Methods and compositions for live cell analysis of intracellular ATP

12158470 ยท 2024-12-03

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed herein are ATP biosensor fusion proteins and their use for assaying ATP levels in cells.

Claims

1. A polynucleotide comprising a nucleic acid encoding a fusion protein of genus X1-X2-X3-X4-X5, wherein: X1 is a FRET acceptor polypeptide consisting of the amino acid sequence of SEQ ID NO: 1, and X5 is a FRET donor polypeptide consisting of the amino acid sequence of SEQ ID NO: 4; X2 and X4 are selected from the group consisting of (i) X2 is A and X4 is A; (ii) X2 is S and X4 is SA; (iii) X2 is S and X4 is A; (iv) X2 is absent and X4 is GA; (v) X2 is absent and X4 is FF; and (vi) X2 is T and X4 is GTSG; and X3 is an ATP binding protein consisting of the amino acid sequence of SEQ ID NO: 5; wherein binding of ATP by the ATP binding protein causes interaction of the FRET acceptor polypeptide and the FRET donor polypeptide.

2. An expression vector comprising the polynucleotide of claim 1, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein.

3. A recombinant host cell comprising the expression vector of claim 2.

4. A kit comprising: (a) the polynucleotide of claim 1; and (b) a control polynucleotide, wherein the control polynucleotide comprises a nucleic acid encoding a control fusion protein of genus X1-X2-X3-X4-X5, wherein: X1 is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 1, and X5 is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 4; X2 and X4 are selected from the group consisting of (i) X2 is A and X4 is A; (ii) X2 is S and X4 is SA; (iii) X2 is S and X4 is A; (iv) X2 is absent and X4 is GA; (v) X2 is absent and X4 is FF; and (vi) X2 is T and X4 is GTSG; and X3 is a polypeptide consisting of the amino acid sequence of SEQ ID NO: 12.

5. A method of assaying ATP, comprising: (a) expressing the fusion protein encoded by the polynucleotide of claim 1 in one or more first cells, and generating one or more images selected from the group consisting of: (i) a fluorescence image generated by detecting fluorescent signals produced by light having the FRET acceptor polypeptide emission wavelength emitted from the one or more first cells upon exposing the one or more first cells to light having the FRET donor polypeptide excitation wavelength; (ii) a fluorescence image generated by detecting fluorescent signals produced by light having the FRET acceptor polypeptide emission wavelength emitted from the one or more first cells upon exposing the one or more first cells to light having the FRET acceptor polypeptide excitation wavelength; (iii) a fluorescence image generated by detecting fluorescent signals produced by light having the FRET donor polypeptide emission wavelength emitted from the one or more first cells upon exposing the one or more first cells to light having the FRET donor polypeptide excitation wavelength; and (iv) any combinations of (i), (ii), and (iii); and (b) determining a FRET ratio in the one or more first cells by comparing the output of fluorescent signals in the fluorescent image of (i), the fluorescent image of (ii), and/or the fluorescent image of (iii); wherein the level of ATP in the one or more first cells is proportional to the determined FRET ratio.

6. The polynucleotide of claim 1, wherein X2 is A and X4 is A.

7. The polynucleotide of claim 1, wherein the fusion protein comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 7, 8, 9, 10, and 11.

8. The kit of claim 4, wherein the control polynucleotide encodes a control fusion protein comprising the amino acid sequence of SEQ ID NO: 13.

9. The polynucleotide of claim 1, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 7.

10. An expression vector comprising the polynucleotide of claim 6, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein.

11. An expression vector comprising the polynucleotide of claim 7, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein.

12. An expression vector comprising the polynucleotide of claim 9, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein.

13. A recombinant host cell comprising the expression vector of claim 10.

14. A recombinant host cell comprising the expression vector of claim 11.

15. A recombinant host cell comprising the expression vector of claim 12.

16. The kit of claim 4, wherein the polynucleotide encodes a fusion protein, wherein the fusion protein comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 7, 8, 9, 10, and 11.

17. The kit of claim 4, wherein the polynucleotide encodes a fusion protein, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 7.

18. The kit of claim 17, wherein the control polynucleotide encodes a control fusion protein comprising the amino acid sequence of SEQ ID NO: 13.

19. The kit of claim 4, wherein (i) the polynucleotide is present in a first expression vector, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein; and (ii) the control polynucleotide is present in a second expression vector, wherein the control polynucleotide is operatively linked to a promoter sequence capable of directing expression of the control fusion protein.

20. The kit of claim 16, wherein (i) the polynucleotide is present in a first expression vector, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein; and (ii) the control polynucleotide is present in a second expression vector, wherein the control polynucleotide is operatively linked to a promoter sequence capable of directing expression of the control fusion protein.

21. The kit of claim 17, wherein (i) the polynucleotide is present in a first expression vector, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein; and (ii) the control polynucleotide is present in a second expression vector, wherein the control polynucleotide is operatively linked to a promoter sequence capable of directing expression of the control fusion protein.

22. The kit of claim 18, wherein (i) the polynucleotide is present in a first expression vector, wherein the polynucleotide is operatively linked to a promoter sequence capable of directing expression of the fusion protein; and (ii) the control polynucleotide is present in a second expression vector, wherein the control polynucleotide is operatively linked to a promoter sequence capable of directing expression of the control fusion protein.

Description

DESCRIPTION OF THE FIGURES

(1) FIG. 1 is a graphical representation of signal window calculated for exemplary fusion proteins of the disclosure by subtracting the FRET ratio of drug-treated cells from the FRET ratio of the vehicle-treated cells 2 h post treatment.

(2) FIG. 2A-B are graphical comparisons of FRET ratios observed using exemplary fusion proteins of the disclosure ((A) GO-ATeam1; and (B) A1) in cell lines with stable expression of each sensor.

(3) FIG. 3A-B are graphical comparisons of excitation spectra observed using exemplary fusion proteins of the disclosure incubated with and without 10 mM ATP. The performance of sensor A1 (GO-ATeam-A1) (FIG. 3A) illustrates a greater than 2-fold increase in signal window (comparing ATP bound (solid line) to ATP unbound state (dashed line)) when compared to the performance of the GO-Ateam1 sensor (FIG. 3B).

(4) FIG. 4. ATP depletion via concurrent inhibition of glycolysis and OXPHOS by 2DG and KCN, respectively, on cells grown in standard media (FIG. 4A). Data demonstrate the time course of ATP depletion and concentration dependence of concurrent 2DG and KCN treatment. Comparison of cytotoxic (chlorpromazine, FIG. 4B) and mitotoxic (rotenone, FIG. 4C) compounds on cells grown in glucose or galactose media. The first two panels depict the effect of each compound over a 24 h time course in cells grown in glucose or galactose as indicated. The third panel depicts the concentration-response curve of each compound at the 24 h time point. Cytotoxic compounds show a similar effect under both media conditions, while mitotoxic compounds induce greater ATP depletion in cells grown in galactose.

(5) FIG. 5A-B. Effect of CB-839 in breast cancer cell lines in mono- or co-culture with fibroblasts. Representative data demonstrate prolonged ATP depletion in triple negative breast cancer (TNBC) cells, which is attenuated by co-culture with CCD-1068Sk fibroblasts (FIG. 5A). In contrast, receptor positive cells demonstrated recovery from CB-839 treatment within 48 h, and the response was unaffected by the presence of fibroblasts (FIG. 5B).

DETAILED DESCRIPTION

(6) Scientific and technical terms used herein are intended to have the meanings commonly understood by those of ordinary skill in the art. Such terms are found defined and used in context in various standard references illustratively including J. Sambrook and D. W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; F. M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002; B. Alberts et al., Molecular Biology of the Cell, 4th Ed., Garland, 2002; D. L. Nelson and MM. Cox, Lehninger Principles of Biochemistry, 4th Ed., W. H. Freeman & Company, 2004; and Herdewijn, P. (Ed.), Oligonucleotide Synthesis: Methods and Applications, Methods in Molecular Biology, Humana Press, 2004.

(7) The singular terms a, an, and the are not intended to be limiting and include plural referents unless explicitly stated otherwise or the context clearly indicates otherwise.

(8) All embodiments disclosed herein can be combined unless the context clearly indicates otherwise.

(9) In a first aspect, the disclosure provides fusion proteins, comprising a polypeptide of genus X1-X2-X3-X4-X5, wherein: one of X1 and X5 comprises a fluorescence resonance energy transfer (FRET) acceptor polypeptide having an acceptor excitation wavelength and FRET emission wavelength, and the other of X1 and X5 comprises a FRET donor polypeptide having a donor excitation wavelength and a donor emission wavelength X2 and X4 independently are optional amino acid linkers; and X3 comprises an ATP binding protein; wherein binding of ATP by the ATP binding protein causes interaction of the FRET acceptor polypeptide and the FRET donor polypeptide.

(10) The fusion proteins of this first aspect can be used, for example, to detect and measure ATP in living cells, as detailed in the examples that follow.

(11) Fluorescence Resonance Energy Transfer (FRET) is non-radiative transfer of energy from an excited donor fluorophore to a suitable acceptor fluorophore in proximity to the donor. For selection of FRET fluorophore donor/acceptor polypeptide pairs for use in the fusion proteins of the disclosure, the absorption and emission wavelengths of each are considered. Based on the teachings herein, one of skill in the at can readily determine which of various fluorophores are to be used as FRET donor/acceptor polypeptide pairs in a particular application.

(12) In one embodiment, X1 comprises a FRET acceptor polypeptide and X5 comprises a FRET donor polypeptide; in another embodiment, X1 comprises a FRET donor polypeptide and X5 comprises a FRET acceptor polypeptide.

(13) Any suitable polypeptide fluorophores may be used, including but not limited to, any of green fluorescent protein and derivatives such as BFP, EBFP, EBFP2, ECFP, RFP, and YFP, and other polypeptide fluorophores described herein.

(14) In another embodiment, the FRET acceptor polypeptide has a maximal acceptor excitation wavelength in a range of 500 to 560 nm and an acceptor maximal emission wavelength in a range of 530 to 580 nm. In another embodiment as described in the examples that follow, the FRET acceptor polypeptide comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical along the length of the amino acid sequence of one or more of SEQ ID NOs:1-3 and identical at the chromophore (noted by highlighted residues). Residues in parentheses are optional throughout.

(15) TABLE-US-00001 mKOk (SEQIDNO:1) (MVSVI)KPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHR LVRKTEGNITEQVEDAVA(HS) mKO (SEQIDNO:2) (MSVIK)PEMKKRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAK GGPMPFAFDLVSHVFCYGHRPFTKYPEEIPDYFKQAFPEGLSWERSLEFE DGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKI TASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKKILKMPGSHYISHRL VRKTEGNITELVEDAVA(HS) mKO2 (SEQIDNO:3) (MVSVI)KPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQMKTTYKAAKEILEMPGDKYIGHR LVRKTEGNITEQVEDAVA(HS)

(16) In one embodiment, all optional amino acid residues in the FRET acceptor polypeptide are present.

(17) In another embodiment, the FRET donor polypeptide has a maximal donor excitation wavelength in a range of 450 to 500 nm and a maximal donor emission wavelength in a range of 480 to 515 nm. In another embodiment as described in the examples that follow, the FRET donor polypeptide comprises an amino acid sequence at least 85%, 87%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical along the length of the amino acid sequence of SEQ ID NO: 4 and identical at the chromophore (highlighted residues).

(18) TABLE-US-00002 Circularlypermuted(cpm)ECFP: SEQID.NO:4 (DG)SVQLADKYQQNTPIGDGFVLLPDNHYLSTQS(A/K)LSKDPNEKRD HMVLLEFVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDV NGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFS RYPDKMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNR IELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIE (EA)

(19) Exemplary FRET donor polypeptides having the requisite amino acid sequence identity to SEQ ID NO:4 and which can be used in the fusion proteins of the disclosure are listed in Table 1 below.

(20) TABLE-US-00003 TABLE 1 % Identity to Name SEQ ID NO: 4 Database accession # M1S2 protein [synthetic construct] 97% gi|400653667|AFP87541.1 PKG#6 [synthetic construct] 98% gi|1033838710|ANH79566.1 PKG#8 [synthetic construct] 98% gi|1033838714|ANH79568.1 NES-YC3.6 [Binary expression vector NES-YC3.6] 96% gi|378792854|AFC41195.1 yellow cameleon 2.60 [synthetic construct] 96% gi|50507914|BAD30083.1 yellow cameleon 4.60 [synthetic construct] 96% gi|50507918|BAD30085.1 yellow cameleon 3.60 [synthetic construct] 96% gi|50507916|BAD30084.1 YC3.6 [Binary expression vector YC3.6-C] 96% gi|378792870|AFC41207.1 yellow cameleon Nano50 [synthetic construct] 96% gi|302375510|ADL29888.1 Fluorescent Mg2+ indicator [synthetic construct] 96% gi|1341117861|BBC69164.1 calcium sensor cameleon D2cpv [synthetic construct] 96% gi|94471595|ABF21065.1 yellow cameleon X 2.60 [synthetic construct] 96% gi|765098779|BAQ56021.1 calcium sensor cameleon D3cpv [synthetic construct] 96% gi|94471597|ABF21066.1 yellow cameleon Nano15 [synthetic construct] 96% gi|302375506|ADL29886.1 yellow cameleon Nano30 [synthetic construct] 96% gi|302375508|ADL29887.1 YC3.6 [Binary expression vector YC3.6-N] 96% ai|378792874|AFC41210.1 NLS-YC3.6 [Binary expression vector NLS-YC3.6] 96% gi|378792858|AFC41198.1 yellow cameleon Nano140 [synthetic construct] 96% gi|302375514|ADL29890.1 yellow cameleon Nano65 [synthetic construct] 96% gi|302375512|ADL29889.1 calcium sensor cameleon lynD3cpv [synthetic construct] 96% gi|94471601|ABF21068.1 calcium sensor cameleon D4cpv [synthetic construct] 96% gi|94471599|ABF21067.1 yellow cameleon Nano50 96% gi|997831445|BAU51804.1 yellow cameleon 3.60-pm [synthetic construct] 96% gi|50507920|BAD30086.1 PKG#7 [synthetic construct] 96% gi|1033838712|ANH79567.1 PKG#2 [synthetic construct] 96% gi|1033838702|ANH79562.1 yellow cameleon Nano15 [Cloning vector pLN-YC Nano15] 96% gi|997831443|BAU51803.1 TP-D3cpv [Binary expression vector TP-D3cp] 96% gi|378792866|AFC41204.1 PKG#4 [synthetic construct] 96% gi|1033838706|ANH79564.1 photoactivatable calcium indicator PA-TNXL [ 96% gi|464095426|BAN00003.1 PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] 96% gi|378792862|AFC41201.1 mitochondrial calcium sensor cameleon 4mtD3cpv 96% gi|94471603|ABF21069.1 3x GFP [Cloning vector pGGC025] 93% gi|568816479|AHE38517.1 SV40-3xeGFP [Cloning vector pPLV04] 97% gi|334085767|AEG42740.1 calcium indicator TN-XXL [synthetic construct] 95% gi|194716543|ACF93133.1 three repeats of Citrine with GGSGGS linkers 96% gi|929652476|BAS49686.1 PKG#3 [synthetic construct] 95% gi|1033838704|ANH79563.1 Twitch-2B [synthetic construct] 94% gi|568402376|AHD25944.1 mVenus(L68V)-mTurquoise [synthetic construct] 91% gi|341940080|AEL12177.1 GEPRA-G [synthetic construct] 93% gi|478246796|BAN14786.1 NLS-YFP-CFP [Yeast integrative vector pBS42] 93% gi|544370144|AGW21605.1 NLS-YFP-Pro10-CFP [Yeast integrative vector pBS47] 91% gi|544370160|AGW21617.1 ratiometric fluorescent temperature indicator 87% gi|1177648317|BAX25172.1 NLS-YFP-Pro15-CFP [Yeast integrative vector pBS48] 89% gi|544370164|AGW21620.1 NLS-YFP-Pro5-CFP [Yeast integrative vector pBS46] 92% gi|544370156|AGW21614.1 NLS-YFP-Pro20-CFP [Yeast integrative vector pBS50] 87% gi|544370172|AGW21626.1 NLS-YFP CFP [Yeast integrative vector pBS42BN] 92% gi|544370148|AGW21608.1 MT1-MMP FRET probe protein [synthetic construct] 88% gi|170791211|ACB38271.1 ssrA-tagged green fluorescent protein [synthetic construct] 93% gi|339905310|AEK24782.1 photoconvertible fluorescent protein Phamret 90% gi|187370622|BAG31927.1 calcium-sensing GFP analog [synthetic construct] 99% gi|29150153|CAD79597.1 MolyProbe protein [synthetic construct] 96% ai|457866284|BAM93494.1 His-6-tagged G-CaMP1.6 [synthetic construct] 98% gi|94411311|ABF18599.1 G-CaMP2 [synthetic construct] 98% gi|87248062|ABD36085.1 GCaMP3 [synthetic construct] 97% gi|299818413|ADJ53338.1 dLight1.4 [synthetic construct] 97% gi|1398286563|AWS21700.1 GAP43-GCaMP6s [pAAV-hSyn1-FLEx-GAP43-GCaMP6s] 97% gi|1442830696|AXK50352.1 GAP43-GCaMP6m [pAAV-hSyn1-GAP43-GCaMP6m] 97% gi|1442830702|AXK50356.1 GAP43-GCaMP6f [Vector pAAV-hSyn1-GAP43-GCaMP6f] 97% gi|1442830699|AXK50354.1 dLight1.5 [synthetic construct] 97% gi|1398286565|AWS21701.1 5htLight1.1 [synthetic construct] 97% gi|1398286577|AWS21707.1 G-GECO1 [synthetic construct] 96% gi|345787073|AEO16868.1 dLight1.1 [synthetic construct] 97% gi|1398286555|AWS21696.1 dLight1.2 [synthetic construct] 97% gi|1398286557|AWS21697.1 dLight1.3a [synthetic construct] 97% gi|1398286559|AWS21698.1 dLightl ,3b [synthetic construct] 97% gi|1398286561|AWS21699.1 glutatmate sensor SF-iGluSnFR [synthetic construct] 95% gi|1488571045|AYH52532.1 glutatmate sensor SF-iGluSnFR [synthetic construct] 95% gi|1488571043|AYH52531.1 glutatmate sensor SF-iGluSnFR [synthetic construct] 95% gi|1488571041|AYH52530.1 nLight3.1 [synthetic construct] 97% gi|1398286571|AWS21704.1 GEX-GECO1 [synthetic construct] 96% gi|345786981|AEO16865.1 iGABA sensor nFR [synthetic construct] 95% gi|1488571039|AYH52529.1 kLight1.1 [synthetic construct] 97% gi|1398286573|AWS21705.1 mtLight1.1 [synthetic construct] 97% gi|1398286579|AWS21708.1 iGABA sensor nFR [synthetic construct] 95% gi|1488571035|AYH52527.1 iGABA sensor nFR [synthetic construct] 95% gi|1488571037|AYH52528.1 Crystal Structure Calcium Bound Dimeric Gcamp2 (#2) 96% gi|1209040728|3EVV_A mLight1.1 [synthetic construct] 97% gi|1398286575|AWS21706.1 ssrA-tagged green fluorescent protein [synthetic construct] 93% gi|339905308|AEK24781.1 G-GECO1.1 [synthetic construct] 96% gi|345787100|AEO16869.1 Chain A, Crystal Structure Of Circular-permutated Egfp 96% gi|217035443|3EVP_A nLight2.1 [synthetic construct] 97% gi|1398286569|AWS21703.1 nLight1.1 [synthetic construct] 97% gi|1398286567|AWS21702.1 G-CaMP6 protein [synthetic construct] 96% gi|815006828|AKE44624.1 G-CaMP7 protein [synthetic construct] 96% gi|815006830|AKE44625.1 GCaMP7a [synthetic construct] 96% gi|446512552|BAM78547.1 GEM-GECO1 [synthetic construct] 96% gi|345786945|AEO16864,1 G-CaMP-HS protein [synthetic construct] 96% gi|815006836|AKE44628.1 calcium-sensing GFP protein [synthetic construct] 96% gi|335060646|AEH27627.1 Crystal structure of Calcium bound monomeric GCAMP2 96% ai|217035444|3EVR_A G-CaMP4.1 protein [synthetic construct] 96% gi|810222674|AKE14367.1 G-CaMP8 protein [synthetic construct] 95% gi|815006832|AKE44626.1 G-GECO1.2 [synthetic construct] 95% gi|345787127|AEO16870.1 Crystal structure of Calcium bound dimeric GCAMP2 96% gi|217035445|3EVU_A Myosin light chain kinase, GFP, Calmodulin-1 chimera 96% gi|392311568|3SG6_A Calcium-free GCaMP2 (calcium binding deficient mutant) 96% gi|218681839|3EKJ_A Chain A, High Resolution Structure Of Delta-rest-gcamp3 96% gi|576865036|4IK5_A GCaMP6s-P2A-mKate2 97% gi|1442830714|AXK50364.1 GAP43-GCaMP6s-P2A-mKate2 97% gi|1442830705|AXK50358.1 GCaMP6s-P2A-mRuby3 97% gi|1442830717|AXK50366.1 Chain A, High Resolution Structure Of Gcampj At Ph 8.5 96% gi|582045214|4IK1_A

(21) Any suitable ATP binding protein can be used in the fusion proteins as deemed appropriate for an intended use (i.e.: capable of being expressed in the cell type to be assayed, etc.) In one non-limiting embodiment as described in the examples that follow, X3 comprises an ATP binding protein comprising the amino acid sequence at least 65%, 67%, 68%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical along the length of the amino acid sequence selected from the group consisting of SEQ ID NO:5-6 (residues in parentheses are optional).

(22) TABLE-US-00004 SEQIDNO:5:ModifiedsubunitofBacillus subtilisF.sub.oF.sub.1-ATPsynthase (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRAELALQRALNRLDVAGK SEQIDNO:6ModifiedsubunitofBacillus subtilisF.sub.oF.sub.1-ATPsynthasehavingtwoelements fromesubunitofBacillussp.PS3F.sub.oF.sub.1-ATP synthase,MtoYmutationandGKtoEMKsubstitu- tion(inbold) (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEYVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRAELALQRALNRLDVAEMK

(23) Exemplary ATP binding proteins having the requisite amino acid sequence identity to SEQ ID NO:5-6 and which can be used in the fusion proteins of the disclosure are listed in Table 2 below.

(24) TABLE-US-00005 TABLE 2 MULTISPECIES: ATP synthase epsilon chain [Bacillus], 97%, gi|489320353|WP_003227688.1 ATP synthase epsilon chain [Bacillus subtilis], 96%, gi|505296717|WP_015483819.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 96%, gi|504291152|WP_014478254.1 ATP synthase epsilon chain [Bacillus tequilensis], 95%, gi|639655008|WP_024713798.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 95%, gi|545118192|WP_021480810.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. FMQ74], 95%, gi|1102032633|WP_071577657.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 95%, gi|1280952059|WP_100275394.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus subtilis group], 95%, gi|1039477827|WP_064816018.1 F0F1 ATP synthase subunit epsilon [Bacillus subtilis], 94%, gi|1207627978|WP_087992693.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 94%, gi|745781482|WP_039075208.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 92%, gi|498018072|WP_010332228.1 F0F1 ATP synthase subunit epsilon [Bacillus halotolerans], 92%, gi|570758358|WP_024123161.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus subtilis group], 89%, gi|489420817|WP_003326558.1 MULTISPECIES: ATP synthase epsilon chain [Bacillus], 87%, gi|1489242972|WP_003151176.1 F0F1 ATP synthase subunit epsilon [Bacillus nakamurai], 86%, gi|1004344994|WP_061522539.1 MULTISPECIES: ATP synthase F0F1 subunit epsilon [Bacillus], 86%, gi|921995573|WP_053285344.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 86%, gi|740674878|WP_038460167.1 MULTISPECIES: ATP synthase epsilon chain [Bacillus], 86%, gi|723597160|WP_033574395.1 MULTISPECIES: ATP synthase epsilon chain [Bacillus], 85%, gi|503119226|WP_013353907.1 F0F1 ATP synthase subunit epsilon [Bacillus velezensis], 86%, gi|1207676870|WP_088037238.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillales], 95%, gi|489314501|WP_003221882.1 F0F1 ATP synthase subunit epsilon [Bacillus swezeyi], 82%, gi|1140910370|WP_076759287.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 82%, gi|651594109|WP_026589081.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 82%, gi|489278336|WP_003186004.1 F0F1 ATP synthase subunit epsilon [Bacillus sonorensis], 82%, gi|493689352|WP_006639406.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillales], 82%, gi|521288986|WP_020453254.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 82%, gi|806497211|WP_046130316.1 F0F1 ATP synthase subunit epsilon [Bacillus glycinifennentans], 81%, gi|860247715|WP_048355651.1 ATP synthase subunit epsilon [Bacillus subtilis XF-1], 95%, gi|449030049|AGE65288.1 F0F1 ATP synthase subunit epsilon [Bacillus gobiensis], 75%, gi|926266349|WP_053604535.1 F0F1 ATP synthase subunit epsilon [Anoxybacillus vitaminiphilus], 73%, gi|1408392372|WP_111644740.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. J37], 73%, gi|6515313841|WP_026563116.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 73%, gi|736227472|WP_034318329.1 F0F1 ATP synthase subunit epsilon [Bacillus xiamenensis], 73%, gi|495630347|WP_008354926.1 F0F1 ATP synthase subunit epsilon [Bacillus fastidiosus], 72%, gi|1054351039|WP_066230885.1 F0F1 ATP synthase subunit epsilon [Bacillus onubensis], 71%, gi|1272187322|WP_099360911.1 MULTISPECIES: ATP synthase F0F1 subunit epsilon [Bacillus], 73%, gi|915975869|WP_050944437.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. MBGLi79], 81%, gi|1339810892|AUZ40790.1 F0F1 ATP synthase subunit epsilon [Bacillus pumilus], 73%, gi|1002946034|WP_061409853.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. YN-1], 71%, gi|1493450619|WP_121448499.1 ATP synthase epsilon chain [Bacillus pumilus], 73%, gi|763278706|WP_044140142.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 72%, gi|736652987|WP_034660282.1 F0F1 ATP synthase subunit epsilon [Bacillus onubensis], 70%, gi|1272175367|WP_099354575.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 72%, gi|495618814|WP_008343393.1 F0F1 ATP synthase subunit epsilon [Bacillus safensis], 72%, gi|1207611961|WP_087977756.1 MULTISPECIES: ATP synthase epsilon chain [Bacillus], 72%, gi|489307156|WP_003214592.1 F0F1 ATP synthase subunit epsilon [Bacillus pumilus], 72%, gi|1274554308|WP_099682181.1 F0F1 ATP synthase subunit epsilon [Bacillus australimaris], 72%, gi|983547050|WP_060698605.1 F0F1 ATP synthase subunit epsilon [Bacillus indicus], 71%, gi|657860862|WP_029566603.1 F0F1 ATP synthase subunit epsilon [Bacillus alveayuensis], 71%, gi|765542636|WP_044749357.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. NMTD17], 72%, gi|1360795247|WP_106071342.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Anoxybacillus], 67%, gi|765534407|WP_044741555.1 F0F1 ATP synthase subunit epsilon [Bacillus stratosphericus], 71%, gj|494762213|WP_107497623.1 F0F1 ATP synthase subunit epsilon [Bacillus sinesaloumensis], 70%, gi|1148930458|WP_077619903.1 F0F1 ATP synthase subunit epsilon [Bacillus weihaiensis], 71%, gi|1119658527|WP_072578188.1 F0F1 ATP synthase subunit epsilon [Bacillus indicus], 71%, gi|657040285|WP_029283365.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. HNG], 69%, gi|1452393681|WP_116352015.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. HMSC76G11], 69%, gi|1093537853|WP_070877088.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 68%, gi|736761603|WP_034765168.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 68%, gi|692164220|WP_032086917.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. UMB0893], 69%, gi|1325663800|WP_101567345.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. MKU004], 68%, gi|1035730730|WP_064567821.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillus], 68%, gi|764371645|WP_044339984.1 F0F1 ATP synthase subunit epsilon [Bacillus litoralis], 71%, gi|1054559304|WP_066328627.1 ATP synthase epsilon chain [Bacillus pumilus], 71%, gi|1129140162|OLP66784.1 F0F1 ATP synthase subunit epsilon [Bacillus timonensis], 69%, gi|498363035|WP_010677191.1 F0F1 ATP synthase subunit epsilon [Parageobacillus thermoglucosidasius], 69%, gi|1035712219|WP_064552783.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Geobacillus], 69%, gi|496156185|WP_008880692.1 F0F1 ATP synthase subunit epsilon [Bacillus aquimaris], 68%, gi|1430927033|WP_113969229.1 F0F1 ATP synthase subunit epsilon [Anoxybacillus tepidamans], 67%, gi|653159045|WP_027408017.1 ATP synthase epsilon chain [Parageobacillus toebii], 69%, gi|1004920835|KYD29843.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Bacillaceae], 69%, gi|1011859921|WP_062678125.1 F0F1 ATP synthase subunit epsilon [Bacillus alkalitelluris], 71%, gi|1154169450|WP_078543435.1 F0F1 ATP synthase subunit epsilon [Bacillus camelliae], 70%, gi|1316769867|WP_101356051.1 F0F1 ATP synthase subunit epsilon [Geobacillus genomosp. 3], 70%, gi|530784737|WP_020961503.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. SJS], 68%, gi|737427371|WP_035408062.1 F0F1 ATP synthase subunit epsilon [Bacillus methanolicus], 68%, gi|489441322|WP_003346791.1 F0F1 ATP synthase subunit epsilon [Bacillus horikoshii], 68%, gi|1025825400|WP_063559286.1 F0F1 ATP synthase subunit epsilon [Bacillus salsus], 69%, gi|1222808566|WP_090853330.1 F0F1 ATP synthase subunit epsilon [Bacillus aquimaris], 67%, gi|1031446442|WP_064091927.1 F0F1 ATP synthase subunit epsilon [Bacillus humi], 67%, gi|953347474|WP_057998216.1 ATP synthase epsilon chain [Geobacillus stearothermophilus], 69%, gi|1017231308|KZE96595.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Geobacillus], 70%, gi|1017204529|WP_063167198.1 F0F1 ATP synthase subunit epsilon [Geobacillus lituanicus], 70%, gi|1229394455|WP_094239354.1 F0F1 ATP synthase subunit epsilon [Geobacillus thermodenitrificans], 69%, gi|1293369325|WP_100660569.1 F0F1 ATP synthase subunit epsilon [Bacillus bataviensis], 67%, gi|494146406|WP_007086152.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. CHD6a], 68%, gi|983512443|WP_060664609.1 F0F1 ATP synthase subunit epsilon [Bacillus horikoshii], 68%, gi|1207658166|WP_088019729.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. LL01], 68%, gi|847255533|WP_047970236.1 F0F1 ATP synthase subunit epsilon [Bacillus soli], 68%, gi|10538201221|WP_066072952.1 F0F1 ATP synthase subunit epsilon [Geobacillus sp. 46C-IIa], 69%, gi|1173351582|WP_081207861.1 F0F1 ATP synthase subunit epsilon [Bacillus methanolicus], 69%, gi|489446343|WP_003351763.1 MULTISPECIES: F0F1 ATP synthase subunit epsilon [Geobacillus], 68%, gi|765520579|WP_044732826.1 F0F1 ATP synthase subunit epsilon [Bacillus sp. FJAT-14578], 68%, gi|654945804|WP_028395968.1 F0F1 ATP synthase subunit epsilon [Parageobacillus thermantarcticus], 68%, gi|1222906556|WP_090949501.1 F0F1 ATP synthase subunit epsilon [Bacillus marisflavi], 68%, gi|850295930|WP_048004873.1 F0F1 ATP synthase subunit epsilon [Bacillus marisflavi], 68%, gi|850330602|WP_048014185.1

(25) In one embodiment, an amino acid linker (X2) is present between X1 and X3, and an amino acid linker (X4) is present between X3 and X5. Any suitable amino acid linker may be used: extensive guidance is provided in the examples that follow. In various embodiments, X2 is an amino acid linker of between 0-2, 1-2, 0, 1, or 2 amino acids in length. In various further embodiments: X2 is an amino acid linker selected from the group consisting of A, S, P, V. T, TS, ID, or wherein X2 is absent; X2 is an amino acid linker selected from the group consisting of A, S, V, T, TS, and ID; or X2 is an amino acid linker selected from the group consisting of A. S. V. and T.

(26) In other embodiments, X4 is an amino acid linker of between 1-5, 1-4, 1-3, 1-2, 1, 2, 3, 4, or 5 amino acids in length, or wherein X4 is absent. In various further embodiments: X4 is an amino acid linker selected from the group consisting of AT, A, SA, GA, FF, PPPP (SEQ ID NO: 20), FL, GTSG (SEQ ID NO: 21), P, S, ANEFM (SEQ ID NO: 22), or wherein X4 is absent; X4 is an amino acid linker selected from the group consisting of AT, A, SA, GA, FF, FL, P, and S; or X4 is an amino acid linker selected from the group consisting of A, FF, FL, and GTSG (SEQ ID NO: 21).

(27) In further specific embodiments: X2 and X4 are both A; X2 is S and X4 is A; X2 is absent and X4 is FF; X2 is V and X4 is FL; X2 is T and X4 is GTSG (SEQ ID NO: 21); or X2 is S and X4 is SA.

(28) In another embodiment, X2 and X4 do not include any proline residues, to maintain the linkers as flexible.

(29) In further embodiments, the fusion protein comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%95%, 96%, 97%, 98%, 99%, or 100% identical along the length of the amino acid sequence selected from the group consisting of SEQ ID NOS:7-11 (name referring to the designation used in the examples that follow), or that are the same as the sequences below but the linkers (X2 and X4) shown below (highlighted) are substituted with linkers for other constructs shown in Table 3 in the examples that follow:

(30) TABLE-US-00006 SEQIDNO:7 GO-ATeam-A1 FusionProteinincludingmKOkfluorescentprotein (aminoacids1-218),afirstalaninelinker(amino acid219),anATPbindingprotein(aminoacids 220-351),asecondalaninelinker(aminoacid 352),andcpmEGFPfluorescentprotein(amino acids353-598) (M)VSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHR LVRKTEGNITEQVEDAVAHSA (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRAELALQRALNRLDVAGKADGSVQLADHYQQNT PIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDEL YKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL TLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFEKSAMPEGY VQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLE YNYNSHNVYIMADKQKNGIKVNFKIRHNIEEA SEQIDNO:8 D5 (M)VSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHR LVRKTEGNITEQVEDAVAHS S(M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKI GAVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAAR QRAQERLNSQSDDTDIRRAELALQRALNRLDVAGKA DGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKPDHMVLLE FVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGI DFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEEA SEQIDNO:9 F1 (M)VSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHR LVRKTEGNITEQVEDAVAHS(nolinker) (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRAELALQRALNRLDVAGKFF DGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLE FVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGI DFKEDGNILGHKLEYNYNSHNVYIMADKQNGIKVNFKIRHNIEEA SEQIDNO:10 G1 (M)VSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHR LVRKTEGNITEQVEDAVAHSV (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRELALQRLNRLDVAGKFL DGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLE FVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGI DFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEEA SEQIDNO:11 G9 (M)VSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMA EGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEF EDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEK ITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHR LVRKTEGNITEQVEDAVAHST (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRAEIALQRALNRLDVAGKGTSG DGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLE FVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGI DFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEFA

(31) In a second aspect, the disclosure provides control fusion proteins that can be used together with the active fusion proteins of the first aspect of the disclosure, for example, as a control in assays to detect and measure ATP in living cells. The control fusion proteins have the same general formula (X1-X2-X3-X4-X5) as the fusion proteins of the first aspect of the disclosure. All embodiments of the X1, X2, X4, and X5 domains disclosed for the first aspect are equally applicable in the control fusion proteins. The X3 domain differs in the control fusion proteins by comprising a control protein that does not bind to ATP. Any suitable control protein can be used. In one embodiment, the control protein comprises the amino acid sequence at least 65%, 67%, 68%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical along the length of the amino acid sequence of SEQ ID NO: 12, wherein the underlined and bold font residues must be K:

(32) TABLE-US-00007 SEQIDNO:12 (M)KTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIG AVRLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQ RAQERLNSQSDDTDIRRAELALQKALNKLDVAGK

(33) The control proteins of this embodiment are closely related to the ATP binding proteins disclosed above, differing in having the required lysine residues noted above, which abolishes ATP binding activity.

(34) In one specific embodiment, the control fusion proteins comprises an amino acid sequence at least 65%, 67%, 68%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical along the length of the amino acid sequence of SEQ ID NO:13, wherein the underlined and bold font residues must be K:

(35) TABLE-US-00008 SEQIDNO:13 MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEG GPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFED GGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKIT ASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHRLV RKTEGNITEQVEDAVAHSA MKTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIGAV RLKKDGQTEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQRA QERLNSQSDDTDIRRAELALQKALNKLDVAGKA DGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLE FVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHM KQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGI DFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEEA

(36) In this embodiment, the italicized and underlined linker residues can be modified to any suitable linker residues, including but not limited those listed in Table 3 of the examples.

(37) As used throughout the present application, the term protein or is used in its broadest sense to refer to a sequence of subunit amino acids. The polypeptides described herein may be chemically synthesized or recombinantly expressed.

(38) As will be understood by those of skill in the art, the fusion proteins of the disclosure may include additional residues at the N-terminus, C-terminus, or both that are not present in the described fusion proteins; these additional residues are not included in determining the percent identity of the polypeptides of the disclosure relative to the reference polypeptide. Such residues may be any residues suitable for an intended use, including but not limited to ligands suitable for purposes of purification (His tags, etc.), and additional peptide domains that add functionality to the polypeptides.

(39) In one embodiment, changes relative to the reference fusion proteins comprises conservative amino acid substitution. As used herein, conservative amino acid substitution means amino acid or nucleic acid substitutions that do not alter or substantially alter fusion protein or domain function or other characteristics. A given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn). Other such conservative substitutions, e.g., substitutions of entire regions having similar hydrophobicity characteristics, are well known. Polypeptides comprising conservative amino acid substitutions can be tested in the assays described herein to confirm that a desired activity is retained.

(40) In another aspect, the disclosure provides polynucleotides encoding the fusion protein or control fusion protein of any embodiment or combination of embodiments of the disclosure. The polynucleotides may comprise RNA or DNA. Such polynucleotides may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what polynucleotides will encode the fusion proteins of the disclosure.

(41) In another aspect, the disclosure provides recombinant expression vectors comprising the polynucleotides of any embodiment or combination of embodiments of the disclosure operatively linked to a promoter sequence capable of directing expression of the polynucleotide. Recombinant expression vector includes vectors that operatively link the polynucleotides to any promoter sequence capable of effecting expression of the fusion proteins. Promoter sequences operatively linked to the nucleic acid sequences of the disclosure are nucleic acid sequences capable of effecting the expression of the polynucleotides. The promoter need not be contiguous with the polynucleotide, so long as it functions to direct polynucleotide expression. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the polynucleotide and the promoter sequence can still be considered operably linked to the coding sequence. Such expression vectors can be of any type known in the art, including but not limited plasmid and viral-based expression vectors. The promoter may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive). In various embodiments, the expression vector may comprise a plasmid, viral-based vector, or any other suitable expression vector.

(42) In a further aspect, the present disclosure provides host cells that comprise the recombinant expression vectors disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic. The cells can be transiently or stably engineered to incorporate the expression vector of the disclosure. A method of producing a fusion protein according to the disclosure is an additional part of the disclosure. The method comprises the steps of (a) culturing a host according to this aspect of the disclosure under conditions conducive to the expression of the fusion protein, and (b) optionally, recovering the expressed fusion protein. The expressed fusion protein can be recovered from the cell free extract or the cell culture medium.

(43) In another aspect, the disclosure provides kits comprising: (a) the fusion protein of any embodiment or combination of embodiments of the disclosure, the polynucleotide encoding the fusion protein, the expression vector comprising the polynucleotide encoding the fusion protein and/or the recombinant host cell comprising the expression vector comprising the polynucleotide encoding the fusion protein; (b) the control fusion protein of any embodiment or combination of embodiments of the disclosure, the polynucleotide encoding the control fusion protein, the expression vector comprising the polynucleotide encoding the control fusion protein and/or the recombinant host cell comprising the expression vector comprising the polynucleotide encoding the control fusion protein.

(44) The kits of this aspect may be used, for example, to detect and measure ATP in living cells, as detailed in the examples that follow.

(45) ATP Binding Fusion Proteins

(46) Polynucleotides encoding an ATP binding fusion protein are provided according to aspects of the present disclosure wherein the ATP binding fusion protein includes: a first fluorophore that is a FRET acceptor having an acceptor excitation wavelength and a FRET emission wavelength, the first fluorophore having an N-terminus and a C-terminus; an ATP binding protein having an N-terminus and a C-terminus; and a second fluorophore that is a FRET donor having a donor excitation wavelength and a donor emission wavelength, the second fluorophore having an N-terminus and a C-terminus, wherein a first linker is disposed between the C-terminus of the first fluorophore and the N-terminus of the ATP binding protein and a second linker is disposed between the C-terminus of the ATP binding protein and the N-terminus of the second fluorophore, and wherein the first fluorophore, ATP binding protein, and second fluorophore are operably linked such that binding of ATP by the ATP binding protein causes interaction of the first fluorophore and second fluorophore to produce a FRET emission signal when exposed to light having the donor excitation wavelength.

(47) According to aspects of the present disclosure, the first linker of the ATP binding fusion protein is an alanine residue and the second linker is an alanine residue.

(48) According to aspects of the present disclosure, the first linker of the ATP binding fusion protein a serine residue and the second linker is an alanine residue.

(49) According to aspects of the present disclosure, the first linker of the ATP binding fusion protein is a nullity and the second linker is a phenylalanine-phenylalanine dipeptide residue.

(50) According to aspects of the present disclosure, the first linker of the ATP binding fusion protein is a valine residue and the second linker is a phenylalanine-leucine dipeptide residue.

(51) According to aspects of the present disclosure, the first linker of the ATP binding fusion protein is a threonine residue and the second linker is a glycine-threonine-srine-glycine peptide residue.

(52) According to aspects of the present disclosure, the first linker of the ATP binding fusion protein is a serine residue and the second linker is a serine-alanine dipeptide residue.

(53) According to aspects of the present disclosure, the second linker of the ATP binding fusion protein is not and/or does not include an asparagine residue.

(54) Fusion proteins are provided according to aspects of the present disclosure wherein the fusion protein includes: a first fluorophore that is a FRET acceptor having an acceptor excitation wavelength and a FRET emission wavelength, the first fluorophore having an N-terminus and a C-terminus; an ATP binding protein having an N-terminus and a C-terminus; and a second fluorophore that is a FRET donor having a donor excitation wavelength and a donor emission wavelength, the second fluorophore having an N-terminus and a C-terminus, wherein a first linker is disposed between the C-terminus of the first fluorophore and the N-terminus of the ATP binding protein and a second linker is disposed between the C-terminus of the ATP binding protein and the N-terminus of the second fluorophore, and wherein the first fluorophore, ATP binding protein, and second fluorophore are operably linked such that binding of ATP by the ATP binding protein causes interaction of the first fluorophore and second fluorophore to produce a FRET emission signal when exposed to light having the donor excitation wavelength.

(55) According to aspects of the present disclosure, an ATP binding protein included a fusion protein is the ATP binding protein of SEQ ID NO: 5, encoded by SEQ ID NO: 14.

(56) According to aspects of the present disclosure, an ATP binding protein included a fusion protein is a variant of SEQ ID NO: 5 which binds ATP and has 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 substitution mutations, additions or deletions compared to SEQ ID NO:5.

(57) According to aspects of the present disclosure, an ATP binding protein included a fusion protein is a variant of SEQ ID NO: 5 which binds ATP and is encoded by a variant of SEQ ID NO: 14 which binds to SEQ ID NO:14 under high stringency hybridization conditions.

(58) Control Fusion Proteins

(59) Polynucleotides encoding a control fusion protein are provided according to aspects of the present disclosure wherein the control fusion protein includes: a first fluorophore that is a FRET acceptor having an acceptor excitation wavelength and an acceptor emission wavelength, the first fluorophore having an N-terminus and a C-terminus; a control mutant ATP binding protein having an N-terminus and a C-terminus, the control mutant ATP binding protein mutated such that it does not bind ATP; and a second fluorophore that is a FRET donor having a donor excitation wavelength and a donor emission wavelength, the second fluorophore having an N-terminus and a C-terminus, wherein a first linker is disposed between the C-terminus of the first fluorophore and the N-terminus of the control mutant ATP binding protein and a second linker is disposed between the C-terminus of the control mutant ATP binding protein and the N-terminus of the second fluorophore, and wherein the first fluorophore, control mutant ATP binding protein, and second fluorophore are operably linked to function as a control since the control mutant ATP binding protein does not bind ATP such that interaction of the first fluorophore and second fluorophore to produce a FRET emission signal when exposed to light having the donor excitation wavelength represents a non-specific background signal unrelated to presence of ATP.

(60) According to aspects of the present disclosure, the first linker of the control fusion protein is an alanine residue and the second linker is an alanine residue.

(61) According to aspects of the present disclosure, the first linker of the control fusion protein is a serine residue and the second linker is an alanine residue.

(62) According to aspects of the present disclosure, the first linker of the control fusion protein is a nullity and the second linker is a phenylalanine-phenylalanine dipeptide residue.

(63) According to aspects of the present disclosure, the first linker of the control fusion protein is a valine residue and the second linker is a phenylalanine-leucine dipeptide residue.

(64) According to aspects of the present disclosure, the first linker of the control fusion protein is a threonine residue and the second linker is a glycine-threonine-serine-glycine peptide residue.

(65) According to aspects of the present disclosure, the first linker of the control fusion protein is a serine residue and the second linker is a serine-alanine dipeptide residue.

(66) According to aspects of the present disclosure, the second linker of the control fusion protein is not and/or does not include an asparagine residue.

(67) A control fusion protein, the control fusion protein including: a first fluorophore that is a FRET acceptor having an acceptor excitation wavelength and a FRET emission wavelength, the first fluorophore having an N-terminus and a C-terminus; a control mutant ATP binding protein having an N-terminus and a C-terminus; and a second fluorophore that is a FRET donor having a donor excitation wavelength and a donor emission wavelength, the second fluorophore having an N-terminus and a C-terminus, wherein a first linker is disposed between the C-terminus of the first fluorophore and the N-terminus of the control mutant ATP binding protein and a second linker is disposed between the C-terminus of the control mutant ATP binding protein and the N-terminus of the second fluorophore, and wherein the first fluorophore, control mutant ATP binding protein, and second fluorophore are operably linked to function as a control since the control mutant ATP binding protein does not bind ATP such that interaction of the first fluorophore and second fluorophore to produce a FRET emission signal when exposed to light having the donor excitation wavelength represents a non-specific background signal unrelated to presence of ATP.

(68) According to aspects of the present disclosure, an ATP binding protein included a control fusion protein is the ATP binding protein of SEQ ID NO: 15, encoded by SEQ ID NO: 16.

(69) According to aspects of the present disclosure, a control mutant ATP binding protein which does not bind ATP included a control fusion protein is a variant of SEQ ID NO: 15 which does not bind ATP and has 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 substitution mutations, additions or deletions compared to SEQ ID NO: 15.

(70) According to aspects of the present disclosure, a control mutant ATP binding protein included a fusion protein is a variant of SEQ ID NO: 15 which does not bind ATP and is encoded by a variant of SEQ ID NO: 16 which binds to SEQ ID NO: 16 under high stringency hybridization conditions.

(71) According to aspects of the present disclosure, a polynucleotide described herein includes an operably linked promoter. According to aspects of the present disclosure, a polynucleotide described herein is included in an expression vector. According to aspects of the present disclosure, a polynucleotide and/or expression vector described herein is present in a host cell, such as, but not limited to, a stable transformant cell line expressing the polynucleotide and its encoded fusion protein.

(72) According to aspects of the present disclosure, the donor fluorophore is cpmEGFP. According to aspects of the present disclosure, the acceptor fluorophore is mKOk.

(73) It should be appreciated that while embodiments of the disclosure are described herein wherein the FRET donor fluorophore is positioned at the C-terminus of the ATP binding protein or the control mutant binding protein (with a linker disposed between the C-terminus of the ATP binding protein, or the control mutant binding protein, and the FRET donor fluorophore) and the FRET acceptor fluorophore is positioned at the N-terminus of the ATP binding protein or the control mutant binding protein (with a linker disposed between the N-terminus of the ATP binding protein, or the control mutant binding protein, and the FRET acceptor fluorophore), the relative positions of the fluorophores is optionally switched such that fusion proteins described herein have the FRET donor fluorophore positioned at the N-terminus of the ATP binding protein or the control mutant binding protein (with a linker disposed between the N-terminus of the ATP binding protein, or the control mutant binding protein, and the FRET donor fluorophore) and the FRET acceptor fluorophore is positioned at the C-terminus of the ATP binding protein, or the control mutant binding protein, (with a linker disposed between the C-terminus of the ATP binding protein, or the control mutant binding protein, and the FRET acceptor fluorophore).

(74) Fluorophores

(75) Examples of FRET donor/acceptor pairs generally include, but are not limited to, cyan fluorescent protein/yellow fluorescent protein (CFP-YFP) FRET pairs, green fluorescent protein/red fluorescent protein (GFP-RFP) FRET pairs, and other combinations.

(76) In another aspect, the disclosure provides methods for determining a level of ATP in a cell of interest using the fusion proteins disclosed herein. The fusion proteins detect ATP in that binding of ATP by the ATP binding protein in the fusion protein causes interaction of the FRET acceptor polypeptide and the FRET donor polypeptide, resulting in emission of light that can be detected. Detection of emitted light can be carried out via any suitable assay or imaging format. In one embodiment, such methods comprise (a) expressing the fusion protein of any embodiment or combination of embodiments disclosed herein in one or more first cells, and generating one or more images selected from the group consisting of: (i) a first fluorescence image generated by detecting fluorescent signals produced by light having the FRET acceptor polypeptide emission wavelength emitted from the one or more first cells upon exposing the one or more first cells to light having the FRET donor polypeptide excitation wavelength; and/or (ii) a second fluorescence image generated by detecting fluorescent signals produced by light having the FRET acceptor polypeptide emission wavelength emitted from the one or more first cells upon exposing the one or more first cells to light having the FRET acceptor polypeptide excitation wavelength; and/or (iii) a third fluorescence image generated by detecting fluorescent signals produced by light having the FRET donor polypeptide emission wavelength emitted from the one or more first cells upon exposing the one or more first cells to light having the FRET donor polypeptide excitation wavelength; and (b) determining a FRET ratio in the one or more first cells by comparing the output of fluorescent signals in the first fluorescent image, the second fluorescent image, and/or the third fluorescent image; wherein the level of ATP in the one or more first cells is proportional to the determined FRET ratio.

(77) In this embodiment, comparing the output of fluorescent signals means dividing the output of fluorescent signals in one image by the output of fluorescent signals in a different image. For example: the output of fluorescent signals in the first fluorescent image can be divided by the output of fluorescent signals in the second fluorescent image; the output of fluorescent signals in the first fluorescent image can be divided by the output of fluorescent signals in the third fluorescent image; the output of fluorescent signals in the second fluorescent image can be divided by the output of fluorescent signals in the first fluorescent image; the output of fluorescent signals in the second fluorescent image can be divided by the output of fluorescent signals in the third fluorescent image; the output of fluorescent signals in the third fluorescent image can be divided by the output of fluorescent signals in the first fluorescent image; or the output of fluorescent signals in the third fluorescent image can be divided by the output of fluorescent signals in the second fluorescent image.

(78) The outputs of fluorescent signals can be determined on any suitable basis, including but not limited to on a whole image basis, per cell basis, on a per pixel basis, or using any alternative intensity measurements.

(79) In another embodiment, the methods further comprise expressing the control fusion protein of any embodiment or combination of embodiments of the disclosure in one or more first cells, and detecting a control signal produced by light having the acceptor emission wavelength emitted from the one or more first cells. Any suitable method for using the control signal to correct the determined FRET ratio may be used. In one embodiment, detecting the control signal comprises (c) expressing the control fusion protein of any embodiment or combination of embodiments disclosed herein in one or more control cells (such as the first cells, or second cells), and generating one or more images selected from the group consisting of: (i) a fourth fluorescence image generated by detecting fluorescent signals produced by light having the FRET acceptor polypeptide emission wavelength emitted from the one or more control cells upon exposing the one or more control cells to light having the FRET donor polypeptide excitation wavelength; and/or (ii) a fifth fluorescence image generated by detecting fluorescent signals produced by light having the FRET acceptor polypeptide emission wavelength emitted from the one or more control cells upon exposing the one or more control cells to light having the FRET acceptor polypeptide excitation wavelength; and/or (iii) a sixth fluorescence image generated by detecting fluorescent signals produced by light having the FRET donor polypeptide emission wavelength emitted from the one or more control cells upon exposing the one or more control cells to light having the FRET donor polypeptide excitation wavelength; and (d) determining a control fusion FRET ratio in the one or more control cells by comparing the output of fluorescent signals in the fourth fluorescent image, the fifth fluorescent image, and/or the sixth fluorescent image; wherein alterations in the control fusion FRET ratio are determined to be the result of experimental conditions unrelated to ATP binding, and wherein the determined FRET ratio is corrected based on the alterations in the control fusion FRET ratio.

(80) The one or more cells may be any cell or cell population in which determining ATP levels is of interest. In one embodiment, the one or more first cells are in culture in an incubator. In another embodiment, all imaging steps are performed without removing the one or more first cells from the incubator. In this embodiment, the cells are cultured in a suitable cell culture medium in an incubator, and the incubator is configured such that the cells to be assayed do not have to be removed from the incubator during observation and/or recording of assays for detecting ATP, such as changes in ATP due to contacting the cells with a test substance.

(81) The assays can be used, for example, to test the effect of one or more test compounds on ATP levels in cells of interest. Thus, in one embodiment, the methods further comprise contacting the one or more first cells with one or more test substance and determining an effect of the test substance on the presence of ATP in the one or more first cells. The effect of the one or more test substance on the presence of ATP in the one or more first cells may be determined over any time period of interest, including but not limited to continuously or intermittently over a time period in the range of 1 minute to three months.

(82) The IncuCyte S3 Live Cell Analysis for Metabolism System for Live Cell Analysis of Intracellular ATP

(83) The IncuCyte S3 hardware may be used for any method of the disclosure, and is composed of 2 components: 1) gantry and 2) controller. The gantry houses the microscope, camera, and consumable trays that enable automated image acquisition of live-cell cultures and is installed inside a standard tissue culture incubator. In the ATP application the microscope system contains a filter module that is tailored to collecting fluorescent images in the desired spectrum (or spectra). The controller contains processors, memory and data storage drives that enable image storage, data handling, database storage, file systems, automated image processing, graphing and over-the-network interaction from the client computer through a graphical user interface (GUI). The software on the controller serves 2 purposes: 1) server interaction, and 2) instrument control.

(84) The gantry is installed in an incubator and houses the microscope and camera. The controller controls the microscope system and functions as a server. The controller plugs into a communications port, such as, but not limited to, an ethernet port. A graphical user interface (GUI) is loaded on to a computer and interacts with the controller (i.e. server) to control the microscope system and interact with the data. All automated image processing is completed on the controller according to aspects of the present disclosure.

(85) Automated Image Capture

(86) The Incucyte S3 microscope moves to user defined locations of cell culture vessels, such as, but not limited to, 96-well plates, turns on the appropriate LED and captures images at a desired exposure time using a desired microscope objective, such as, 700 ms using the 10 objective.

(87) The following data are derived from imaging of the objects, e.g. cells, ATP presence and/or level, and/or one or more additional metrics alone or in combination, are calculated for each object, each well, or each set of wells, stored in a database, and displayed to the user shortly following data acquisition in the client computer through the graphical user interface.

(88) Typically wells are scanned every 2 hours, although more or less frequent scanning is an option. Following each scan, metrics are calculated and stored, for instance in the database, at those time points. For example, over the course of a 3 day experiment, 36 time points are collected for each metric, are concatenated into a time series and can be graphed over the course of the full experimental time frame, i.e. minutes, hours, days, weeks, months.

(89) As described herein systems and methods of the present disclosure allow users to monitor the changes in ATP presence and/or levels over long periods of time in an automated, moderate throughput way. By contrast, previous methods are: 1) end point methods (can only get one or limited read(s) of the various measured parameters), 2) extremely disruptive methods, 3) require a user to move cells out of the incubator for analysis/visualization, 4) dependent on cell number, 5) indirect measurements of ATP production, and/or 6) low throughput (one well at a time, manual).

(90) Embodiments of the compositions and methods of the disclosure are illustrated in the following examples. These examples are provided for illustrative purposes and are not considered limitations on the scope of the claimed compositions and methods.

Example 1

(91) Linker Screening

(92) A library with a diversity of approximately 14,000 unique mutants was screened for optimization of linker regions. Briefly, the screening was completed in bacterial cells where the specific mutant was expressed. Over 15000 individual colonies were evaluated for their brightness and FRET ratio using optical methods. Of these more than 15,000 colonies 400 were selected for further evaluation using protein lysates such that measurements could be made in both the ATP bound and unbound states. 12 potential colonies were selected for genetic sequencing, and cloned into mammalian expression vectors, and used for transient transfection experiments. Cells expressing these constructs were treated with the drugs that are known to reduce the amount of intracellular ATP. The signal window was calculated by subtracting the FRET ratio of the drug-treated cells from the FRET ratio of the vehicle-treated cells 2 h post treatment. The results are shown in FIG. 1. Error bars are SEM, n=3. The two-tailed P value for A1 and GO-ATeam1 equals 0.0084 (unpaired t test).

(93) The linker sequences tested are shown in TABLE 3 below:

(94) TABLE-US-00009 TABLE3 1.sup.stlinker(N-terminusof 2.sup.ndlinker(C-terminusoftheATP- Mutantname theATP-bindingdomain) bindingdomain) B7 nolinkerbetweenmKOk AT andtheATP-binding domain A1(GO-ATeam-A1) A A SEQIDNO:1 F7 S SA D5 S A G7 nolinkerbetweenmKOk GA andtheATP-binding domain F1 nolinkerbetweenmKOk FF andtheATP-binding domain C5 P PPPP(SEQIDNO:20) G1 V FL G9 T GTSG(SEQIDNO:21) C2 nolinkerbetweenmKOk P andtheATP-binding domain A10 nolinkerbetweenmKOk nolinkerbetweentheATP-binding andtheATP-binding domainandcpmEGFP domain E7 TS S GO-ATeam1 ID ANEFM(SEQIDNO:22)

(95) Cell lines were generated expressing construct A land Go-ATeam1 stably. i.e. the cells were infected via lentiviral transduction and selected using an antibiotic selection marker to generate stable lines. Cells were treated with 2.5 M staurosporine to increase ATP and combined 40 mM 2-deoxy-D-Glucose (2-DG) and 4 mM potassium cyanide (KCN) to deplete ATP. The signal window in cells expressing sensor A1 was approximately twice that of the signal window in Go-ATeam1-expressing cell lines (FIG. 2A-B).

(96) Purified proteins were incubated with and without 10 mM ATP and their excitation spectra were collected, FIGS. 3A and 3B. The difference between the spectra of ATP-treated and non-treated protein indicates the signal window. The performance of sensor A1 (GO-ATeam-A1) (FIG. 3A) illustrates a greater than 2-fold increase in signal window (comparing ATP bound (solid line) to ATP unbound state (dashed line)) when compared to the performance of the GO-ATeam1 sensor (FIG. 3B).

Example 2

(97) A live cell imaging approach to categorize test substances as nontoxic, cytotoxic, or mitotoxic using the glucose/galactose switch model was evaluated using methods and compositions according to aspects of the present disclosure which assay ATP in living cells.

(98) Substituting galactose for glucose in growth media blocks the ability of cells to generate ATP via glycolysis, conferring reliance on mitochondrial oxidative phosphorylation to generate ATP and enhancing sensitivity to mitochondrial-driven toxicity (L. D. Marroquin et al., Toxicol Sci 97(2), 539-547 (2007)). Cellular ATP levels were measured up to 24 hours following test substance treatment. Nontoxic test substances resulted in little to no change in ATP, cytotoxic test substances conferred a decrease in ATP in both glucose and galactose conditions, and mitotoxic test substances displayed leftward shift in potency under galactose conditions. Reductions in ATP could be observed in minutes, and transient reductions followed by recovery highlight the sensitivity and value of kinetic data using a live cell imaging approach using compositions and methods according to aspects of the present disclosure as described in further detail below.

(99) Generation of ATP Sensor-Expressing Cell Lines

(100) Cell lines stably expressing cytoATP (ATP-binding) and Control (mutated ATP-binding domain) sensors were generated by lentiviral transduction. A 3.sup.rd generation lentiviral system containing a bicistronic expression cassette was used to express the sensors. Specifically, the EF-1 alpha promoter was used to drive expression of the sensor and the puromycin selection marker using an intervening IRES sequence. Cells were seeded at 50,000 cells/well in 6-well plates the day prior to lentiviral infection. Cells were exposed to cytoATP or Control lentivirus in the presence of 8 g/mL polybrene. After 24 h, media was replaced with polybrene-free media. Cells were passaged once, then subjected to puromycin selection to generate a stable, homogenous population of cells expressing cytoATP or Control sensors.

(101) Cell Culture

(102) Cells were purchased from ATCC.sup.+ (CRL-1658) and maintained in a humidified 5% CO.sub.2 atmosphere at 37 C. Cells were cultured in DMEM without glucose (Gibco) supplemented with 25 mM glucose, 1 mM sodium pyruvate, 5 mM HEPES, 10% FBS, 1% GlutaMax, and 1% Pen/Strep. Galactose media was prepared as described above except glucose was replaced by 10 mM galactose. For galactose adaptation, cells were split into glucose-containing DMEM, switched to galactose media on the second day after passage, then passaged twice more in galactose media before experimentation began.

(103) ATP Assay

(104) Measurement of ATP was performed by an IncuCyte S3 equipped with a specialized FRET-based filter set and data acquisition module. The cytoATP sensor is a genetically-encoded indicator comprised of a FRET donor (cpmEGFP) and FRET acceptor (mKOk) connected by an ATP-binding domain. An increase in FRET is induced upon ATP binding. The Control sensor contains a mutated ATP binding domain and is used to provide a zero point for normalization and to monitor and correct for any artifacts affecting FRET signal readout. Sensor measurements were performed using dual-excitation ratio imaging. In a specific example, fluorescence emission of the acceptor fluorophore mKOk (567-589 nm) is collected following excitation of the donor fluorophore cpmEGFP (475495 nm, measurement of FRET) or direct excitation of the acceptor fluorophore mKOk (524-546 nm, measurement of total protein). A cellular analysis mask is generated by thresholding of the fluorescence images collected from direct mKOk excitation. This mask is also applied to complementary images collected in the FRET channel. Relative ATP level is reported as the cpmEGFP/mKOk excitation ratio, calculated by dividing the total integrated intensity measured from images collected with cpmEGFP excitation by that measured from images collected with mKOk excitation.

(105) To generate concentration-response curves, data was corrected for each treatment and normalized to vehicle controls at a given time point using the following equation:

(106) ( T r e a t m e n t cytoATP Average Treatment Non - binding Control ) - 1 ( Vehicle cytoATP Average Vehicle Non - binding Control ) - 1

(107) FIG. 4A: ATP depletion via concurrent inhibition of glycolysis and OXPHOS by 2DG and KCN, respectively, on cells grown in standard media. Data demonstrate the time course of ATP depletion and concentration dependence of concurrent 2DG and KCN treatment. FIGS. 4B and 4C show a comparison of cytotoxic (chlorpromazine, FIG. 4B) and mitotoxic (rotenone, FIG. 4C) compounds on cells grown in glucose or galactose media. The first two panels depict the effect of each compound over a 24 h time course in cells grown in glucose or galactose as indicated. The third panel depicts the concentration-response curve of each compound at the 24 h time point. Cytotoxic compounds show a similar effect under both media conditions, while mitotoxic compounds induce greater ATP depletion in cells grown in galactose.

Example 3

Materials and Methods

(108) Cancer cell lines stably expressing a genetically encoded, fluorescent ATP sensor or a control (non-ATP binding) sensor were generated. Cell lines were cultured in recommended media conditions except for studies evaluating the effects of the glutaminase-1 (GLS1) inhibitor CB-839, for which cells were adapted to RPMI supplemented with 10% FBS prior to experimentation. ATP levels were monitored and analyzed using an IncuCyte S3 equipped with a specialized filter set and data acquisition module. Cellular ATP levels were measured over the course of hours to days following compound treatment.

(109) Data Summary

(110) A live cell imaging approach was then utilized to evaluate the effect of cancer therapeutics on ATP levels in tumor cell lines, focusing primarily on compounds that target metabolic vulnerabilities. For example, triple-negative breast cancer (TNBC) cell lines have been shown to be more dependent on activity of GLS1, which catalyzes the first step in utilization of glutamine to fuel mitochondrial metabolism, than their receptor-positive counterparts. Using the live cell analysis approach, a rapid drop in ATP was observed upon glutamine deprivation or inhibition of GLS1 by CB-839 in TNBC cell lines. ATP levels remained below that of vehicle-treated cells for the duration of the three-day time course. In contrast, responses of receptor-positive cell lines ranged from no change to more modest decreases in ATP and full recovery within 48 hours. Quantification of phase confluence confirmed that sustained decreases in ATP were associated with enhanced antiproliferative efficacy compared to conditions under which recovery of ATP levels were observed. Further data demonstrating the ability of the ATP sensor to measure metabolic perturbations over time in tumor cells co-cultured with stromal cells was obtained. TNBC cultured on a monolayer of with CCD-1068Sk fibroblasts displayed resistance to CB-839 treatment, as measured by diminished effects on ATP levels (FIG. 5A). In contrast, results from receptor-positive breast cancer lines which showed a transient decrease in ATP levels following CB-839 treatment were unaffected by the presence of CCD-1068Sk fibroblasts (FIG. 5B).

Example 4

(111) Lentiviral transduction was used to generate primary and iPSC-derived neurons expressing Go-ATeamA1. Expression was driven by the synapsin promoter and was restricted to neurons when lentivirus was delivered to neuronal and astrocyte co-cultures. Neurons treated with combined 2DG and KCN responded with a concentration-dependent depletion in ATP as indicated by a drop in FRET ratio. Responses were comparable to those observed following combined 2DG and KCN treatment in other mammalian cells (e.g. cancer cell lines, FIG. 4A).

(112) TABLE-US-00010 SEQUENCES SEQIDNO:5-ATPBindingProtein MKTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIGAVRLKKDGQ TEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDI RRAELALQRALNRLDVAGK SEOIDNO:14-DNAsequenceencodingtheATPBindingProteinofSEQIDNO:1 ATGAAAACTGTGAAAGTGAATATAACAACCCCTGATGGGCCAGTCTACGACGCT GATATCGAGATGGTGTCCGTGCGGGCCGAGAGTGGTGATCTCGGCATCCTCCCCG GTCACATTCCCACAAAGGCCCCACTGAAGATCGGAGCTGTGCGGCTGAAGAAGG ACGGCCAAACCGAGATGGTCGCAGTCTCAGGCGGCACTGTTGAAGTGCGGCCTG ACCACGTTACCATTAATGCTCAAGCCGCTGAAACAGCCGAAGGAATCGACAAAG AGAGAGCAGAAGCCGCAAGACAGAGGGCCCAGGAGCGGCTGAACTCTCAATCC GATGACACCGATATTCGCCGGGCCGAGCTGGCACTGCAGAGGGCCCTGAACAGA CTGGACGTGGCTGGGAAG SEQIDNO:15-ControlMutantATPBindingProteinwhichdoesnotbindATP MKTVKVNITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIGAVRLKKDGQ TEMVAVSGGTVEVRPDHVTINAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDI RRAELALQKALNKLDVAGK SEQIDNO:16-DNAsequenceencodingtheControlMutantATPBindingProteinof SEQIDNO:3 ATGAAAACTGTGAAAGTGAATATAACAACCCCTGATGGGCCAGTCTACGACGCT GATATCGAGATGGTGTCCGTGCGGGCCGAGAGTGGTGATCTCGGCATCCTCCCCG GTCACATTCCCACAAAGGCCCCACTGAAGATCGGAGCTGTGCGGCTGAAGAAGG ACGGCCAAACCGAGATGGTCGCAGTCTCAGGCGGCACTGTTGAAGTGCGGCCTG ACCACGTTACCATTAATGCTCAAGCCGCTGAAACAGCCGAAGGAATCGACAAAG AGAGAGCAGAAGCCGCAAGACAGAGGGCCCAGGAGCGGCTGAACTCTCAATCC GATGACACCGATATTCGCCGGGCCGAGCTGGCACTGCAGAAGGCCCTGAACAAG CTGGACGTGGCTGGGAAG SEQIDNO:17-DNAsequenceencodingmKOkfluorescentprotein(nucleotides1-654),a firstalaninelinker(nucleotides655-657),anATPbindingprotein(nucleotides658-1053),a secondalaninelinker(nucleotides1054-1056),andcpmEGFPfluorescentprotein (nucleotides1057-1794) ATGGTGAGTGTGATTAAACCAGAGATGAAGATGAGGTACTACATGGACGGCTCC GTCAATGGGCATGAGTTCACAATTGAAGGTGAAGGCACAGGCAGACCTTACGAG GGACATCAAGAGATGACACTACGCGTCACAATGGCCGAGGGCGGGCCAATGCCT TTCGCGTTTGACTTAGTGTCACACGTGTTCTGTTACGGCCACAGAGTATTTACTAA ATATCCAGAAGAGATACCAGACTATTTCAAACAAGCATTTCCTGAAGGCCTGTCA TGGGAAAGGTCGTTGGAGTTCGAAGATGGTGGGTCCGCTTCAGTCAGTGCGCAT ATAAGCCTTAGAGGAAACACCTTCTACCACAAATCCAAATTTACTGGGGTTAACT TTCCTGCCGATGGTCCTATCATGCAAAACCAAAGTGTTGATTGGGAGCCATCAAC CGAGAAAATTACTGCCAGCGACGGAGTTCTCAAGGGTGATGTTACGATGTACCT AAAACTTGAAGGAGGCGGCAATCACAAATGCCAATTCAAGACTACTTACAAGGC GGCAAAAGAGATTCTTGAAATGCCAGGAGACCATTACATCGGCCATCGCCTCGT CAGGAAAACCGAAGGCAACATTACTGAGCAGGTAGAAGATGCAGTAGCTCATTC CGCTATGAAAACTGTGAAAGTCAATATAACAACCCCTGATGGGCCAGTCTACGA CGCTGATATCGAGATGGTGTCCGTGCGGGCCGAGAGTGGTGATCTCGGCATCCTC CCCGGTCACATTCCCACAAAGGCCCCACTGAAGATCGGAGCTGTGCGGCTGAAG AAGGACGGCCAAACCGAGATGGTCGCAGTCTCAGGCGGCACTGTTGAAGTGCGG CCTGACCACGTTACCATTAATGCTCAAGCCGCTGAAACAGCCGAAGGAATCGAC AAAGAGAGAGCAGAAGCCGCAAGACAGAGGGCCCAGGAGCGGCTGAACTCTCA ATCCGATGACACCGATATTCGCCGGGCCGAGCTGGCACTGCAGAGGGCCCTGAA CAGACTGGACGTGGCTGGGAAGGCTGACGGCAGCGTGCAGCTCGCCGACCACTA CCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTA CCTGAGCACCCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACAT GGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTG TACAAGGGTGGCAGCGGTGGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGG GTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGC GTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTC ATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGA CCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTT CTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAG GACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTG GTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTG GGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGAC AAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGAA GCT SEQIDNO:7-FusionProteinencodedbySEQIDNO:17-includingmKOkfluorescent protein(aminoacids1-218),afirstalaninelinker(aminoacid219),anATPbindingprotein (aminoacids220-351),asecondalaninelinker(aminoacid352),andcpmEGFPfluorescent protein(aminoacids352-598) MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEGGPMPF AFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLR GNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGG GNHKCQFKTTYKAAKEILEMPGDRYIGHRLVRKTEGNITEQVEDAVAHSAMKTVKV NITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIGAVRLKKDGQTEMVAVS GGTVEVRPDHVTINAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELALQ RALNRLDVAGKADGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRD HMVLLEFVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFF KSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKL EYNYNSHNVYIMADKQKNGIKVNFKIRHNIEEA GO-ATeam-A1control SEQIDNO:18-DNAencodingmKOkfluorescentprotein(nucleotides1-654),afirst alaninelinker(nucleotides655-657),acontrolATPBindingproteinmutatedsoitnotbind ATP(nucleotides658-1053),asecondalaninelinker(nucleotides1054-1056),and cpmEGFPfluorescentprotein(nucleotides1057-1794) ATGGTGAGTGTGATTAAACCAGAGATGAAGATGAGGTACTACATGGACGGCTCC GTCAATGGGCATGAGTTCACAATTGAAGGTGAAGGCACAGGCAGACCTTACGAG GGACATCAAGAGATGACACTACGCGTCACAATGGCCGAGGGCGGGCCAATGCCT TTCGCGTTTGACTTAGTGTCACACGTGTTCTGTTACGGCCACAGAGTATTTACTAA ATATCCAGAAGAGATACCAGACTATTTCAAACAAGCATTTCCTGAAGGCCTGTCA TGGGAAAGGTCGTTGGAGTTCGAAGATGGTGGGTCCGCTTCAGTCAGTGCGCAT ATAAGCCTTAGAGGAAACACCTTCTACCACAAATCCAAATTTACTGGGGTTAACT TTCCTGCCGATGGTCCTATCATGCAAAACCAAAGTGTTGATTGGGAGCCATCAAC CGAGAAAATTACTGCCAGCGACGGAGTTCTGAAGGGTGATGTTACGATGTACCT AAAACTTGAAGGAGGCGGCAATCACAAATGCCAATTCAAGACTACTTACAAGGC GGCAAAAGAGATTCTTGAAATGCCAGGAGACCATTACATCGGCCATCGCCTCGT CAGGAAAACCGAAGGCAACATTACTGAGCAGGTAGAAGATGCAGTAGCTCATTC CGCTATGAAAACTGTGAAAGTGAATATAACAACCCCTGATGGGCCAGTCTACGA CGCTGATATCGAGATGGTGTCCGTGCGGGCCGAGAGTGGTGATCTCGGCATCCTC CCCGGTCACATTCCCACAAAGGCCCCACTGAAGATCGGAGCTGTGCGGCTGAAG AAGGACGGCCAAACCGAGATGGTCGCAGTCTCAGGCGGCACTGTTGAAGTGCGG CCTGACCACGTTACCATTAATGCTCAAGCCGCTGAAACAGCCGAAGGAATCGAC AAAGAGAGAGCAGAAGCCGCAAGACAGAGGGCCCAGGAGCGGCTGAACTCTCA ATCCGATGACACCGATATTCGCCGGGCCGAGCTGGCACTGCAGAAGGCCCTGAA CAAGCTGGACGTGGCTGGGAAGGCTGACGGCAGCGTGCAGCTCGCCGACCACTA CCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTA CCTGAGCACCCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACAT GGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTG TACAAGGGTGGCAGCGGTGGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGG GTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGC GTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTC ATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGA CCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTT CTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAG GACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTG GTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTG GGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGAC AAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGAA GCT SEQIDNO:19-FusionProteinencodedbySEQIDNO:18-includingmKOkfluorescent protein(aminoacids1-218),afirstalaninelinker(aminoacid219),acontrolmutantATP bindingproteinwhichdoesnotbindATP(aminoacids220-351),asecondalaninelinker (aminoacid352),andcpmEGFPfluorescentprotein(aminoacids352-598) MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEGGPMPF AFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLR GNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGG GNHKCQFKTTYKAAKEILEMPGDHYIGHRLVRKTEGNITEQVEDAVAHSAMKTVKV NITTPDGPVYDADIEMVSVRAESGDLGILPGHIPTKAPLKIGAVRLKKDGQTEMVAVS GGTVEVRPDHVTINAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELALQ KALNKLDVAGKADGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRD HMVLLEFVTAAGITLGMDELYKGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFF KSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKL EYNYNSHNVYIMADKQKNGIKVNFKIRHNIEEA

(113) Any patents or publications mentioned in this specification are incorporated herein by reference to the same extent as if each individual publication is specifically and individually indicated to be incorporated by reference.

(114) The compositions and methods described herein are presently representative of preferred embodiments, exemplary, and not intended as limitations on the scope of the disclosure. Changes therein and other uses will occur to those skilled in the art. Such changes and other uses can be made without departing from the scope of the disclosure as set forth in the claims.