) INDDR 126 113 HAEGT (SEQ ID NO: 10) IYGDR 117 114 HAEGT (SEQ ID NO: 10) NYTDR 59 115 HAEGT (SEQ ID NO: 10) SGGDR 243 116 HAEGT (SEQ ID NO: 10) SSGDR 191 117 HAEGT (SEQ ID NO: 10) VIGDR 68

Examples 118-137

(108) Relative Cleavage Rate of Enterokinase-Cleavable Fusion Polypeptides Comprising the Entire [Arg34]GLP-1(9-37) Sequence and an N-Terminal Extension and Reference Enterokinase-Cleavable Fusion Polypeptides Comprising DDDDK (SEQ ID NO: 2).

(109) For all of the Examples 118-135 the substrate was Z.sub.2*-X.sub.6-X.sub.5-X.sub.4-GDR-Z.sub.1* (SEQ ID NO: 60), wherein Z.sub.2 and Z.sub.1 are as defined in Table 9, i.e. Z.sub.2 is an N-terminal extension of the Enterokinase-cleavable fusion polypeptide and Z.sub.1 is [Arg34]GLP-1(9-37), X.sub.6 is absent and the Enterokinase site corresponding to X.sub.5-X.sub.4-GDR is as specified in Table 9; except in reference examples, and as specified in Table 9 (e.g. Example 118), the substrate was Z.sub.2*-X.sub.6-DDDDK-Z.sub.1* (SEQ ID NO: 61). The substrates were synthesized by the SPPS-I method and their initial Enterokinase cleavage rates were determined by the EK-kinetics_2 method.

(110) The EK-site as specified in Table 9 designates the pentapeptide corresponding to the X.sub.5-X.sub.4-GDR sequence. Hence, in Example 119 the substrate has the structure DVKPGQPLYDEGDR-[Arg34]GLP-1(9-37) (SEQ ID NO: 62).

(111) The Enterokinase enzymes used for Examples 118-135 was the bovine light chain variant (C112A, L134K, I135K) as described in WO2013/092855A1.

(112) The initial rate of Enterokinase cleavage is normalised against the substrate having a D4K site (replacing the X.sub.5-X.sub.4-GDR in formula (II)).

(113) TABLE-US-00009 TABLE9 RelativeEnterokinasecleavagerateofreferencesubstratescomprisingthe entire[Arg34]GLP-1(9-37)sequenceasZ1andanN-terminalextensionasZ.sub.2 asdefinedbelow(slowestD4Ksiteinthissetbeing100%). EK-site (corresponding Example Z.sub.2 Z.sub.1 toX.sub.5-X.sub.4-GDR) Activity(%) 118 DVKPGQPLY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 136 119 (SEQIDNO:50) DEGDR(SEQIDNO:57) 707 120 DVKPGQELY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 168 121 (SEQIDNO:53) DEGDR(SEQIDNO:57) 1039 122 DVKPGEPLY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 162 123 (SEQIDNO:49) DEGDR(SEQIDNO:57) 895 124 DVKPEQPLY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 167 125 (SEQIDNO:54) DEGDR(SEQIDNO:57) 803 126 DVKPGQPEY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 158 127 (SEQIDNO:48) DEGDR(SEQIDNO:57) 625 128 DVKEGQPLY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 178 129 (SEQIDNO:55) DEGDR(SEQIDNO:57) 913 130 DVKPGQPLA [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 134 131 (SEQIDNO:47) DEGDR(SEQIDNO:57) 476 132 DVKPGQPLE [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 100 133 (SEQIDNO:51) DEGDR(SEQIDNO:57) 653 134 DVEPGQPLY [Arg34]GLP-1(9-37) DDDDK(SEQIDNO:2) 203 135 (SEQIDNO:64) DEGDR(SEQIDNO:57) 951

(114) While certain features of the invention have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those of ordinary skill in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes as fall within the true spirit of the invention.