Cell culture models for validating candidate compounds for use in treating COPD and other diseases
09885727 ยท 2018-02-06
Assignee
- St. Luke's-Roosevelt Hospital Center (New York, NY, US)
- The Trustees Of Columbia University In The City Of New York (New York, NY)
Inventors
- Gerard M Turino (New York, NY, US)
- Shuren Ma (Cliffside Park, NJ, US)
- Yong Y Lin (Bridgewater, NJ, US)
- Seymour Leiberman (US)
Cpc classification
Y10T436/145555
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
H01J49/005
ELECTRICITY
G01N30/7233
PHYSICS
G01N2800/122
PHYSICS
G01N2333/78
PHYSICS
International classification
G01N27/62
PHYSICS
Abstract
The present invention relates to methods of diagnosing, monitoring, and treating elastin fiber injuries. In additional preferred embodiments, the present invention relates to methods of validating candidate compounds for use in treating chronic obstructive pulmonary disease (COPD), chronic bronchitis, emphysema, refractory asthma, and other related diseases. Examples of such methods include determining if the candidate compound decreases the degradation of elastic fiber in a patient administered the candidate compound by measuring, using mass spectrometry employing an internal standard, a marker of elastic fiber degradation in a sample of a body fluid or a tissue of the patient. The invention provides that a decrease in the presence of the marker compared to a control validates that the candidate compound is effective to treat, prevent, or ameliorate the disease.
Claims
1. A method for identifying candidate compounds that are effective to treat, prevent, or ameliorate the effects of a disease characterized by elastin degradation comprising: (a) administering a candidate compound to a cell culture model of the disease; (b) measuring, by mass spectrometry using an internal standard comprising acylated pyridinoline, the amount of at least one marker of elastin degradation in the cell culture administered the candidate compound, wherein the at least one marker of elastin degradation is selected from the group consisting of desmosine, isodesmosine, and combinations thereof; and (c) determining whether the amount of the at least one marker produced by the cell culture administered the candidate compound is different compared to a control cell culture absent the candidate compound, wherein a decrease in the amount of the at least one marker produced by the cell culture administered the candidate compound compared to the control cell culture identifies the candidate compound as effective to treat, prevent, or ameliorate the effects of the disease, wherein the disease is selected from the group consisting of chronic obstructive pulmonary disease (COPD), COPD with AATD, chronic bronchitis, emphysema, and refractory asthma.
2. The method according to claim 1, wherein the disease is COPD.
3. The method according to claim 1, wherein both desmosine and isodesmosine are measured.
4. The method according to claim 1, wherein the candidate compound is selected from the group consisting of hyaluronic acid, polysaccharide, carbohydrate, small molecules, and RNAi.
5. The method according to claim 1, wherein tandem mass spectrometry is used.
6. A method for identifying candidate compounds that are effective to treat, prevent, or ameliorate the effects of a disease characterized by elastin degradation comprising: (a) administering a candidate compound to a cell culture model of the disease; (b) measuring, by mass spectrometry using an internal standard comprising acylated pyridinoline, the amount of desmosine and isodesmosine in the cell culture administered the candidate compound; and (c) determining whether the amount of desmosine and isodesmosine produced by the cell culture administered the candidate compound is different compared to a control cell culture absent the candidate compound, wherein a decrease in the amount of the desmosine and isodesmosine produced by the cell culture administered the candidate compound compared to the control cell culture identifies the candidate compound as effective to treat, prevent, or ameliorate the effects of the disease, wherein the disease is selected from the group consisting of chronic obstructive pulmonary disease (COPD), COPD with AATD, chronic bronchitis, emphysema, and refractory asthma.
7. The method according to claim 6, wherein tandem mass spectrometry is used.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
DETAILED DESCRIPTION OF THE INVENTION
(36) According to one preferred embodiment of the present invention, methods are provided for validating whether a candidate compound is effective to treat, prevent, or ameliorate the effects of a disease characterized by elastic fiber injury, such as elastin degradation. In such embodiments, the methods comprise determining if the candidate compound decreases the degradation of elastic fiber in a patient administered the candidate compound by measuring, using mass spectrometry, a marker of elastic fiber degradation in a sample of a body fluid or a tissue of the patient. The invention provides that a decrease in the presence of the marker compared to a control validates that the candidate compound is effective to treat, prevent, or ameliorate the disease.
(37) The foregoing methods may be used to validate whether a candidate compound is effective to treat, prevent, or ameliorate the effects of chronic obstructive pulmonary disease (COPD), chronic bronchitis, emphysema, and/or refractory asthma. The marker of elastic fiber degradation that is measured using mass spectrometry is preferably desmosine, isodesmosine, or combinations thereof. In such embodiments, the marker(s), such as desmosine, isodesmosine, or combinations thereof, are preferably detected and measured within a patient's urine, plasma, and/or sputum.
(38) In certain preferred embodiments of the invention, desmosine, isodesmosine, or combinations thereof are measured in plasma. In certain alternative embodiments, total free desmosine, isodesmosine, or combinations thereof are measured in urine. The methods of the present invention may be employed to test the therapeutic value, or effectiveness, of a variety of different candidate compounds. Non-limiting examples of such compounds include hyaluronic acid, polysaccharides, carbohydrates, small molecules, and RNAi molecules, including siRNAs, shRNAs, and others.
(39) According to additional embodiments of the present invention, methods are provided for identifying candidate compounds that are effective to treat, prevent, or ameliorate the effects of a disease characterized by elastic fiber injury. Such methods of the invention comprise (a) administering a candidate compound to an in vivo or in vitro model of the disease, e.g., a cell culture; (b) measuring, by mass spectrometry, the amount of a marker of elastic fiber injury in the cell culture administered the candidate compound; and (c) determining whether the amount of the marker produced by e.g., the cell culture administered the candidate compound is different compared to e.g., a control cell culture absent the candidate compound. Non-limiting examples of appropriate markers include desmosine, isodesmosine, or combinations thereof. The invention provides that a decrease in the amount of such marker(s) produced by e.g., the cell culture administered the candidate compound compared to e.g., the control cell culture identifies the candidate compound as effective to treat, prevent, or ameliorate the effects of the disease.
(40) Such methods may be used for identifying candidate compounds that are effective to treat, prevent, modulate and/or ameliorate the effects of elastin degradation and diseases associated therewith, such as COPD, chronic bronchitis, emphysema, and/or refractory asthma. Similar to the other embodiments discussed herein, the marker that is measured by mass spectrometry is preferably selected from desmosine, isodesmosine, or combinations thereof. Still further, similar to the other embodiments discussed herein, such methods may be employed to test the therapeutic value, or effectiveness, of a variety of different candidate compounds, including hyaluronic acid, polysaccharides, carbohydrates, small molecules, and RNAi molecules, such as siRNAs, shRNAs, and others.
(41) It is noted that, throughout the instant disclosure, desmosine is frequently abbreviated as D or DES, and isodesmosine is frequently abbreviated as I or IDS. Similarly, desmosine and isodesmosine may be collectively abbreviated herein as D and I, D/I, DID, DES/IDS, or DES and IDS.
(42) Tandem mass spectrometry as used herein refers to techniques in which a sample is analyzed two or more times by mass spectrometry. Typically, the sample is analyzed twice, which is referred to herein as MS/MS or MSMS, but it may be analyzed three or more times. In tandem mass spectrometry, the same mass spectroscope may be used two or more times for a given sample, or separate mass spectroscopes may be used. In the latter case, preferably two different mass spectroscopes connected in series are used. The first mass spectrometer sorts and weighs the sample, then the sample enters a collision cell which breaks the sample into fragments, and the second mass spectrometer sorts and weighs the resulting fragments.
(43) Preferably, the technique used to analyze D and I in a sample is LC-MS/MS. This is shown, for example, in
(44) More preferably, an internal standard is used which is included with each sample tested. An internal standard that bears a close structural similarity to D and I, an acylated pyridinoline, more preferably acetylated pyridinoline (IS), was used. The structural similarity can be seen in a comparison of the structures, as follows:
(45) ##STR00001##
(46) According to one preferred embodiment of the present invention, methods are provided for validating whether a candidate compound is effective to treat, prevent, or ameliorate the effects of a disease characterized by elastic fiber injury, such as elastin degradation. In such embodiments, the methods comprise determining if the candidate compound decreases the degradation of elastic fiber in a patient administered the candidate compound by measuring, using mass spectrometry employing an internal standard, a marker of elastic fiber degradation in a sample of a body fluid or a tissue of the patient. The invention provides that a decrease in the presence of the marker compared to a control validates that the candidate compound is effective to treat, prevent, or ameliorate the disease. In preferred methods, tandem mass spectrometry is used.
(47) The foregoing methods may be used to validate whether a candidate compound is effective to treat, prevent, or ameliorate the effects of chronic obstructive pulmonary disease (COPD), chronic bronchitis, emphysema, and/or refractory asthma. The marker of elastic fiber degradation that is measured using mass spectrometry employing an internal standard is preferably desmosine, isodesmosine, or combinations thereof. In such embodiments, the marker(s), such as desmosine, isodesmosine, or combinations thereof, are preferably detected and measured within a patient's urine, plasma, and/or sputum. In preferred methods, tandem mass spectrometry is used.
(48) In certain preferred embodiments of the invention, desmosine, isodesmosine, or combinations thereof are measured in plasma. In certain alternative embodiments, total free desmosine, isodesmosine, or combinations thereof are measured in urine. The methods of the present invention may be employed to test the therapeutic value, or effectiveness, of a variety of different candidate compounds. Non-limiting examples of such compounds include hyaluronic acid, polysaccharides, carbohydrates, small molecules, and RNAi molecules, including siRNAs, shRNAs, and others.
(49) According to additional embodiments of the present invention, methods are provided for identifying candidate compounds that are effective to treat, prevent, or ameliorate the effects of a disease characterized by elastic fiber injury. Such methods of the invention comprise (a) administering a candidate compound to an in vivo or in vitro model of the disease, e.g., a cell culture; (b) measuring, by mass spectrometry employing an internal standard, the amount of a marker of elastic fiber injury in the cell culture administered the candidate compound; and (c) determining whether the amount of the marker produced by e.g., the cell culture administered the candidate compound is different compared to e.g., a control cell culture absent the candidate compound. Non-limiting examples of appropriate markers include desmosine, isodesmosine, or combinations thereof. The invention provides that a decrease in the amount of such marker(s) produced by e.g., the cell culture administered the candidate compound compared to e.g., the control cell culture identifies the candidate compound as effective to treat, prevent, or ameliorate the effects of the disease. In preferred methods, tandem mass spectrometry is used.
(50) Such methods may be used for identifying candidate compounds that are effective to treat, prevent, modulate and/or ameliorate the effects of elastin degradation and diseases associated therewith, such as COPD, chronic bronchitis, emphysema, and/or refractory asthma. Similar to the other embodiments discussed herein, the marker that is measured by mass spectrometry employing an internal standard is preferably selected from desmosine, isodesmosine, or combinations thereof. Still further, similar to the other embodiments discussed herein, such methods may be employed to test the therapeutic value, or effectiveness, of a variety of different candidate compounds, including hyaluronic acid, polysaccharides, carbohydrates, small molecules, and RNAi molecules, such as siRNAs, shRNAs, and others. In preferred methods, tandem mass spectrometry is used.
(51) The following examples are provided to further illustrate the methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
Example 1D and I Measurements
(52) In these examples, measurements of desmosine (D) and isodesmosine (I) in plasma, urine and sputum are described. The results demonstrate a statistically significant difference between normal controls and patients diagnosed with COPD and further suggest that measurements of D and I in plasma may be a discriminating index for distinguishing patients with COPD from normal subjects. D and I were measured in plasma, urine and sputum in a cohort of patients diagnosed with COPD related to smoking and a second cohort in whom COPD is related to Z-phenotype alpha-1 antitrypsin deficiency (AATD) as well as smoking.
(53) Materials and Methods
(54) The mass spectrometric method was used for direct measurement of D/I in urine, plasma and sputum as markers of elastin degradation in healthy controls, patients with 1-antitrypsin deficiency (AATD) and non-AATD-related COPD. Preparation of specimens of urine and sputum and measurements by mass spectrometry (LC/MS) were performed as previously described in Ma S, Lieberman S, Turino G M and Lin Y Y: The detection and quantitation of free desmosine and isodesmosine in human urine and their peptide-bound forms in sputum.sup.11. D and I standard (mixed 50% D and 50% I) were purchased from Elastin Products (Owensville, Mich.), and all other reagents were from Sigma (St. Louis, Mo.). MCX cation exchange cartridges (3 ml) were obtained from Waters (Milford, Mass.), and CF1 cellulose powders were purchased from Whatman (Clifton, N.J.).
(55) Urine Samples.
(56) Twenty-four hour urine samples were collected and analyzed as previously described.sup.11.
(57) Plasma Samples.
(58) Plasma samples were obtained after centrifuging venous blood specimens at 2500 r.p.m. for 25 min. Samples were stored at 20 C. until used. One ml of plasma and 1 ml of concentrated HCl (37%) were placed in a glass vial. After air in the sample was displaced with a stream of nitrogen, the sample was acid hydrolyzed for 24 hours in 6N HCl. After evaporation to dryness, the residue was dissolved in 2 ml of a mixed solution of n-butanol/acetic acid/6 N HCl (4:1:1, by volume). The sample solution was loaded onto a 3 ml CF1 cartridge. The CF1 cartridge was prepared by introducing 3 ml of the slurry of 5% CF1 cellulose powder in a mixture of n-butanol/acetic acid/water (4:1:1, by volume). The cartridge was washed 3 times with 3 ml of n-butanol/acetic acid/water mixture, and D and I adsorbed in the CF1 cartridge were eluted with 3 ml of water. The eluate was evaporated to dryness under vacuum at 45 C. and the residue was dissolved in 0.1 ml of HPLC mobile phase for LC/MS analysis. For analysis in plasma, samples were processed and measured in duplicate and the results averaged.
(59) Sputum Samples.
(60) Sputum samples were processed as previously described.sup.11 with the following modification: The acid hydrolyzed samples were chromatographed using a CF1 cartridge as described in the treatment of plasma samples. Each sputum sample was processed and measured in duplicate and the results averaged. Sputum was obtained from 3-hour morning collections spontaneously produced. When subjects could not voluntarily produce sputum, sputum induction was induced by 3% saline inhalation for 20 minutes as previously described.sup.11.
(61) Recovery of Desmosine and Isodesmosine in Urine and Plasma.
(62) Using D and I as the external standards we performed studies to ensure recovery and reproducibility of the analysis in urine and plasma. Triplicates of two urine samples, were spiked with 0.4 pmol and 2.0 pmol each of D and I standards, and carried through HCl hydrolysis and chromatography procedures as described. The recoveries of D and I from one urine spiked with 2.0 pmol of D and I were 914% and 881%, and that spiked with 0.4 pmol of D and I were 923% and 938%. The recoveries of D and I from the other urine spiked with 2.0 pmol of D and I were 881% and 933%, and that spiked with 0.4 pmol of D and I were 936% and 9315%. The reproducibility of the repeated sample analysis ranges from 91-99%.
(63) Similar recovery studies were carried out with 4 plasma samples. The recoveries of D and I with 0.05 ng standards were 654 and 7413%, and that with 0.1 ng standards were 671 and 724%. The reproducibility of the repeated sample analysis is 83-99%. Values in urine and plasma were corrected for recovery losses.
(64) Creatinine and Protein Measurement were carried out as previously described.sup.11. LC/MS Analysis was performed also as previously described.sup.11, with slight modification (see description of
(65) Data Analysis.
(66) The t-test adjusted for unequal variance was used to test the null hypothesis. The level of significance was 0.05. P-values were calculated based on the summed values of D and I using the unpaired t-test with Welch's correction.
(67) Patients.
(68) Study patients were diagnosed with chronic obstructive pulmonary disease and adhere to Gold Criteria grades 1-4. All patients were screened for AATD by serum levels and phenotyping. Patients were divided into two groups: 1) with normal levels of alpha-1 antitrypsin in serum, and 2) those with ZZ-homozygous alpha-1 antitrypsin deficiency. Patients gave informed consent for the study. The study was approved by the Institutional IRB.
(69) All patients with normal levels of alpha-1 antitrypsin had significant smoking histories of from 10 to 60 pack years. Many had stopped in the previous ten years and none were current smokers when studied. Among these patients the age range was 44 to 85. Five were males and 2 females.
(70) Among patients with alpha-1 antitrypsin deficiency all but one had a significant smoking history exceeding ten pack years. All patients had ceased smoking for at least ten years by the time of study. All AATD patients were being treated with AAT protein replacement, were in a stable clinical state and exhibited no evidence of an exacerbation.
(71) Control subjects were selected by a clinical history free of any specific known disease or significant symptoms, including respiratory symptoms, and none had ever smoked.
(72) Results
(73) Results in normal subjects are presented in Table 1 below (C=Caucasian; A=Asian).
(74) TABLE-US-00001 TABLE 1 Controls without Lung Disease Desmosine/Isodesmosine Urine Plasma Free Form Free/ ng/g g/g Total Subjects Sex Age Race ng/ml protein creatinine Total % 1 M 33 C 0.11/0.10 1.89/1.80 1.85/1.11 9.64/5.90 19/19 2 M 35 C 0.07/0.09 1.06/1.36 3 F 58 C 0.10/0.08 2.17/1.74 3.73/2.76 10.22/7.65 36/36 4 M 27 A 0.09/0.07 1.31/1.02 0.60/0.50 2.85/2.70 21/19 5 F 31 A 0.10/0.06 2.22/1.29 6 F 69 C 0.09/0.08 1.62/1.44 1.80/1.69 11.77/8.37 15/20 7 M 54 A 0.11/0.13 2.02/2.27 0.51/0.64 5.17/3.96 10/16 8 M 72 A 0.09/0.13 1.94/2.80 0.75/0.35 5.16/4.10 15/9 9 M 79 C 0.12/0.05 2.43/1.01 0.42/0.38 6.17/4.67 7/8 10 M 65 A 0.11/0.10 2.23/2.03 0.99/0.66 6.59/3.89 15/17 11 F 38 A 0.13/0.08 2.27/1.31 0.89/0.88 5.19/4.26 17/21 12 F 28 C 0.11/0.09 1.83/1.50 2.48/1.58 12.69/6.64 20/24 13 M 32 C 0.10/0.08 1.87/1.49 1.59/1.56 7.29/5.68 22/27 mean 0.10/0.09 1.91/1.62 1.42/1.10 7.52/5.26 18/20 SEM 0.01/0.01 0.11/0.14 0.31/0.22 0.94/0.53 2/2
(75) The mean levels and standard error (S.E.M.) of D and I (D/I) in plasma in 13 subjects were 0.100.01/0.090.01 ng/ml plasma and 1.910.11/1.620.14 ng/g protein.
(76) Results for levels of D and I (D/I) in plasma in patients with COPD with normal levels of AAT are presented in
(77) It is noteworthy that no overlap of levels of plasma D and I exists between controls and the patient groups with COPD; patients' levels are consistently higher. The levels of D and I in urine in control subjects and patients with and without AATD are shown in Table 1 and
(78) Levels of D and I in sputum are shown in
(79) Shown in Table 2 below are repeat measurements of plasma D and I in 1 control subject, 1 patient with AATD related COPD and a patient with COPD without AATD. Intervals between repeat measurements were days in subjects with AATD and COPD to weeks and months for the other two subjects. During these intervals, each patient was in a stable clinical state without exacerbations.
(80) TABLE-US-00002 TABLE 2 Repeat Measurements of Desmosine and Isodesmosine in Plasma D/I (ng/ml) D/I (ng/g protein) Normal Subject - 14 month interval 0.12/0.05 2.43/1.01 0.11/0.07 2.11/1.34 Patient with COPD and AATD - 2 day interval 2.31/1.75 54.91/41.60 2.53/2.08 55.90/45.96 2.55/2.49 61.31/59.87 ng/g protein Patient with COPD without AATD - 6 month interval 0.49/0.44 9.32/8.37 0.32/0.31 7.04/6.82
(81) The results varied between 10 and 15%, which suggests a stable metabolic state with respect to elastin turnover in each individual's normal or abnormal levels.
(82) Levels of D and I (D/I) in plasma and urine were analyzed for possible correlation with age, sex, racial origin or physiological parameters of FEV.sub.1 and RV/TLC and no statistically significant correlations were determined.
(83) Data Analysis
(84) An early insight into the mechanisms leading to alveolar disruption in pulmonary emphysema is that lung matrix elastin is a target for chemical degradation from cellular elastases. Lung elastin content, determined chemically, has been demonstrated to be low in pulmonary emphysema related to smoking or to the Z-phenotype AATD, and morphologically, lung elastin fibers have been shown to be fragmented and disordered. Also intratracheal administration of elastases has uniquely produced animal models of pulmonary emphysema. In addition, elastin peptides have been shown to be chemotactic for neutrophils and macrophages and could be a factor in the progression of human pulmonary emphysema once elastin degradation has occurred.
(85) Current methods of measuring elastin peptides in blood plasma require radioimmunoassay techniques which depend on antibodies to elastin peptides which vary in specificity and sensitivity, which affects the standardization and quantification of peptides. Also, measurements of D and I in urine require a relatively extensive chemical procedure using isotope dilution corrections and HPLC, which can be an arduous methodology.
(86) Recognizing these limitations, mass spectrometry, with its ability to detect specific molecular species with high sensitivity, accuracy and specificity is a readily applicable method for use in complex body fluids. The increased sensitivity of mass spectrometry has permitted the measurement of a free component unbound to protein or other matrix constituents of D and I in urine which are increased statistically significantly in patients with COPD as compared with normals. Similarly, mass spectrometry has allowed measurements of D and I in blood plasma and sputum, both chemically complex media. Attempts to detect a free vs. bound component of D and I in plasma were unsuccessful. The concentration of D and I in a single small sample of plasma may be too low for detection compared to the concentration of D and I in a 24-hour collection of urine.
(87) The increased free component of D and I in urine in COPD patients, we believe, may reflect an increased neutrophil elastase concentration in circulating neutrophils, which has been demonstrated by previous measurements as an increase in lysosomal elastase in neutrophils of COPD patients as compared with normals. This increased elastase concentration may reflect a generalized immunological hyperreactivity resulting from the chronic inflammatory state of the lung in COPD, manifested by increased elastase activity in neutrophils and macrophages.
(88) The difference in levels of D and I in plasma between controls and patients with COPD in this study suggests that D and I in plasma may be one of the sensitive indicators of the presence of lung elastin breakdown in COPD, especially since the entire cardiac output constantly circulates through the lung. While changes in levels of D and I in plasma cannot be assumed to reflect D and I from lung parenchyma per se, the demonstrated presence of D and I in sputum of patients with COPD indicates that increased degradation, and probably turnover, of elastin is occurring in lung, since normal subjects do not have detectable amounts of D and I in induced sputum.
(89) In the limited number of our controls we did not find any correlation of the age of the subjects with urinary excretion or plasma levels of D and I. In other studies of adult subjects which include similar measurements no correlations with age have been reported.
(90) Measurements of total excretion of D and I in 24 hour urine collection did not demonstrate statistically significant differences between patients and normals. This result is consistent with the demonstration of Bode et al., who showed marked variability in daily excretion of D and I in COPD patients and no statistically significant difference in the total excretion between the two cohorts.sup.42. Also, Starcher et al. have demonstrated a failure of urine to reflect the rapid degradation of lung elastin produced by intratracheal porcine pancreatic elastase in mice. Their studies demonstrated a sequestering of elastin peptides in renal parenchyma following lung elastin breakdown and a continued slow urinary excretion of D containing peptides over several days following acute elastase injury.sup.122. Other studies have shown significant increases of urinary D in COPD patients compared to normals. Possibly the individual patient population in the present study varied from those previously studied. In that regard, none of the patients in this study were actively smoking, which has been shown to increase urinary desmosine excretion.
(91) When elastin degradation is mildly, or even moderately, increased above the turnover in normals, it may be difficult to reflect this increase in urine, even with 24-hour collections. However, the percentage of the free component of D and I in urine is consistently elevated in both groups of patients with COPD.
(92) It has long been demonstrated that elastin in elastin fibers, once formed, cross-linked and insoluble, is extremely stable and undergoes little metabolic turnover. This slow metabolic turnover in normal humans is consistent with the very low levels of D and I in normal plasma. It is noteworthy that studies of elastase injury to lung elastin in vivo in rats and mice demonstrate that rapid degradation of elastin occurs when exposed to elastases, with rapidly ascending concentrations of elastin peptides in blood and urine within hours of protease administration. Notable also is the rapid resynthesis of elastin after proteolytic breakdown. The stability of plasma and urine levels of desmosine with repeat measurements over a 44 day interval in patients with AATD was reported by Stolk et al., which is consistent with measurements in this study.sup.123. Thus any increase in elastase activity in lungs, which includes bronchial and blood vessel elastin as well as alveolar, may well be reflected in the circulating blood to and from the lung.
(93) The persistence of elevated levels of D and I in plasma in patients with COPD in both patient cohorts long after smoking cessation is consistent with continued inflammation of the lung in COPD and progression of matrix tissue injury.
(94) The blood levels of D and I in COPD patients may therefore prove to be a sensitive index of the metabolic state of elastin degradation and possibly resynthesis in the lung. Since elastin is a significant structural constituent of alveoli, bronchial walls and blood vessels, the levels of D and I in the earliest phases of COPD deserve to be evaluated. Also the responses to therapeutic agents which may reduce the lung inflammatory state and thereby reduce elastin degradation may be assessed by measurements of D and I in plasma and the proportion of free D and I in urine.
(95) It is noteworthy that the AATD patients had higher levels of D and I in plasma than COPD patients without AATD, along with higher levels in sputum consistent with the AATD patients' form of COPD to be emphysematous with loss of lung mass. All patients with AATD were receiving AAT augmentation therapy at the time of study. Since levels of D and I in body fluids were not obtained prior to the initiation of augmentation therapy, it cannot be assumed that AAT replacement is having no beneficial effect. These data suggest that an evaluation of the effect on D and I levels of higher doses of AAT augmentation would be worthwhile.
(96) Mass spectrometry allows measurements of D and I separately. The proportion of D and I in plasma and urine in control subjects shows a slightly lower proportion of isodesmosine constituting approximately 80% of the level of desmosine. In one study of the amino acid composition of human lung elastin, D exceeded I content by approximately 10-15%, which is close to agreement with the present study.sup.124. It is noteworthy that patients with COPD in both groups had proportions of D and I which are similar to controls, suggesting that resynthesis of elastin in these groups does not show major structural dissimilarities from normals.
(97) The results of this study indicate that levels of D and I in urine which includes an unconjugated fraction, along with levels in plasma and sputum may be useful parameters to characterize patients with COPD of various phenotypes at various phases of the disease. Mass spectrometry, with its increased specificity and sensitivity, should facilitate this characterization.
Example 2Effect of Tiotropium Treatment
(98) COPD patients have elevated levels of D/I in plasma, urine and sputum, which might respond to prolonged bronchodilation. To determine if clinical effects of Tiotropium (TIO) affect tissue degradation of the lung in COPD, clinically stable patients with COPD (n=9) not on TIO prior to the study and at one month and a second month after initiating therapy were tested. Other anticholinergic bronchodilators were stopped prior to TIO, and other therapies/disease treatments were unchanged for the two months of study. To these patients, 18 mcg TIO was administered each 24 hours. D/I in plasma, urine and sputum were measured by liquid chromatography and mass spectrometry (LC/MS) prior to the study and at one month and two months after the study.
(99) Prior to the study, levels of D/I in plasma and sputum were above normal in all patients studied, and the percentage of free D/I in urine was also increased. Significant decreases in D/I levels were observed in urine (10 out of 12), in plasma (10 out of 12) and in sputum (all 12 patients), which may reflect decreases in lung elastin degradation of COPD patients on TIO therapy. (
(100) Overall results of percent decreases in D/I levels indicated that all 12 COPD patients were responding to prolonged TIO treatment with some decrease in lung elastin degradation. Spirometry in most post-TIO therapy patients shows significant increase in Force Vital Capacity (FVC), Forced Expired Volume in 1 second (FEV1), and ratio of FEV1/FVC and decreases in Residual Volume (RV). The improvement in spirometric indices were usually concordant with levels of D/I in patients.
(101) Overall results demonstrate that two months of treatment with TIO in patients is accompanied by significant reductions in D/I levels in plasma, urine and sputum, consistent with a reduction in elastin degradation and possibly an anti-inflammatory effect. Thus, this example confirms the effectiveness of the methods disclosed and claimed herein for, e.g., validating whether a candidate compound is effective to treat, prevent or ameliorate the effects of a disease characterized by elastic fiber injury, such as COPD, COPD with AATD, chronic bronchitis, emphysema, or refactory asthma.
Example 3Analysis Using LC/MSMS and Internal Standard (IS)
(102) D and I concentrations were determined in urine, plasma, and sputum samples using LC/MSMS with an internal standard which was acetylated pyridinoline (IS).
(103) Preparation of specimens of urine, plasma, and sputum was performed as described in Example 1. MCX cation exchange cartridges (3 ml) and CF1 cellulose powders were as indicated in Example 1. D and I standards (mixed 50% D and 50% I) were obtained from Elastin Products (Owensville, Mich.). Acetylated pyridinoline was obtained from Quidel (San Diego, Calif.). All other reagents were from Sigma (St. Louis, Mo.).
(104) Acid Hydrolysis:
(105) 0.2 mL of urine, or 0.5 mL of plasma or sputum were placed in a glass vial with equal volumes of concentrated HCl (37%). Air in the vial was displaced with nitrogen, and was heated at 110 C. for 24 hrs. The hydrolyzed sample was filtered and evaporated to dryness. For the free forms of D and I analysis, samples were analyzed directly without the HCl hydrolysis.
(106) Cellulose (CF1) Cartridge Treatment:
(107) The internal standard, acetylated pyridinoline (IS) was added to the acid hydrolyzed and unhydrolyzed (for free D and I) samples; 1 ng was added to urine samples and 0.5 ng was added to plasma and sputum samples. The sample mixtures were dissolved in 2 mL of n-butanol/acetic acid/water (4:1:1), and applied onto a 3 mL cellulose cartridge, which was prepared by introduction of 3 mL of 5% CF1 slurry in n-butanol/acetic acid/water (4:1:1) (well dispersed slurry by stirring for 24 hrs). The cartridge was washed 3 times with 3 mL of n-butanol/acetic acid/water (4:1:1), and the components retained in the cartridge were eluted with 3 mL of water, dried and dissolved in 200 l of LC mobile phase.
(108) LC/MSMS Analysis.
(109) A TSQ Discovery electrospray tandem mass spectrometer (Thermoelectron) was used for the LC/MSMS analysis. HPLC separation of D and I was achieved using a 2 mm150 mm dC18 (3 m) column (Waters, Milford, Mass.) with mobile phase A (7 mM HFBA/5 mM NH4Ac in water) and mobile phase B (7 mM HFBA/5 mM NH4Ac in 80% acetonitrile). The HPLC was programmed linearly from 100% A to 82% A in 12 mins. The tandem mass spectrometry (LC/MSMS) technique monitors ions of m/z 481 and m/z 387. Selected reaction monitoring (SRM) of D and I (m/z 526 to m/z 481+397) and IS (m/z 471 to m/z 128) were used for the quantitative measurement to determine D and I concentration in the samples.
(110) Sample Spectrograms.
(111) Spectrograms from analysis of samples from a patient of urine (free D and I), urine (total D and I), plasma and sputum, in which each sample was tested three times, are provided in
(112) Calculation.
(113) To determine the concentrations of D and I in the samples, the ratio of the analyte response to the internal standard response is ascertained. The calculation used is shown in
(114) Reproducibility.
(115) From the three measurements taken per sample using LC/MSMS with IS, the coefficient of variance was calculated.
(116) TABLE-US-00003 Urine Urine Free D/I Total D/I (g/g Creatinine) (g/g Creatinine) Mean 7.45 Mean 15.98 SD 0.91 SD 1.76 % CV 12 % CV 11
(117) TABLE-US-00004 Plasma Sputum D/I (ng/ml) D/I (ng/ml) Mean 0.23 Mean 0.23 SD 0.03 SD 0.01 % CV 13 % CV 4
(118) In comparison, representative samples in which three measurements were taken per sample were identified from data in which D and I were measured using LC/MS. The comparative data is provided as follows:
(119) TABLE-US-00005 Urine Urine Free D/I Total D/I (g/g Creatinine) (g/g Creatinine) Mean 0.93 Mean 9.75 SD 0.20 SD 0.96 % CV 22 % CV 10
(120) TABLE-US-00006 Plasma Sputum D/I (ng/ml) D/I (ng/ml) Mean 0.63 Mean 0.52 SD 0.21 SD 0.11 % CV 33 % CV 21
(121) As can be seen, the coefficient of variance from a representative sample of urine (Total D/I) measured by LC/MS was about 10%. The other representative samples, however, had about or above 20% variance. The CV % for an urine (free D/I) sample was 22% and the CV % for a sputum sample was 21%. For a plasma sample, the CV % was as high as 33%.
(122) For the measurements taken using LC/MSMS with IS, on the other hand, the reproducibility was significantly and unexpectedly improved. All of the samples had a CV % below 15%, and the particular CV percentages spanned from 4% (for sputum sample) to 12% (for urine (free D/I) sample). The use of tandem MS employing an internal standard shows significant improvement in reproducibility. Thus, the technique advances the importance of desmosine and isodesmosine as reliable biomarkers in biological fluids for the detection of elastin degradation in diseases characterized by elastic fiber injury such as COPD. Moreover, using the process according to the present invention it is now possible to obtain CV percentages within FDA approved limits (i.e., generally below 15%).
Example 4Effect of Hyaluronan on Smoke-Induced Elastic Fiber Injury
(123) In the current study, we used the D/I biomarker to determine both the progression of elastic fiber damage in a mouse model of smoke-induced pulmonary emphysema and the potential therapeutic effects of aerosolized hyaluronan (HA) on smoke-induced injury. This agent has previously been shown to significantly reduce smoke-induced airspace enlargement and prevent elastic fiber injury when given concurrently with smoke.sup.15. The current investigation modifies the original experimental protocol by delaying therapeutic intervention for 1 month following initiation of smoke exposure, thereby providing a more clinically relevant approach to evaluating this form of treatment. The ability of HA to limit airspace enlargement and prevent elastic fiber injury, despite pre-existing smoke-induced lung injury, would support clinical testing of this agent in patients who already have significant evidence of COPD.
(124) Methods
(125) Experimental Plan
(126) Eight-week-old female DBA/2J mice (The Jackson Laboratory, Bar Harbor, Me.) were divided into two treatment groups as follows: Group 1 was treated with aerosolized HA, beginning 1 month following initiation of smoke exposure; Group 2 was treated with aerosolized water, beginning 1 month following initiation of smoke exposure. Groups 1 and 2 were exposed to smoke for 3 h per day, 5 days/week, for a period of 10 months. Group 1 was treated with a 0.1% solution of HA in water for 1 h prior to each smoking session. Group 2 received aerosolized water for a similar interval. At various intervals following initial smoke exposure, animals were euthanized to determine (1) DID content in bronchoalveolar lavage fluid (BALF) and whole lungs at 2, 4, 6, 8, and 10 months; (2) lung histopathology at 3, 6, and 10 months; and (3) airspace enlargement as measured by the mean linear intercept (MLI) at 3 months.
(127) Exposure to Cigarette Smoke
(128) Following administration of either aerosolized HA or water, the nebulizer was disconnected and the smoking machine (Model TE-10, Teague Enterprises, Davis, Calif.) was attached to the exposure chamber. Both treatment groups were exposed to cigarette smoke for a period of 3 h/day, 5 days/week. The smoking machine simultaneously burned two filtered research-grade cigarettes (type 2R4F, University of Kentucky). Each cigarette was puffed once per minute for 2 s at a flow rate of 1.05 LPM, yielding 35 cc of smoke. This cycle was repeated nine times before ejecting the cigarette and loading a new one. Proper flow rate was maintained by a vacuum pump that established negative pressure at the exhaust port.
(129) Exposure to HA Aerosol
(130) Beginning 1 month following initial smoke exposure, Group 1 was administered a 0.1% solution of low-molecular-weight (150 kDa) streptococcal HA in water (Bayer, Shawnee, Kans.), using a Misty-Ox nebulizer (Vital Signs, Totowa, N.J.). Group 2 received aerosolized water alone. The nebulizer was connected to a heavy-duty air compressor that delivered a constant pressure of 30 psi. The aerosol entered the exposure chamber through an inflow port attached to the roof and was drawn through the chamber by negative pressure created by a vacuum pump connected to an exhaust port on the side wall. The chamber was large enough (281915 in.) to permit the mice to remain in their cages while inhaling the aerosol, thereby minimizing direct handling of the animals.
(131) Light Microscopic Studies
(132) At 3, 6, and 10 months following initiation of smoke exposure, mice were asphyxiated with CO.sub.2 and their lungs were inflated in situ with 10% neutral-buffered formalin at a constant pressure of 20 cm H.sub.2O. After 2 h, the chest contents were removed and fixed for several days in formalin. The extrapulmonary structures were then dissected off and the lung tissues were randomly cut and entirely submitted for histological processing. Slide sections stained with hematoxylin and eosin were examined with the light microscope to determine histological changes and to quantify airspace diameter by the mean linear intercept method.sup.16. Additional sections were treated with the Verhoeff-Van Gieson stain to identify elastic fibers.
(133) Measurement of DID
(134) The levels of the elastin-specific crosslinking amino acids, DID, were measured in both BALF and whole-lung tissues. Animals were asphyxiated with CO.sub.2 and their lungs were lavaged three times with 1-ml aliquots of Hanks' solution. Both cell-free lavage fluids and homogenized lung tissues were then hydrolyzed in 6 N HCl at 110 C. for 24 h, and the hydrolysates were filtered and evaporated to remove acid. DID were quantified by high-performance liquid chromatography and electrospray ionization mass spectrometry according to previously published procedures.sup.11.
(135) Data Analysis
(136) All data were expressed as meanstandard error of the mean (SEM). The two-sample t-test was used to determine statistically significant differences between treatment groups.
(137) Results
(138) BALF DID
(139) As shown in
(140) Lung DID
(141) The amount of DID in the lungs was also measured at bimonthly intervals, beginning 2 months after the smoking regimen began. Both the HA/Smoke and Smoke-Only groups showed an increase in DID during the first 2 months, followed by a decline over the next 4 months and a second increase between 6 and 10 months (
(142) Differences between the groups were not statistically significant over the entire course of the study.
(143) Lung Histopathology
(144) Exposure to tobacco smoke for 3 months resulted in significant airspace enlargement in animals receiving smoke alone, whereas only minimal alveolar changes were seen in those treated with HA (
(145) Both groups showed inflammation of the larger airways at 3 months, including prominent papillary hyperplasia of bronchial epithelium, and accumulation of elastic fibers within the connective tissue stalks associated with the papillary epithelium (
(146) Discussion
(147) The concept of using nebulized HA to prevent elastic fiber injury is based on a series of experiments designed to determine the potential role of agents other than elastases in the pathogenesis of pulmonary emphysema. Previous studies from this laboratory indicated that intratracheal instillation of a nonelastolytic enzyme, hyaluronidase, induced pulmonary airspace enlargement in hamsters when administered in conjunction with 60% oxygen.sup.19. Damage to elastic fibers occurred only when both agents were given concomitantly, suggesting the possibility that hyaluronidase may facilitate the breakdown of these fibers by increasing their susceptibility to injury by other injurious agents such as elastases or oxidants. This concept was supported by subsequent work demonstrating that pretreatment of the lung with hyaluronidase enhances airspace enlargement induced by intratracheal administration of elastase.sup.20,21.
(148) Studies were then undertaken to examine the effect of HA itself on this model of emphysema. Animals were exposed to an aerosol composed of 0.1% HA in water for 50 min prior to intratracheal instillation of elastase. Compared to controls treated with aerosolized water and elastase, those that received HA had significantly less airspace enlargement.sup.22,23.
(149) Although the precise mechanism by which HA prevents lung injury is not yet well understood, our laboratory has shown that HA does not directly inhibit elastases but instead appears to bind to elastic fibers and prevent elastases from attacking them.sup.20,22,24. Studies using aerosolized fluorescein-labeled HA demonstrated preferential adherence of the polysaccharide to lung elastic fibers.sup.22,24. This finding was complemented by additional experiments in which the binding of HA to elastic fibers in vitro prevented elastolysis by several different types of elastase, including human metalloproteinase 12, an enzyme that may be responsible for emphysematous changes associated with cigarette smoking.sup.22.
(150) Interactions between HA and elastic fibers may involve formation of electrostatic or hydrogen bonds. The binding sites may not be situated on the elastin protein itself but may instead be located in the surrounding matrix composed of microfibrils or other glycoproteins. Alternatively, the exogenously administered HA could combine with native HA in close proximity to elastic fibers by a process of self-aggregation.sup.26,27. The resulting molecular complexes of HA may provide a protective barrier against both free elastases and the cells that secrete them.sup.13.
(151) In contrast to earlier studies in which HA was administered concomitantly with cigarette smoke, the current investigation allowed elastic fiber breakdown to proceed unimpeded for the first month, thus providing a more clinically relevant test of the therapeutic potential of HA. While concurrent administration of aerosolized HA significantly reduced BALF DID levels within 3 months of smoke exposure.sup.15, the same effect was not seen until 6 months in the present study. Nevertheless, the delay in administering HA did not affect its ability to prevent emphysematous changes in the lung.
(152) In the current study, the lack of airspace enlargement in the HA-treated group, despite significant elastic fiber breakdown, may possibly be explained by the fact that airway injury is an early feature of this model of smoke-induced lung injury. Although the precise contribution of airway inflammation to BALF DID levels remains uncertain, it may be speculated that the high levels of BALF DID at 2 and 4 months following initiation of smoke exposure are a consequence of elastin turnover in the walls of the larger airways rather than the distal lung.
(153) With regard to total-lung DID, there were no significant differences between the two groups at any time point, suggesting that this parameter is not a sensitive measure of elastic fiber degradation but rather reflects the balance between elastic fiber injury and repair. Rapid resynthesis of these fibers could mask any differences with regard to their rate of breakdown.
(154) The development of airway inflammation within the first 2 months of smoke exposure may explain why HA was initially ineffective in reducing BALF DID levels. The release of enzymes and oxidants by inflammatory cells may cause the exogenous HA to undergo breakdown, thereby impairing its ability to form larger, protective complexes in proximity to airway elastic fibers. While such a process remains hypothetical, this laboratory has previously shown that the same preparation of aerosolized HA used in the current study is effective in preventing acute lung injury only when given prior to intratracheal instillation of endotoxin.sup.27.
(155) Whether a similar pattern of elastic fiber breakdown and proliferation occurs in human lungs in response to smoking remains unclear. However, there is some experimental evidence which suggests that both forms of injury have certain features in common. In one study, DID levels in plasma and urine were significantly elevated in COPD patients, with and without emphysema, indicating that elastic fiber injury occurs in both airways and lung parenchyma.sup.12. Other investigators have also reported a reduction in urinary desmosine levels as the disease progresses, although their findings were attributed to a loss of lung elastic fiber mass rather than a specific decrease in the rate of elastin breakdown.sup.28.
(156) The leveling off of airspace enlargement in smoke-exposed mice after several months is consistent with an adaptive response to chronic injury. A number of studies suggest that enhanced synthesis of endogenous antioxidants may limit the damaging effects of tobacco smoke and other oxidants.sup.29-31. Furthermore, changes in the interstitial extracellular matrix resulting from continued injury and repair could decrease the likelihood of alveolar wall rupture due to elastase activity or mechanical stress. Regarding this possibility, an increase in lung collagen content has been reported after prolonged exposure to cigarette smoke, suggesting a transition from a degradative to a proliferative process, similar to that observed in the current study.sup.32.
(157) Notwithstanding these limitations, experimental models of smoke-induced lung injury provide a means of evaluating the usefulness of potential therapeutic agents. In the current study, the ability of HA to mitigate both airspace enlargement and elastic fiber injury, despite a 1-month delay in treatment, provides added support for testing this agent in patients with pre-existing COPD. The gradual progression of this disease suggests that even a small decrease in the rate of elastic fiber injury could have a significant impact on the decline of lung function.
Example 5Quantitation of Desmosine and Isodesmosine in Urine, Plasma, and Sputum by Tandem Mass Spectrometric Analysis
(158) In this application we describe a practical, and a reliable LC/MSMS analysis that can measure DES and IDS in all body fluids including urine, plasma, sputum, and lavages and serve as a standardized method. The analysis utilizes commercially available acetylated pyridinoline as the internal standard to optimize reproducibility and accuracy.
(159) Materials and Methods
(160) Chemicals
(161) Desmosine (DES) and Isodesmosine (IDS) standard (mixed 50% DES and 50% IDS) were purchased from Elastin Products Company (Owensville, Mich.). Acetylated pyridinoline was obtained from Quidel (San Diego, Calif.). CF1 cellulose powders were purchased from Whatman (Clifton, N.J.), and all other reagents were from Sigma (St. Louis, Mo.).
(162) Sample Collection and Human Subjects
(163) Urine (24 hour samples), plasma, and sputum samples were collected as previously described.sup.11,54 from volunteers with informed consent at the James P. Mara Center for Lung Disease, St. Luke/Roosevelt Hospital Center, New York. COPD was diagnosed in study patients according to the Global initiative for Chronic Obstructive Lung Disease grades 1 to 4.sup.60. Patients gave informed consent for the study. Control subjects were selected by clinical history free of any specific known disease or significant symptoms, and none have ever smoked. The study was approved by the Institutional Review Board.
(164) Creatinine and Protein Measurement
(165) Urine creatinine was measured by the commercially available 555A creatinine kit (Sigma-Aldrich). Total protein in plasma and sputum samples was measured by the commercially available microprotein assay kit (Sigma-Aldrich), which is based on protein-dye (Coomassie blue) binding.
(166) Acid Hydrolysis
(167) Samples of urine (0.1 ml), plasma or sputum (0.5 ml each) were placed in a glass vial with equal volumes of conc. HCl (37%). Air in the vial was displaced with nitrogen, and was heated at 110 C. for 24 hrs. The hydrolyzed sample was filtered and evaporated to dryness. For the free (unconjugated) forms of DES and IDS analysis, 0.2 ml of urine was analyzed directly without the HCl hydrolysis.
(168) Cellulose (CF1) Cartridge Extraction
(169) The acid hydrolyzed samples (after drying under vacuum or nitrogen stream to remove residual acid) or unhydrolyzed urine sample (for free DES and IDS analysis) were treated with 1 ng (for urine samples) or 0.5 ng (for plasma and sputum samples) of acetylated pyridinoline as the internal standard.
(170) The mixture was dissolved in 2 ml of n-butanol/acetic acid/water (4:1:1), and applied onto a 3 ml cellulose cartridge, which was prepared by introduction of 3 ml of 5% CF1 cellulose powder slurry in n-butanol/acetic acid/water (4:1:1). The cellulose powder slurry must be a well dispersed slurry by stirring for 24 hrs. The cartridge was washed 3 times with 3 ml of n-butanol/acetic acid/water (4:1:1), and the samples retained in the cartridge were eluted with 3 ml of water, dried and dissolved in 200 l (for urine sample) or 100 l (for plasma and urine samples) of LC mobile phase and analyzed by LC/MSMS.
(171) LC/MSMS Analysis
(172) A TSQ Discovery electrospray tandem mass spectrometer (Thermo Fisher Scientific) was used for LC/MSMS analysis.
(173) HPLC conditions used were a 2 mm150 mm dC18 (3 m) column (Waters, Mass.) and the mobile phase A (7 mM HFBA/5 mM NH.sub.4Ac in water) and B (7 mM HFBA/5 mM NH.sub.4Ac in 80% acetonitrile) were programmed linearly from 100% A to 82% A in 12 mins.
(174) Quantitation was performed by selected reaction monitoring (SRM) of the transitions of both DES and IDS (m/z 526 to m/z 481+m/z 397) and the internal standard (m/z 471 to m/z 128), with collision energy set at 33 V for both transition, collision gas pressure was 1.5 mTorr, tube lens at 132 V, with sheath gas pressure set at 45 and auxiliary gas pressure at 6 units and ion spray voltage at 3.8 kV. The scan time set at 1.00 msec and both quadrupoles (Q1 and Q3) were at 0.7 Da FWHM.
(175) Statistical Analysis
(176) A t-test adjusted for unequal variance was used to test the null hypothesis. The level of significance was 0.05. The p-values were calculated based on the summed values of DES and IDS using the unpaired t-test (The used software is GraphPad Prism 4 (2)).
(177) Results
(178) DES and IDS are Stable Toward HCl Hydrolysis
(179) The assay of total DES and IDS in biological fluids requires HCl hydrolysis at 110 C. to release DES and IDS from their crosslinked or peptide conjugates. We examined the stability of DES and IDS in three different concentrations (10, 5, and 1 ng/ml) during HCl hydrolysis at 110 C. for 24 hrs. The DES/IDS solutions resulting from the HCl treatment were subjected to LC/MSMS measurements of DES and IDS, which were compared with the measurements of the same concentrations of untreated DES and IDS to calculate the recovery by the acid treatment. The results show that DES and IDS are stable through acid hydrolysis with virtually complete recoveries at all three concentrations (Table 3).
(180) Recovery of DES and IDS in Human Body Fluids
(181) Three known amounts of DES/IDS were spiked into the control urine, plasma, and sputum samples at concentration ranges expected to be encountered in biological samples (10, 20 and 40 ng/ml in urine samples; 0.2, 0.4 and 0.8 ng/ml in plasma and sputum samples). The mixtures were subject to HCl hydrolysis at 110 C. for 24 hrs, addition of IS, CF1 cartridge chromatography, and LC/MSMS analysis under the established procedure to measure DES/IDS levels. The recoveries of DES/IDS are above 99% in urine, 94% in plasma, and 87% in sputum samples; with the imprecision 8%, 9%, and 10%, respectively (Table 2). Limit of quantitation (LOQ) in all relevant body fluids are determined as 0.1 ng/ml of samples based on reproducibility and recovery study (Table 4).
(182) Acetylated Pyridinoline as Internal Standard
(183) Acetylated pyridinoline is an acetylated derivative of 3-hydroxy pyridinoline which serves as a trifunctional crosslink in collagen. The compound has been used as an internal standard (IS) in HPLC analysis of pyridinium crosslinks of collagen in urine or tissue.sup.61-63.
(184) Since acetylated pyridinoline has a similar molecular structure and polarity to that of DES and IDS (
(185) Standardized LC/MSMS Analysis of DES and IDS in all Body Fluids
(186) We have developed the following conventional three-step analytical procedure which can be used to measure DES and IDS in all relevant body fluids (urine, plasma, and sputum) or lavage fluids:
(187) 1. Sample hydrolysis: To body fluid samples (0.1 ml urine, 0.5 ml plasma or sputum) are added with equal volumes of concentrated HCl (e.g., about 6-12N) and heated in nitrogen at 110 C. for 24 hours. (For free urinary DES and IDS analysis, this hydrolysis step is eliminated)
(188) 2. CF1 cartridge extraction: Add 1 ng (for urine) or 0.5 ng (for plasma, sputum) of internal standard (acetylated pyridinoline) and apply to a 3 ml cellulose cartridge prepared by introduction of 5% CF1 cellulose powder slurry in n-butanol/acetic acid/water (4:1:1), wash the cartridge with n-butanol/acetic acid/water (4:1:1), and elute the analytes out with 3 ml of water.
(189) 3. LC/MSMS analysis: HPLC separation by a 2 mm150 mm dC18 (3 m) column and measure DES and IDS by SRM monitoring of transition ions; DES or IDS (m/z 526 to m/z 481+397) and IS (m/z 471 to m/z 128).
(190) Measurement of DES and IDS in Urine, Plasma, and Sputum of COPD Patients and Healthy Subjects
(191) The analytical procedure we have developed was used to compare the levels of DES and IDS in urine, plasma, and sputum obtained from COPD patients and that of healthy normals. The results are shown with urine samples in
(192) Discussion
(193) A strength of DES/IDS as biomarkers in COPD is the recognition that matrix elastin is a structural target of the disease. Among the many techniques developed to measure DES/IDS, the LC/MSMS technique which provides higher sensitivity and specificity appears to be an improved choice for biomarker analysis.sup.55. Several modifications of LC/MSMS methods for DES/IDS analysis have been reported recently, but they are all developed for the measurements of DES/IDS in urine.sup.56-58. Our previous studies on the measurement of DES/IDS in COPD patients.sup.11,54 and DES/IDS levels in response to Tiotropium treatment of COPD patients.sup.10 demonstrate that DES/IDS levels in sputum and plasma are effective indicators of elastin degradation in patients in the body as a whole and the lung per se. Development of a sensitive, accurate, and reproducible method which can measure DES/IDS levels in all body fluids can be clinically meaningful especially related to parameters such as lung structure analyzed by computed tomography quantitative, lung function or genomic analysis.
(194) Previously published LC/MS or LC/MSMS methods.sup.11,54-58 all have disadvantages of either lack of a reliable internal standard or the method not standardized for the analysis of all relevant body fluids (i.e., urine, plasma, and sputum), which are important for assessing clinical meaning of elastin degradation. In this application we have developed a practical and simplified LC/MSMS analytical procedure that can be universally utilized for the analysis of DES and IDS in all relevant body fluids; including urine, plasma, and sputum.
(195) We confirm that DES/IDS are stable under the conditions of hydrolysis in 6N HCl at 110 C. for 24 hours, the acid hydrolysis generally used to release DES/IDS from their peptide conjugate (Table 3). We introduce acetylated pyridinoline as the internal standard after the HCl hydrolysis step to correct for losses occurring from the subsequent steps. Acetylated pyridinoline has a closely similar molecular structure and chromatographic mobility to that of DES and IDS molecules, which enables the development of a reproducible and accurate LC/MSMS measurement of DES/IDS in urine, plasma, and sputum. The LC/MSMS analysis can also effectively separate the two DES/IDS isomers (
(196) TABLE-US-00007 TABLE 3 Stability of Desmosine (DES) and Isodesmosine (IDS) on acid hydrolysis* 10 ng/ml DES/IDS 5 ng/ml DES/IDS 1 ng/ml DES/IDS Recovered (ng/ml) DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS Means 5.04 5.37 10.41 2.42 2.55 4.98 0.50 0.48 0.98 SD 0.32 0.30 0.61 0.20 0.20 0.24 0.05 0.05 0.10 % 6 5 6 8 8 5 10 11 10 % Recovery 101 107 104 97 102 100 100 96 98 *DES/IDS of three concentrations were hydrolyzed in 6N HCl at 110 C. for 24 hour, after addition of internal standard DES/IDS were re-isolated by SPE (CF1 column) chromatography, and quantified by LC/MSMS analysis
(197) Two previous reports have introduced deuterated compounds as internal standards to improve LC/MSMS analysis of DES/IDS.sup.57,58. However the origin of the deuterium compounds are not stated, and appeared to be obtained through catalytic proton exchange reactions with DES/IDS. The structures and the stability of the introduced standard were not demonstrated. In this regard, acetylated pyridinoline is a commercially available compound with defined structure, which can be readily added as the internal standard. The accuracy and reproducibility of the developed LC/MSMS analysis was further tested by recovery studies of DES/IDS in a series of known contents of DES/IDS in urine, plasma, and sputum samples as shown in Table 4. The recoveries from urine, plasma, and sputum samples are above 99%, 94%, and 87%, respectively, with good reproducibility.
(198) TABLE-US-00008 TABLE 4 Recovery of Desmosine (DES) and Isodesmosine (IDS) from Urine, Plasma, and Sputum* Recovery from Urine Control Urine Add 40 ng/ml urine Add 20 ng/ml Urine Add 10 ng/ml Urine Recovered (ng/ml) DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS Mean(n = 3) 3.82 3.24 7.06 23.3 23.33 46.65 14.14 14.36 28.5 8.81 8.2 17.01 SD 0.29 0.66 0.94 1.87 2.01 3.86 0.41 2.06 2.44 0.87 0.75 1.61 % CV 8 20 13 8 9 8 3 14 9 10 9 9 % Recovery*2 98 100 99 102 109 105 100 100 100 Recovery from Plasma Control Plasma Add 0.8 ng/ml plasma Add 0.4 ng/ml plasma Add 0.2 ng/ml plasma Recovered (ng/ml) DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS Mean(n = 3) 0.23 0.13 0.35 0.57 0.57 1.15 0.4 0.33 0.72 0.31 0.22 0.52 SD 0.02 0.03 0.04 0.02 0.03 0.05 0.02 0.04 0.03 0.05 0.03 0.05 % CV 7 22 12 4 6 4 4 12 4 15 12 10 % Recovery*2 91 109 99 93 100 96 94 95 94 Recovery from Sputum Control Sputum Add 0.8 ng/ml Sputum Add 0.4 ng/ml Sputum Add 0.2 ng/ml Sputum Recovered (ng/ml) DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS DES IDS DES/IDS Mean(n = 3) 0.09 0.03 0.12 0.4 0.4 0.8 0.24 0.24 0.48 0.19 0.12 0.32 SD 0.01 0.01 0.01 0.06 0.05 0.09 0 0.04 0.04 0.04 0.02 0.01 % CV 13 42 7 15 11 11 0 18 9 18 18 4 % Recovery*2 81 94 87 84 104 93 101 95 99 *1) DES/IDS were spiked into control body fluids at three concentrations (expected ranges of detection). The samples were acid hydrolyzed (6N HCl at 110 C. for 24 hrs), chromatographed by SPE (CF1 column). After addition of the internal standard DES/IDS were measured by LC/MSMS and calculated for recovery. *2) More accurate % Recovery was obtained by integration of combined areas of DES/IDS. % Recovery of individual DES and IDS may varied by chromatographic separation.
(199) This proposed method was used to measure DES and IDS in urine, plasma, and sputum of a cohort of COPD patients as compared to their healthy controls (
(200) The degradation of elastin-containing tissues also occur in aorta.sup.44,64, skin.sup.43,65,66, and liver.sup.67, etc. The developed LC/MSMS analysis of DES/IDS can have wide application for investigating diseases which involve in those elastic tissues.
(201) In sum, we have developed a sensitive, reproducible, and practical method using tandem mass spectrometric LC/MSMS analysis to measure DES and IDS using acetylated pyridinoline as the internal standard. This procedure can serve as a standardized LC/MSMS method to measure DES and IDS in all relevant body fluids, which are important for the clinical assessment of elastin degradation in diseases. The developed method demonstrated increased DES/IDS levels in urine, plasma, and sputum samples of patients with COPD over healthy controls. This analytical method can be applied to investigate diseases which induce elastic tissue degradation in vivo.
Example 6The Effect of Second Hand Smoke Exposure on Markers of Elastin Degradation
(202) As set forth above, desmosine and isodesmosine (D/I) are two crosslinked pyridinoline amino acids specific to peptides produced from elastin degradation.sup.55. D/I have been measured by liquid chromatography tandem mass spectrometry (LC/MS/MS) in patients with COPD and found to be elevated as compared to normal controls. For the first time these peptides have been measured in subjects exposed to second hand smoke. Desmosine and isodesmosine were found to be statistically significantly elevated in patients exposed to second hand smoke as compared to normal controls.
(203) Materials/Methods
(204) Patients
(205) Two cohorts of subjects, Cohorts I and II, were studied. Cohort I had three sub-groups of subjects which were studied for the effect of SHS exposure on D/I levels. These subjects were part of an ongoing study to determine the effect of SHS exposure on hormonal constituents in females. All subjects completed a lifestyle and nutritional questionnaire that included a description of exposure to cigarette tobacco smoke. Subjects were divided into three groups, active smokers, passive smokers and non-exposed. Passive smokers were defined as anyone who has lived with or has been exposed to cigarette smoke on a daily basis, but were not smokers. Most subjects were exposed within the home.
(206) Active smokers were persons who were smoking daily. Exclusion criteria included several medical conditions including: congestive heart failure, myocardial infarction, cerebral vascular accident, asthma, bronchitis, emphysema, any malignancy; also subjects exposed to dyes (textiles, arts and crafts) on a regular basis. Subjects were initially screened as eligible by telephone and then came for a study visit. All patients were female between the ages of 18-50 yrs. with the majority of them in the late twenties and thirties. They were not taking hormonal contraceptives and were not pregnant at the time of the study.
(207) Cohort II was also subdivided into 3 groups of active smokers, passive smokers and non exposed in smaller numbers. Subjects were males and females between the ages of 22 and 69 years. They were recruited from a medical clinic in the Veteran's Administration Hospital where, after clinical evaluation, they were considered to be in normal health and were, or were not, exposed to cigarette smoke. Some subjects responded to an advertisement requesting participation in this study. Most subjects were exposed to second hand smoke in the occupational setting; i.e. bartenders, construction workers, office workers. All passive smoke exposures in Cohorts I and II were current and not past.
(208) The degree of second hand smoke exposure in Cohort I was determined from the volunteered histories given on a questionnaire. Subjects reported the number of individuals that smoked in the household, an estimation of the number of cigarettes each individual smoked per day and the period time the subject lived in the household. A number was calculated reflecting these variables. A score less than 2,000 was considered mild exposure; 2,000-10,000 moderate exposure and over 10,000 severe exposure. Mild, moderate and severe exposures were then used in the analysis.
(209) Such detailed information on the occupation and household environmental exposure was not available in Cohort II. The subjects of Cohort II indicated their occupation and that they were exposed to second hand smoke and were not actively smoking themselves.
(210) Chemicals
(211) Desmosine (D) and Isodesmosine (I) standard (mixed 50% D and 50% I) were purchased from Elastin Products Company (Owensville, Mich.), CF1 cellulose powders were from Whatman (Clifton, N.J.), and all other reagents were from Sigma (St. Louis, Mo.).
(212) Preparation of Blood Samples
(213) Plasma samples were obtained after centrifuging venous blood specimens with EDTA for 2,500 revolutions per minute for 15 min. Plasma samples were stored at 80 C. until used. 0.25 ml of serum and 0.25 mL of concentrated HCl (37%) were placed in a glass vial. After air in the sample was displaced with a stream of nitrogen, the sample was acid hydrolyzed at 110 C. for 24 hr. The hydrolysates were filtered and dried, the residue was dissolved in 2 mL of the mixed solution (n-butanol/acetic acid/water, 4:1:1 by volume). The sample solution was loaded onto a 3-mL CF1 cartridge. The CF1 cartridge was prepared by introducing 3.5 mL of the slurry of 5% CF1 cellulose powder in the mixed solution between two polypropylene frits. The cartridge was washed three times with 3 mL of the mixed solution, and the D and I adsorbed in the CF1 cartridge were eluted with 3 mL of water. The eluate was evaporated to dryness under vacuum at 45 C., and the residue was dissolved in 0.1 mL of HPLC mobile phase for LC/MS/MS analysis.
(214) Samples were processed and measured in duplicate, and the results were averaged. The mean recoveries of D/I and from 0.20 ng/ml plasma were 671 and 724%, respectively. Values in plasma were corrected for recovery losses.
(215) Measurement of Desmosine/Isodesmosine by LC/MS/MS Analysis
(216) The Thermoscientific TSQ Quantum Discovery tandem LC/MS/MS system was used for the analysis. HPLC column was a 1502 mm (3 m) Atlantis dc18 (Waters, Miss.). The mobile phase A is a solution containing 5 mM ammonium acetate and 7 mM heptafluorobutyric acid in water and the mobile phase B is a solution containing 5 mM ammonium acetate and 7 mM heptafluorobutyric acid in a acetonitrile/water (8:2 ratio). The flow rate of mobile phase is 0.2 ml/min and is programmed from mobile phase A 100% to 88% in 12 mins.
(217) Reaction ion monitoring (RIM) of the transition ions, m/z 526 to m/z 481+m/z 397, was used for the quantitative measurements of D and I. Between-run imprecision (% CV) at D/I levels of 0.10, and 0.20 ng/ml were 4.0% and 3.9% respectively.
(218) IRB approval has been obtained from IRB Georgetown University Medical Center (2006-132) and from Carl T. Hayden, VAMC (Robbins 003).
(219) Measurement of Cotinine by LC/MS/MS Analysis
(220) To indicate exposure to cigarette tobacco smoke, plasma cotinine, a metabolite of nicotine, was quantitated using LC/MS/MS (Applied Biosystem API-4000 or Thermoscientific TSQ Quantum Discovery) following extraction by a solvent (ethyl acetate) extraction. Internal standard (D.sub.3-cotinine) solution was added to subject samples and samples were vortexed and centrifuged. The supernatant was injected into the LC/MS/MS system. Cotinine was measured by monitoring the Q1/Q3 transition ions of cotinine at m/z 177 to 80 and D.sub.3-cotinine at m/z 180 to 80. Between-run imprecision (% CV) at cotinine levels of 33, 124, and 248 ng/ml were 7.2, 5.6, 3.6% respectively.
(221) Statistical Analysis
(222) A t-test adjusted for unequal variance was used to test the null hypothesis. The level of significance was 0.05. The p-values were calculated based on the summed values of D and I using the unpaired t-test (The used software is GraphPad Prism 4 (2)).
(223) Results
(224) Results for all three groups of non-exposed, exposed, and smokers in 98 subjects (Cohort I) are shown in
(225) Cohort II compared D/I plasma levels and levels of cotinine also in 22 subjects of non-exposed, exposed, and smokers. The study includes males as well as females and shows the D and I levels and cotinine levels in those subjects (
(226) Cotinine values for each of the cohorts are shown in
(227) Comparison of the mean levels of plasma D/I and cotinine in Cohorts I and II showed no statistically significant difference in D/I in the non-exposed group but statistically significant differences in the exposed and actively smoking groups (p=0.023 and p=0.004), respectively, for D/I but not statistically significant differences for cotinine for those groups respectively (p=0.350 and p=0.560).
(228) Among active smokers the levels of D/I were higher in Cohort II consistent with their higher pack/year histories.
(229) Discussion
(230) The United States EPA estimates that passive smoking accounts for roughly 3000 deaths in the United States secondary to lung cancer annually.sup.68. The impact of passive smoking on overall health is clearly recognized as an independent risk factor for diseases including the lung.sup.71.
(231) The levels of D and I in urine and plasma in COPD have been found to be consistently elevated in many studies by various analytical methods.sup.54,55. This raises the prospect that elevated levels of D/I induced by second hand smoke exposure become an indicator of risk to develop COPD in later life.
(232) As shown above, both cohorts of subjects demonstrate a statistically significant increase in plasma levels of D/I in subjects exposed to SHS none of whom had clinical symptoms of respiratory disease.
(233) Disclosed herein are the first reported measurements of the effect of second hand smoke exposure on elastin degradation in human subjects. This is a demonstration of a tissue matrix effect which may have special significance for lung structure. The further implication of increased elastin degradation of mature elastin is increased elastase activity in tissues and possibly an upgraded inflammatory state. The patients studied in all groups were not symptomatic. Neither group had any significant medical history or evidence of lung pathology. All had equivalent and average exercise tolerance. As is the case with the effects of direct smoke exposure which takes years before evidence of COPD is apparent, SHS smoke exposure may produce its effects decades later. The results also suggest that even mild passive smoke exposure could have deleterious effects on lung parenchyma, which if persistent long term may result in parenchymal inflammation and destruction resulting in COPD.
(234) The clinical significance of the findings in this study are still unclear. As mentioned earlier, patients with excessive, chronic second hand smoke exposure do suffer the sequalae of active smokers.sup.70. In patients with COPD, elastin fibers have been shown to be degraded and disorganized, and the content of lung elastin is low in such patients.sup.45,50. Also once elastin breakdown has occurred, the resulting peptides may promote further parenchymal destruction since they may be antigenic and chemotactic. The peptides are chemotactic for neutrophils and macrophages, resulting in a chronic inflammatory state which could induce further elastin degradation and possibly clinical sequelae in the long term.sup.51.
(235) The increase in levels of D/I in plasma of subjects undergoing SHS exposure raises the question of the mechanism for the increase. Since SHS enters via the respiratory tract the initial effect should be on lung cells and most notably neutrophils and macrophages which undergo stimulation with increased synthesis and secretion of elastases. This augmented activity of elastolysis then can effect degradation of elastin in any site in addition to the lung such as blood vessels and skin which would elevate plasma concentrations.
(236) D and I as biomarkers for COPD have been studied for some time.sup.55. With advances in technology and preparation of samples, they can be detected with greater sensitivity and specificity.sup.54. This is significant since the levels in plasma of patients exposed to second hand smoke may have been previously too low to detect. Plasma can be easily obtained from patients. In the past, 24 hr urine has been studied as a medium for D and I measurement. Though promising since there is an increase in free D and I levels in urine in active smokers and COPD patients, it is often difficult for the patient and the practitioner to accurately collect 24 hr urine.sup.54. If we are able to accurately and precisely detect increased levels in plasma it brings us possibly one step closer to a practical marker of elastin degradation and in effect one step closer to understanding and quantifying lung degradation.
(237) It would be clinically important to learn what happens to the levels of D and I over time in these individuals and whether the levels decrease if the patients are removed from passive smoke exposure, and if they are not removed if the levels continue to increase in response to increased elastin degradation. Menzies et al previously illustrated that when the inciting factor was removed; i.e. smoke in bars where they worked, the subjects rapidly returned to their previous state of health.sup.74. Such findings would suggest that the levels of D and I should decrease when second hand smoking is terminated. The clinical implications on lung function that this early degradation imposes are unclear. It is noteworthy that the levels of D and I, in passive smokers, were not as high as seen in patients with COPD or alpha-1 antitrypsin deficiency.sup.54. This finding is not surprising given the burden of disease in patients with COPD and alpha-1 as compared to our study population.
(238) Certain methodological limitations should be noted in this study. The data is reliant on an accurate recognition of second hand smoke exposure by our subjects through self-reporting. This is based on an extensive questionnaire characterizing their exposure to second hand smoke. In previous studies a good correlation between a person's perception of second hand smoke and the lab findings consistent with exposure to SHS has been shown.sup.73. The questions are very specific about who smokes in the home, how much, for how long, and how much time the subject spends within this environment. The questionnaire administered to all persons participating in this study included the same questions, therefore each study group was exposed to the same level of bias.
(239) Of interest is the measurement of cotinine levels. Previous studies have established a positive correlation between the level of SHS exposure and inflammatory cytokine elevation.sup.77,82. On average they were significantly elevated in subjects that self-reported SHS exposure when compared to subjects without any exposure. The drawback is that cotinine remains elevated only for short periods of time post exposure and correlations with presumed exposure may be weak.sup.83. This could explain why certain subjects have low cotinine levels.
(240) In the past, multiple studies illustrated that the levels of inflammatory cytokines, on average, are higher in males than females.sup.70,72,74. It is postulated that males are more sensitive to the inflammatory cytokines than females vs. a possibility of greater exposure in males than in females. It is noteworthy that second hand smokers in Cohort I, which was exclusively a female population of subjects, has lower levels of D/I for the cotinine level which was higher than that among passive smokers in Cohort II. This raises the possibility that females may be less susceptible to elastin degradation by exposure to tobacco smoke, a prospect which should be explored further.
(241) This study illustrates that second hand smoke exposure may be as dangerous and harmful as active smoking on tissue matrix injury and possibly lung parenchyma. This study demonstrates that D and I can be used to detect early changes of elastin degradation, before clinically significant symptoms occur, and possibly to indicate progression of the disease. Thus, D and I can serve as biomarkers of exposure. It would be significant to determine, if increased levels of D and I can be correlated with computed tomography (CT) findings of significant parenchymal destruction, before clinical symptoms occur. Overall having a tissue matrix component effected by second hand smoke and detectable by chemical analysis is a useful adjunct to evaluating clinical and physiological consequences of environmental smoke exposure.
Example 7Characterization of Peptide Fragments from Lung Elastin Degradation in Chronic Obstructive Pulmonary Disease
(242) As noted above, COPD is characterized by destruction of alveolar walls, obstruction of bronchioles, and trapping of air.sup.86,87. An early insight into the mechanisms leading to alveolar destruction in patients with pulmonary emphysema is that lung matrix elastin is a target for protease degradation by cellular elastases.sup.80,88,89.
(243) Lung elastin is a highly cross-linked insoluble protein formed by condensation of lysyl residues in the soluble precursor, tropoelastin (786 amino acids; Table 5), which can be degraded into soluble peptide fragments by the elastolytic enzymes produced by neutrophils and macrophages. Degradation of lung elastin occurs in COPD as well as in smoking subjects and has been investigated by measurement of 2 lysyl-derived cross-linked pyridinium molecules, desmosine and isodesmosine.sup.11,14,40,54,90, which only exist in elastin and have been shown to be useful biomarkers for lung elastin degradation in COPD patients.sup.54,55.
(244) TABLE-US-00009 TABLE5 HumanTropoelastinSequence(Swiss-ProtP15502)(SEQIDNO:1) MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGA 50 LGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAA 100 AAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVY 150 PGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQP 200 GVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGV 250 GPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGT 300 PAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGA 350 IPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVG 400 AGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAA 450 KYGAAGAGVLGGLVPGPQAAVPGVPGTGGVPGVGTPAAAAAKAAAKAAQF 500 GLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGP 550 GGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGL 600 GVGAGVPGFGAGADEGVRRSLSPELREGDPSSSQHLPSTPSSPRVPGALA 650 AAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQ 700 FGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGG 750 AGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKRK 786
(245) The degradation of cross-linked elastin by elastases results in elastin fragments of varying molecular weight and can be identified as elastin-derived peptides (EDPs). Immunologic detection of EDPs in body fluids in COPD patients and smokers has been studied, but provides little information with regard to their structural identities.sup.38,92,93. Extensive purifying and sequencing studies of elastin molecules in the elastic fibers in bovine ligament or aorta have been carried using various proteolytic enzymes.sup.33,94-100. However, the cross-linking domains and structure have not been fully characterized because of the protein's high degree of cross-linking and its insolubility. Using liquid chromatography/tandem mass spectrometry (LC/MSMS) analysis, Barroso et al..sup.100 reported the amino acid sequences in the peptide fragments produced by different proteolytic enzymes in vitro, but did not further study the detection of such peptides in body fluids. In the present application we utilize LC/MSMS analysis to characterize a full spectrum of EDPs obtained in vitro with 2 representative elastases, human neutrophil elastase (HNE) and macrophage metalloproteinase (MMP12), which have been involved clinically in lung elastin degradation.sup.7,101. We further demonstrate the detection of some of the characterized peptides in the body fluids of patients with COPD.
(246) The structural characterization of EDPs detected in patients can identify the enzymatic reactions leading to their formation and their possible role in pathogenesis. In addition, EDPs have been shown to play a role in cellular behavior within the extracellular matrix, such as chemotaxis for neutrophils and macrophages or tumor cells. Such factors may affect the progression of COPD or pulmonary metastasis once elastin degradation has occurred.sup.102-105. Antigenic autoimmune effects of EDPs in COPD patients have also been demonstrated.sup.106,107.
(247) Materials and Methods
(248) Materials
(249) Purified human lung elastin, bovine neck ligament elastin, human sputum neutrophil elastase (HNE), murine macrophage metalloproteinase (MMP12) were obtained from Elastin Products Company (Owensville, Miss.). Porcine pancreatic elastase (PPE) was purchased from Worthington (Lakewood, N.J.), and synthetic peptide standards were obtained from GenScript (Piscataway, N.J.).
(250) Patients Studied
(251) The 5 patients studied were selected at random from subjects with a diagnosis of COPD (Table 6). The diagnostic criteria conformed to those stated in the Global Criteria and Guidelines.sup.60. One of the 5 patients had 1-antitrypsin deficiency (AATD) of the ZZ phenotype. All had a strong smoking history from 30 to 79 pack-years but had stopped smoking approximately 3 years prior to this study. Four healthy control subjects were males, ages 35 to 85, in good health without respiratory symptoms or a history of smoking or exposure to second hand smoke.
(252) TABLE-US-00010 TABLE 6 Patients With Diagnosis of COPD Smoking FVC FEV.sub.1 RV/TLC DLCO history D/I Patients Age Gender Race % Pred % Pred % Pred % Pred (Pk-Yr) BMI (ng/mL) 1* 42 M C 70 23 34 64 79 30.4 0.52 2 68 F H 67 46 81 98 18 23.1 0.51 3 63 M C 74 46 59 59 50 22.1 0.32 4 82 F C 57 41 60 21.0 0.54 5 88 M C 99 68 65 54 30 23.6 0.66 Note. FVC % Pred = forced vital capacity % of predicted; FEV.sub.1% Pred = forced expiratory volume in 1 second % of predicted; RV/TLC % Pred = residual volume/total lung capacity % of predicted; BMI = body mass index; D/I = plasma levels of desmosine/isodesmosine; C = Caucasian; H = Hispanic. *Patient 1 has homozygous ZZ .sub.1-antitrypsin deficiency.
Elastase Digestion
(253) To determine EDPs produced by elastases in human lung, we digested human lung elastin by 2 representative elastolytic enzymes, human neutrophil elastase (HNE) isolated from human sputum.sup.108 and macrophage metalloproteinase (MMP12) isolated from mouse peritoneal lavage.sup.109, which has been shown to be a mouse orthologue of human alveolar macrophages metalloproteinase.sup.110,111.
(254) Human lung elastin (4 mg) was suspended in 1 mL of 0.1 M ammonium carbonate buffer, pH 7.8. The suspension was digested by addition of 0.1 mg HNE (875 U/mg) or 25 g MMP12 (37.5 U/mg) or 7 mg PPE (8 U/mg) and stirring at room temperature for 12 hours. After 12 hours the digestions were repeated for the second time by addition of another portion of fresh enzymes. The digested mixtures were fractionated into 3 fractions of molecular weight cut-off: (1)<10,000, (2) 10,000-50,000, (3) >50,000 Da using Centricon (Millipore, Mass.) membrane filtration tubes.
(255) Characterization of Peptides by LC/MSMS Analysis
(256) A TSQ Discovery electrospray tandem mass spectrometer (Thermo Electron) was used for both LC/MS and LC/MSMS analysis. High-performance liquid chromatography (HPLC) conditions involved the use of a Symmetry 1 mm5 cm dC18 (5 m) column (Waters, Milford, Mass.) and programming from a 5% acetonitrile/water (0.1% formic acid) to 50% acetonitrile/water (0.1% formic acid) for 50 minutes under a flow rate of 100 L/min. LC/MS analysis was carried out in positive ion mode with a spray voltage of 4,000 volts and an ion transfer tube temperature of 300 C. LC/MSMS analysis was performed by stepping up collision energy from 20 to 40 eV with the increase in the molecular weights from 500 to 1500 Da. The peptide sequences were assigned by searching their MS/MS spectra against the SwissProt database by either PEAK (Bioinformatics Solution, Waterloo, Canada) or MASCOT (Matrix Science, MA) software.
(257) Selected Reaction Monitoring (SRM) of EDPs in Body Fluids
(258) Plasma samples were obtained after centrifuging venous blood specimens at 2500 revolutions per minute for 25 minutes. Samples were stored at 20 C. until used. Sputum samples of COPD patients were collected from spontaneously produced sputum. All patients gave informed consent for the study, and the study was approved by the institutional review board.
(259) One milliliter of plasma or sputum from selected COPD patients were filtered by a Centricon membrane to obtain molecular weight cut-off fractions of <10,000 Da. One transition ion (the most abundant CID ion) was selected from each characterized EDP, and they were searched for the presence of the corresponding EDPs in the LC/MSMS spectra obtained from body fluids of COPD patients. Four synthetic peptides, GYPI (SEQ ID NO:5), APGVGV (SEQ ID NO:4), GLGAFPA (SEQ ID NO:11), and VGVLPGVPT (SEQ ID NO:16), were used for structural confirmation and as external standards for the SRM quantitation.
(260) Results
(261) Identification of Lung Elastin-Derived Peptides (EDPs) Produced by Neutrophil and Macrophage Metalloproteinase Digestions
(262) Samples of human lung elastin were digested by HNE and MMP12. The digested peptide mixtures were separated into 3 molecular weight cut-off fractions: (1) smaller than 10,000, (2) between 10,000 and 50,000, and (3) larger than 50,000 Da. LC/MS analysis of the peptide fractions indicated that a large portion of soluble EDPs was isolated in fraction 1 (<10,000 Da). Fraction 2 (10,000-50,000 Da) contained essentially the same peptides as that of the fraction 1 but in significantly lower concentration. Fraction 3 (>50,000 Da) contained mostly the undigested solid elastin. Therefore, fraction 1 (<10,000 Da) appears to constitute all major soluble EDPs produced by HNE or MMP12 digestion of lung elastin, as shown in
(263) TABLE-US-00011 TABLE7 HumanLungEDPs(<10,000da)byHNEDigestion Positionsin HPLC LC/MS Aminoacid tropoelastin Peptides (min) (m/z) sequence (P15002) 1 2.2 444 LGVGV 582-586 2 3.4 444 GGIPT 392-386 3 3.7 499 APGVGV 509-514 515-520 527-532 533-538 539-544 4 12.3 449 GYPI 205-208 5 13.3 520 VTFPG 85-89 6 15.5 598 GIPGGVV 675-681 7 16.0 866 APGIGPGGVAA 545-555 8 17.7 598 GVPGLGV 587-593 596-605 9 18.0 572 GLGGLGV 708-714 10 18.1 632 GLGAFPA 78-84 11 18.1 763 GGIPTYGV 392-399 12 18.9 726 GAGVPGLGV 594-602 13 19.3 643 AGLGGLGV 707-714 14 20.1 771 GAAGLGGLGV 705-714 15 21.5 838 VGVLPGVPT 163-171 16 21.6 754 GVGVPGLGV 585-593 17 22.1 543* AARPGFGLSPI 760-770 18 23.9 930 GLGAGLGAFPA 74-84 19 24.4 865 GAGGFPGFGV 400-409 20 26.4 1209 GLVPGGPGFGPGVV 321-334 21 26.9 779* GVPGAGVPGVGVPG 335-353 AGIPV 22 27.8 1139 FPGVGVLPGVPT 160-171 23 39.8 731* GVGVPGLGVGAGVP 585-602 GLGV 24 30.8 728* GLGGVLGGAGQFPL 743-759 GGV *Doubly charged ion.
Peptides 1-24 in Table 7 above correspond to SEQ ID NOS:2-25).
(264) TABLE-US-00012 TABLE8 HumanLungEDPs(<10,000da)byMMP12Digestion TABLE4HumanLungEDPs(<10,000da)byMMP12Digestion Amino PositionsIn Positionsin HPLC LC/MS acid tropoelastin HPLC LC/MS Aminoacid tropoelastin Peptides (min) (m/z) sequence (P5002) Peptides (min) (m/z) sequence (P5002) 1 1.5 499 VAPGVG 506-511 9 11.2 476 FPGVG 160-164 512-517 518-523 530-535 536-541 542-547 2 2.2 556 VGAGVPG 593-599 10 13.5 726 LGVGAGVPG 591-599 602-608 600-608 3 2.7 513 LAPGVG 526-531 11 15.1 591 VTFPGA 85-90 4 3.5 596 LVPGGPG 322-327 12 15.2 575 LGAFPA 79-84 5 7.5 655 VGVAPGVG 506-513 13 17.0 543* VYPGGVLPGAR 149-159 512-519 519-525 530-537 536-543 6 8.5 584 VGVGVPG 584-590 14 18.2 858 VYPGGVLPG 149-157 7 9.5 541 LVPGVG 502-507 15 21.0 859 FGVGVGGIP 407-416 8 10.7 584 LGAGPG 575-581 16 23.7 925 LGVGVGVPGLG 582-592 *Doubly charged ion.
Peptides 1-16 in Table 8 above correspond to SEQ ID NOS:26-41).
(265) The peptides are rich in nonpolar amino acids, especially G, V, P, A, L, or I, including 2 hexapeptides, APGVGV (SEQ ID NO:4) and VAPGVG (SEQ ID NO:26), and an octapeptide, VGVAPGVG (SEQ ID NO:30), derived from the characteristic elastic repeats (positions 506 to 547; see Table 5) of the hydrophobic domain in tropoelastin.sup.84,114,115.
(266) Detection of Lung EDPs in Body Fluids of COPD
(267) Using the SRM of LC/MSMS analysis (see Materials and Methods), the transition ions derived from the 24 EDPs characteristically produced by HNE digestion and the 16 EDPs characteristically produced by MMP12 digestion were used to search for their presence in plasma or sputum obtained from COPD patients. Five patients were selected at random from subjects diagnosed with COPD. The results showed that 3 or 4 peptides, GYPI (NO: 5), APGVGV (SEQ ID NO:4), GLGAFPA (SEQ ID NO:11), and VGVLPGVPT (SEQ ID NO:16), were present in plasma or sputum from 2 COPD patients (patients 1 and 2), but not in 3 other COPD patients and 4 normal controls (Table 9). The identities and quantities of the detected peptides were determined by comparison with the synthetic peptides. The SRM is highly sensitive and specific with a limit of detection, 0.01 ng of peptide present in 1 mL of plasma.
(268) TABLE-US-00013 TABLE9 LungEDPsDetectedinCOPDPatients GYPI APGVGV GLGAFPA VGVLPGVPT Patients 1 Plasma 0.14 0.11 0.48 0.10 Sputum X* X 1.01 X 2 Plasma 0.02 X 1.44 0.04 Sputum X X X X 3 Plasma X X X X 4 Plasma X X X X 5 Plasma X X X X Normalsubjects 1 Plasma X X X X 2 Plasma X X X X 3 Plasma X X X X 4 Plasma X X X X
Hexapeptides APGVGV, VAPGVG, and VGVAPG from the Elastin Repeats
(269) Several EDPs such as the hexapeptide VGVAPG (SEQ ID NO:42), which has been isolated from bovine ligament elastin by porcine pancreatic elastase (PPE) digestion, have been actively studied as chemoattractants for neutrophils and macrophages.sup.116. However, our LC/MS studies show that the hexapeptide APGVGV (SEQ ID NO:4) is formed by HNE and VAPGVG (SEQ ID NO:26) by MMP12 digestion, with no detection of VGVAPG. We have extended our LC/MSMS analysis to EDPs obtained with the PPE digestions on both lung elastin and bovine ligament elastin. The PPE digestions resulted in characterization of 12 EDPs from Lung elastin (Table 10) and 21 EDPs from ligament elastin (Table 11), and it was found that VGVAPG was exclusively formed by PPE digestion or from digestion of ligament elastin (
(270) TABLE-US-00014 TABLE10 HumanLungEDPs(<10,000Da)byPPEDigestion Positionsin HPLC LC/MS Aminoacid tropoelastin Peptides (min) (m/z) sequence (P15002) 1 2.6 499 VGVAPG 506-511 512-517 518-523 530-535 536-541 542-547 2 4.5 442 VGLPG 144-148 3 8.4 456 AGIPV 349-353 4 9.4 449 GYPI 205-208 5 10.7 419 VGPF 192-195 6 16.2 912 VGPFGGLPQPG 192-201 7 18.0 563 QFGLV 499-503 700-704 8 18.6 786 GPGFGPGVV 326-334 9 21.6 633 FGLSPI 765-770 10 21.6 1011 GLVPGGPGFGPG 321-332 11 24.0 737 GGFPGFGV 402-409 12 26.1 1209 GLVPGGPGFGPGVV 321-334
Peptides 1-12 in Table 10 correspond to SEQ ID NOS:42-53.
(271) TABLE-US-00015 TABLE11 BovineLigamentEDPs(<10,000Da) byPPEDigestion Positionsin HPLC LC/MS Aminoacid tropoelastin Peptides (min) (m/z) sequence (P04985) 1 2.4 702 GGVGDLGGA 619-627 2 2.6 499 VGVAPG 503-508 521-526 3 3.9 442 VGLPG 153-157 4 5.8 449 GGLVPG 5 7.6 473 AGLGGV 692-697 6 9.0 449 GYPI 216-219 7 10.3 419 VGPF 203-206 8 11.5 681 PGVGVVPG 507-514 513-520 9 13.0 499 PGLGVG 566-571 575-580 584-589 10 13.4 852 GGQQPGVPL 207-215 11 14.5 490 FPGIG 171-175 429-433 12 16.7 433 FPGI 171-174 FPGI 429-432 13 17.9 591 GGIPTF 417-422 14 17.9 804 GFPGIGDAA 428-436 15 19.6 658 GQPFPI 701-706 16 20.9 1139 VGPFGGQQPGVP 203-214 17 22.5 845 FPGAGLGGLG 43-52 18 24.8 856 FPGIGVLPG 171-179 19 24.8 1252 VGPFGGQQPGVPL 203-215 20 26.5 751 GVFFPGAG 40-47 21 26.5 694 VFFPGA 41-47
Peptides 1-21 in Table 11 correspond to SEQ ID NOS:54-74.
Discussion
(272) In this study enzymatic digestion of human lung elastin by 2 key enzymes, human neutrophil elastase (HNE) and macrophage metalloproteinase (MMP12), resulted in identification of 24 EDPs from HNE (Table 7) and 16 EDPs from MMP12 (Table 8). The 40 EDPs we have characterized by LC/MSMS analysis appear to represent all major soluble EDPs produced by the HNE and MMP12 digestions of elastin in vitro. The peptides are rich in nonpolar amino acids, especially G, V, P, A, L, or I, from the hydrophobic elastic domain in tropoelastin. Among them, the hexapeptides APGVGV (SEQ ID NO:4), and VAPGVG (SEQ ID NO:26) and the octapeptide VGVAPGVG (SEQ ID NO:30) are derived from the characteristic hydrophobic elastic repeats (positions 506 to 547; Table 5). Tropoelastin consists of alternating repetitive hydrophobic domains of variable length (the elastic repeats) and the alanine-rich lysine-containing domain that form cross-links.sup.114,115. A model of the elastic property of the elastin matrix proposes that hydrophobic interactions of the 3-spiral elastic repeats are exposed to an aqueous environment to stabilize the folded protein structure.sup.117-119. The spectrum of EDPs we have characterized suggests that both HNE and MMP12 degradations occur primarily at the site of the hydrophobic elastic repeat domain and result in disintegration of the stable protein structure of elastin.
(273) Recent progress in proteomic LC/MSMS analysis has become an effective approach to characterize protein molecules as biomarkers involved in disease. This study represents the first effort to determine peptide fragments from enzymatic degradations in biological fluids in COPD patients. The 40 EDPs we have characterized by LC/MSMS analysis results from the 2 major elastases involved in elastin degradation in COPD. We believe these EDPs represent all the major soluble EDPs produced by HNE and MMP12 digestions. However, the amino acid sequences produced in our study differ from the sequences produced in the study reported by Barroso et al..sup.100. This may be a consequence of a difference in the enzymes used or a difference in the conditions of digestion.
(274) We used the 40 characterized EDPs to search for biomarkers of lung elastin degradation in body fluids obtained from COPD patients. Our preliminary screening of some selected COPD patients have shown that 4 EDPs, GYPI (SEQ ID NO: 5), APGVGV (SEQ ID NO:4), GLGAFPA (SEQ ID NO:11), and VGVLPGVPT (SEQ ID NO:16), were present in plasma or sputum of 2 COPD patients but not in 3 other COPD subjects or healthy controls (Table 9). Two patients (patients 1 and 2) with detectable levels of EDPs have more advanced disease clinically and physiologically. Patient 1 with AATD had evidence of emphysematous destruction on chest x-ray and computed tomography (CT) as did patient 2. The 3 other subjects with undetectable levels of EDPs had mild or little evidence of emphysematous destruction on chest x-ray or CT. All of the detected peptides were among those identified from HNE digestions in vitro, suggesting that this was the active enzyme producing the elastin degradation in vivo in these patients, an observation especially relevant to the patients with AATD. Further study is needed to determine whether the presence of multiple peptides as shown here can be related to the severity of emphysematous destruction by CT. Such studies are planned along with further evaluation of the chemotactic and antigenic potential of the detected peptides. The possible reasons for not detecting EDPs in all patients include (1) levels too low for detection by our mass spectrometry analysis; (2) in vivo intermittent production of such peptides depending upon varying pathological factors; and (3) varying phenotypes of disease in COPD related to causative factors and the host responses. Further study in COPD patients may clarify the basis of these variable results.
(275) The EDPs represented by the hexapeptide VGVAPG (SEQ ID NO:42) isolated from ligamentum nuchae or aorta of animals by porcine pancreatic elastase (PPE) have been shown to be chemoattractants for neutrophils and macrophages, and thus initiators of possible pathogenic consequences of elastin degradation.sup.102-105,120. Also, VGVAPG has been reported to induce pro-MMP1 and pro-MMP3 upregulation.sup.121. However, our study with human elastin showed that the hexapeptides APGVGV (SEQ ID NO: 4) and VAPGVG (SEQ ID NO:26) were formed by degradation with human neutrophil elastase (HNE) and macrophage metalloproteinase (MMP12), The hexapeptide VGVAPG (SEQ ID NO:42) could not be detected by the digestion of lung elastin by either HNE or MMP12. VGVAPG (SEQ ID NO:42) was only formed either by the PPE digestion or formed by the digestion of ligamentum nuchae (
(276) In sum, we utilized proteomic LC/MSMS analysis to characterize the full spectrum of peptides that can be produced by 2 major elastases (neutrophil elastase and macrophage metalloproteinase) in vitro from human lung elastin. These characterized elastin peptides were searched for and several were detected in plasma and sputum in COPD patients. Such elastin peptides were not detected in normal subjects. The detection in vivo of these elastin peptides in COPD patients appears to be varied, which might be a reflection of variable pathogenic processes in COPD. This study demonstrates the feasibility of detecting these elastin peptides in body fluids and relating them to clinical, physiological, and radiological characteristics of COPD and makes possible further study for their pathogenic potential.
(277) All documents cited herein are hereby incorporated by reference as if recited in full herein.
CITED DOCUMENTS
(278) 1. Barnes P J, Shapiro S D, Pauwels R A (2003) Chronic obstructive pulmonary disease: molecular and cellular mechanisms. Eur Respir J 22:672-678. 2. Shapiro S D (2002) Proteinases in chronic obstructive pulmonary disease. Biochem Soc Trans 30:98-102. 3. Owen C A (2008) Roles for proteinases in the pathogenesis of chronic obstructive pulmonary disease. Int J Chron Obstruct Pulmon Dis 3:253-268. 4. Djekic U V, Gaggar A, Weathington N M (2009) Attacking the multi-tiered proteolytic pathology of COPD: new insights from basic and translational studies. Pharmacol Ther 121:132-146. 5. Celli B R (2000) The importance of spirometry in COPD and asthma: effect on approach to management. Chest 117 (2 Suppl): 357 15S-19S. 6. Newell J D, Hogg J C, Snider G L (2004) Report of a workshop: quantitative computed tomography scanning in longitudinal studies of emphysema. Eur Respir J 23:769-775. 7. Nakano Y, Muller N L, King G G, Niimi A, Kalloger S E, Mishima M, Pare P D (2002) Quantitative assessment of airway remodeling using high-resolution C T. Chest 122:271S-275S. 8. Barnes P J (2004) Mediators of chronic obstructive pulmonary disease. Pharmacol Rev 56:515-548. 9. Tzortzaki E G, Lambiri I, Vlachaki E, Siafakas N M (2007) Bio-markers in COPD. Curr Med Chem 14:1037-1048. 10. Ma S, Lin Y Y, Tartell L, Turino G M (2009) The effect of tiotropium therapy on markers of elastin degradation in COPD. Respir Res 10:12. 11. Ma S, Lieberman S, Turino G M, Lin Y Y (2003) The detection and quantitation of free DID in human urine and their peptide-bound forms in sputum. Proc Natl Acad Sci USA 100: 12941-12943. 12. Boschetto P, Quintavalle S, Zeni E, Leprotti S, Potena A, Ballerin L, Papi A, Palladini G, Luisetti M, Annovazzi L, ladorola P, De Rosa E, Fabbri L M, Mapp C E (2006) Association between markers of emphysema and more severe chronic obstructive pulmonary disease. Thorax 61:1037-1042. 13. Fiorenza D, Viglio S, Lupi A, Baccheschi J, Tinelli C, Trisolini R, Iadarola R, Luisetti M, Snider G L (2002) Urinary desmosine excretion in acute exacerbations of COPD: a preliminary report. Respir Med 96:110-114. 14. Viglio S, ladorola P, Lupi A, Trisolini R, Tinelli C, Balbi B, Grassi V, Worlitzsch D, Doring G, Meloni F, Meyer K C, Dowson L, Hill S L, Stockley R A, Luisetti M (2000) MEKC of DID in urine of chronic destructive lung disease patients. Eur Respir J 388 15:1039-1045. 15. Cantor J O, Cerreta J M, Ochoa M, Ma S, Chow T, Grunig G, Turino G M (2005) Aerosolized hyaluronan limits airspace enlargement in a mouse model of cigarette smoke-induced pulmonary emphysema. Exp Lung Res 31:417-430. 16. Dunnill M S (1962) Quantitative methods in the study of pulmonary pathology. Thorax 17:320-328. 17. Mascarenhas M M, Day R M, Ochoa C D, Choi W I, Yu L, Ouyang B, Garg H G, Hales C A, Quinn D A (2004) Low molecular weight hyaluronan from stretched lung enhances interleukin-8 expression. Am J Respir Cell Mol Biol 30:51-60. 18. McKee C M, Penno M B, Cowman M, Burdick M D, Streiter R M, Bao C, Noble P W (1996) Hyaluronan (HA) fragments induce chemokine gene expression in alveolar macrophages. The role of HA size and CD44. J Clin Invest 98:2403-2413. 19. Cantor J O, Cerreta J M, Armand G, Keller S, Turino G M (1993) Pulmonary air-space enlargement induced by intratracheal instillment of hyaluronidase and concomitant exposure to 60% oxygen. Exp Lung Res 19:177-192. 20. Cantor J O, Cerreta J M, Keller S, Turino G M (1995) Modulation of airspace enlargement in elastase-induced emphysema by intratracheal instillment of hyaluronidase and hyaluronic acid. Exp Lung Res 21:423-436. 21. Murakami H, Yoshida M, Aritomi T, Shiraishi M, Ishibashi M, Watanabe K (1998) Effects of hyaluronidase on porcine pancreatic elastase-induced lung injury. J Jpn Respir Soc 36:577-584. 22. Cantor J O, Shteyngart B, Cerreta J M, Armand G, Liu M, Turino G M (2000) The effect of hyaluronan on elastic fiber injury in vitro and elastase-induced airspace enlargement in vivo. Proc Soc Exp Biol Med 225:65-71. 23. Cantor J O, Cerreta J M, Armand G, Turino G M (1998) Aerosolized hyaluronic acid decreases alveolar injury induced by human neutrophil elastase. Proc Soc Exp Biol Med 217:471-475. 24. Cantor J O, Cerreta J M, Armand G, Turino G M (1997) Further investigation of the use of intratracheally administered hyaluronic acid to ameliorate elastase-induced emphysema. Exp Lung Res 23(3):229-244. 25. Baccarani-Contri M, Vincenzi D, Cicchetti F, Mori G, Pasquali-Ronchetti I (1990) Immunocytochemical localization of proteoglycans within normal elastin fibers. Eur J Cell Biol 53:305-312. 26. Scott J E, Cummings C, Brass A, Chen Y (1991) Secondary and tertiary structures of hyaluronan in aqueous solution, investigated by rotary shadowing-electron microscopy and computer simulation. Hyaluronan is a very efficient network-forming polymer. Biochem J 274 (Pt 3):699-705. 27. Nadkarni P P, Kulkarni G S, Cerreta J M, Ma S, Cantor J O (2005) Dichotomous effect of aerosolized hyaluronan in a hamster model of endotoxin-induced lung injury. Exp Lung Res 31:807-818. 28. Cocci F, Miniati M, Monti S, Cavarra E, Gambelli F, Battolla L, Lucattelli M, Lungarella G (2002) Urinary desmosine excretion is inversely correlated with the extent of emphysema in patients with chronic obstructive pulmonary disease. Int J Biochem Cell Biol 34:594-604. 29. Comhair S A, Erzurum S C (2002) Antioxidant responses to oxidant-mediated lung diseases. Am J Physiol Lung Cell Mol Physiol 283:L246-L255. 30. Baskaran S, Lakshmi S, Prasad P R (1999) Effect of cigarette smoke on lipid peroxidation and antioxidant enzymes in albino rat. Indian J Exp Biol 37:1196-2000. 31. Wurzel H, Yeh C C, Gairola C, Chow C K (1996) Oxidative damage and antioxidant status in the lungs and bronchoalveolar lavage fluid of rats exposed chronically to cigarette smoke. J Biochem Toxicol 10:11-17. 32. Wright J L, Churg A (1995) Smoke-induced emphysema in guinea pigs is associated with morphometric evidence of collagen breakdown and repair. Am J Physiol Lung Cell Mol Physiol 12:17-20. 33. Thomas J, Elsden D F, Partridge S M. Degradation products from elastin: Partial structure of two major degradation products from the cross-linkages in elastin. Nature 1963; 200:651-2. 34. Shimada W, Bowman A, Davis N R, Anwar R A. An approach to the study of the structure of desmosine and isodesmosine containing peptides isolated from the elastase digest of elastin. Biochem Biophys Res Commun 1969; 37:191-7. 35. Akagawa M, Suyama K. Mechanism of formation of elastin crosslinks. Connect Tissue Res 2000; 41:131-41. 36. Sandberg L B. Elastin structure in health and disease. Int Rev Connect Tissue Res 1978; 7:159-210. 37. Rosenbloom J. Elastin: Biosynthesis, structure, degradation and role in disease processes. Connect Tissue Res 1982; 10:73-91. 38. Schriver E E, Davidson J M, Sutcliffe M C, Swindell B B, Bernard G R. Comparison of elastin peptide concentrations in body-fluids from healthy-volunteers, smokers, and patients with chronic obstructive pulmonary-disease. Am Rev Respir Dis 1992; 145:762-6. 39. Tenholder M F, Rajagopal K R, Phillips Y Y, Dillard T A, Bennett L L, Mundie T G, Tellis C J. Urinary desmosine excretion as a marker of lung injury in the adult respiratory distress syndrome. Chest 1991; 100:1385-1390. 40. Stone P J, Gottlieb D J, O'Connor G T, Ciccolella D E, Breuer R, Bryan-Rhadfi J, et al. Elastin and collagen degradation products in urine of smokers with and without chronic obstructive pulmonary disease. Am J Respir Crit Care Med 1995; 151:952-9. 41. Stone P J, Konstan M W, Berger M, Dorkin H L, Franzblau C, Snider G L. Elastin and collagen degradation products in urine of patients with cystic fibrosis. Am J Respir Crit Care Med 1995; 152:157-62. 42. Bode D C, Pagani E D, Cumiskey W R, von Roemeling R, Hamel L, Silver P J. Comparison of urinary desmosine excretion in patients with chronic obstructive pulmonary disease or cystic fibrosis. Pulm Pharmacol Ther 2000; 13:175-80. 43. Schwartz E, Cruickshank F A, Lebwohl M. Determination of desmosines in elastin-related skin disorders by isocratic high-performance liquid chromatography. Exp Mol Pathol 1990; 52:63-8. 44. Watanabe M, Sawai T. Alteration of cross-linking amino acids of elastin in human aorta in association with dissecting aneurysm: Analysis using high performance liquid chromatography. Tohoku J Exp Med 1999; 187: 291-303. 45. Wright R R. Elastic tissue of normal and emphysematous lungsa tridimensional histologic study. Am J Pathol 1961; 39:355-67. 46. Yoshida T, Tuder R M. Pathobiology of cigarette smoke-induced chronic obstructive pulmonary disease. Physiol Rev 2007; 87:1047-82. 47. King G S, Mohan V S, Starcher B C, Radioimmunoassay for desmosine. Connect Tissue Res 1980; 7:263-7. 48. Harel S, Janoff A, Yu S Y, Hurewitz A, Bergofsky E H. Desmosine radioimmunoassay for measuring elastin degradation in vivo. Am Rev Respir Dis 1980:122:769-73. 49. Stone P J, Bryanrhadfi J, Lucey E C, Ciccolella D E, Crombie G, Faris B, et al. Measurement of urinary desmosine by isotope-dilution and high-performance liquid-chromatographycorrelation between elastase-induced air-space enlargement in the hamster and elevation of urinary desmosine. Am Rev Respir Dis 1991; 144:284-90. 50. Cumiskey W R, Pagani E D, Bode D C. Enrichment and analysis of desmosine and isodesmosine in biological fluids. J Chromatogr B 1995; 668:199-207. 51. Chen J R, Takahashi M, Kushida K, Suzuki M, Suzuki K, Horiuchi K, Nagano A. Direct detection of crosslinks of collagen and elastin in the hydrolysates of human yellow ligament using single-column high performance liquid chromatography. Anal Biochem 2000; 278:99-105. 52. Giummelly P, Botton P, Friot R, Prima-Putra D, Atkinson J. Measurement of desmosine and isodesmosine by capillary zone electrophoresis. J Chromatogr 1995; 710:357-60. 53. Viglio S, Zanaboni G, Luisetti M, Trisolini R, Grimm R, Cetta G, Iadarola P. Micellar electrokinetic chromatography for the determination of urinary desmosine and isodesmosine in patients affected by chronic obstructive pulmonary disease. J Chromatogr B 1998; 714:87-98. 54. Ma S, Lin Y Y, Turino G M. Measurements of desmosine and isodesmosine by mass spectrometry in COPD. Chest 2007; 131:1363-71. 55. Luisetti M, Ma S, Iadarola P, Stone P J, Viglio S, Casado B, et al. Desmosine as a biomarker of elastin degradation in COPD: Current status and future directions. Eur Respir J 2008; 32:1146-57. 56. Kaga N, Soma S, Fujimura T, Seyama K, Fukuchi Y, Murayama K. Quantification of elastin crosslinking amino acids, desmosine and isodesmosine, in hydrolysates of rat lung by ion-pair liquid chromatography-mass spectrometry. Anal Biochem 2003; 318:25-9. 57. Boutin M, Berthelette C, Gervais F G, Scholand M B, Hoidal J, Leppert M F, et al. High-sensitivity nanoLC-MS/MS analysis of urinary desmosine and isodesmosine. Anal Chem 2009; 81:1881-7. 58. Albarbarawi O, Barton A, Lin Z, Takahashi E, Buddharaju A, Brady J, et al. Measurement of urinary total desmosine and isodesmosine using isotope-dilution liquid chromatography-tandem mass spectrometry. Anal Chem 2010; 82:3745-50. 59. Desmosine and Isodesmosine analysis as possible biomarkers for COPD has been among the topics of two recent FDA workshops (2009 and 2010 at Bethesda): a) Turino G M, Lin Y Y. Desmosine and isodesmosine as biomarkers of elastin degradation in COPD and Alpha-1 antitrypsin deficiency. FDA Study Group on Improving Endpoints, Improving Care: Alpha-1 Antitrypsin Augmentation Therapy and Clinical Trials Center for Biologics Evaluation and Research, FDA, Bethesda, Md. March 23-24, (2009); b) Svartengren M, Anderson M, Hallberg, Pedersen N (Karolinska Institutet Stockholm); Wollmer P (Clinical Physiology Malm University Hospital, Malm Sweden); Dirksen A, Shaker S (Gentofte University Hospital, Hellerup, Denmark); Lindberg C, Forsman-Semb K, Lloyd A (Astra-Zeneca Respiratory and Inflammation Clinical and Discovery Groups); Turino G M, Lin Y Y (James P. Mara Center for Lung Disease, St. Luke's-Roosevelt Hospital Centre); Kilty I, Thompson N, Palmer C (Pfizer), Gervais F, Boutinn, et al. (Merck & Co). Study Group on Desmosine and Isodesmosine as Biomarkers for COPD FDA, Bethesda, Md., January 26-27 (2010). 60. Pauwels R A, Buist A S, Calverley P M R, Jenkins C R, Hurd S S. Global strategy for the diagnosis, management, and prevention of chronic obstructive pulmonary disease. NHLBI/WHO global initiative for Chronic Obstructive Lung Disease (GOLD) workshop summary. Am J Respir Crit Care Med 2001; 163:1256-76. 61. Pratt D A, Daniloff Y, Duncan A, Robinson S P, Automated analysis of the pyridinium crosslinks of collagen in tissue and urine using solid-phase extraction and reversed-phase high-performance liquid chromatography. Anal Biochem 1992; 207:168-175. 62. James I T, Walne A J, Perrett D. Automated solid-phase extraction with high-performance liquid chromatography analysis of pyridinium crosslinks. Anal Biochem 1996; 240:29-36. 63. Kindt E, Rossi D T, Gueneva-Boucheva K, Hallak H. Quantitative method for biomarkers of collagen degradation using liquid chromatography tandem mass spectrometry. Anal Biochem 2000; 283:71-6. 64. Abraham P A, Perejda A J, Carnes W H, Uitto J. Marfan syndrome: Demonstration of abnormal elastin in aorta. J Clin Invest 1982; 70:1245-52. 65. Stone P J, Korn J H, North H, Lally E V, Miller L C, Tucker L B, et al. Cross-linked elastin and collagen degradation products in the urine of patients with scleroderma. Arthritis Rheumatism 1995; 38:517-24. 66. Annovazzi L, Viglio S, Gheduzzi D, Pasquali-Ronchetti I, Zanone C, Getta G, Ladarola P. High level of desmosine in urine and plasma of patients with pseudoxanthoma elasticum. Europ J Clin Invest 2004; 34:156-64. 67. Stone P J. Potential use of collagen and elastin degradation markers for monitoring liver fibrosis I schistosomiasis. Acta Trop 2000; 77:97-9. 68. World Health Organization fact sheet No. 315, November 2009 (www.who.int/mediacentre/factsheets/fs315/en/). 69. Barnes P J. Chronic Obstructive Pulmonary Disease. New England J of Med 2000; 343(4): 269-280. 70. Flouris A D, Metsios G S, Carrillo A E, Jamurtas A Z et al. Acute and short-term effects of secondhand smoke on lung function and cytokine production. Am J Respir Crit Care Me 2009; 179:1029-1033. 71. World Health OrganizationEnvironmental burden of disease series No. 18 (2010): Second Hand Smoke (www.who.int/quantifying_ehimpacts/publications/ebd18/en/). 72. Iso H, Shimamoto T, Sato S et al. Passive smoking and plasma fibrinogen concentrations. Am J of Epidemiology 1996; 144:1151-1154. 73. Clark III J D, Wilkinson J D, LeBlanc W G et al. Inflammatory markers and secondhand tobacco smoke exposure among U.S. workers. Am J of Industrial Medicine 2008; 51:626-632. 74. Panagiotakos D B, Ptsavos C, Chrysohoou C et al. Effect of exposure to secondhand smoke on markers of inflammation: the ATTICA study. Am J of Med 2004; 116: 145-150. 75. Menzies D, Nair A, Williamson P A, Schembri S et al. Respiratory symptoms, pulmonary function, and markers of inflammation among bar workers before and after a legislative ban on smoking in public places. JAMA; 296:1742-1748. 76. Otsuka R, Watanabe H, Hirata K, Tokai K et al. Acute effects of passive smoking on the coronary circulation in healthy young adults. JAMA 2001; 286:436-441. 77. Whincup P H, Gilg J A, Emberson J R, Jarvis M J et al. Passive smoking and risk of coronary heart disease and stroke: prospective study with cotinine measurement. BMJ 2004; 10:1-6. 78. Benowitz N L. Cotinine as a biomarker of environmental tobacco smoke exposure. Epidemiol Rev 1996; 18:188-204. 79. Senior R M, Betsuyaku T. Lung elastin and elastase in COPD. Eur Resp Rev 2002; 12. 80. Chrzanowski P, Keller S, Cerreta J, et al. Elastin content of normal and emphysematous lung parenchyma. Am. J Med 1980; 69: 351-359. 81. Senior R M, Griffen G L, Mecham R P. Chemotactic activity of elastin-derived peptides. J Clin Invest 1980; 66:859-862. 82. Venn A, Britton J. Exposure to secondhand smoke and biomarkers of cardiovascular disease risk in never-smoking adults. Circulation 2007; 990-995. 83. Hiroshi Y, Horiuchi K, Takano R, Nagano T, Shimizu M, Kitajima M, Murayama N and Shono F: Human blood concentrations of cotinine, a biomonitoring marker for tobacco smoke, extrapolated from nicotine metabolism in rats and humans and physiologically based pharmacokinetic modeling. Int J Environ Res Public Health 2010:7:3406-21. 84. Sandberg L B, Soskel N T, Leslie J G: Elastin structure, biosynthesis, and relation to disease states. N Engl J Med. 1981; 304:566-579. 85. Hogg J C, Timens W: The pathology of chronic obstructive pulmonary disease. Ann Rev Pathol Mech Dis. 2009; 4:435-459. 86. Fukuda Y, Masuda Y, Ishizaki M, Masugi Y, Ferrans V J: Morphogenesis of abnormal elastic fibers in lungs of patients with panacinar and centriacinar emphysema. Hum Pathol. 1989; 20:652-659. 87. Vlahovic G, Russell M L, Mercer R R, Crapo J D: Cellular and connective tissue changes in alveolar septal walls in emphysema. Am J Respir Crit Care Med. 1999; 160:2086-2092. 88. Turino G M, Senior R M, Garg B D, Keller S, Levi M M, Mandl I: Serum elastase inhibitor deficiency and alpha1-antitrypsin deficiency in patients with obstructive emphysema. Science. 1969; 165:709-711. 89. Snider G L, Lucey E C, Stone P J: Animal-models of emphysema: Am Rev Respir Dis. 1986; 133:149-169. 90. Gottlieb D J, Stone P J, Sparrow D, Gale M E, Weiss S T, Snider G L, O'Connor G T: Urinary desmosine excretion in smokers with and without rapid decline of lung functionthe normative aging study. Am J Respir Crit Care Med. 1996; 154: 1290-1295. 91. Darnule T V, McKee M, Darnule A T, Turino G M, Mandl I: Solid-phase radioimmunoassay for estimation of elastin peptides in human-sera. Anal Biochem. 1982; 122:302-307. 92. Dillon T J, Walsh R L, Scicchitano R, Eckert B, Cleary E G, McLennan G: Plasma elastin-derived peptide levels in normal adults, children, and emphysematous subjectsphysiological and computed tomographic scan correlates. Am Rev RespirDis. 1992; 146:1143-1148. 93. Akers S, Kucich U, Swartz M, Rosen G, Glass M, Rosenbloom J, Kimbel P, Weinbaum G: Specificity and sensitivity of the assay for elastin-derived peptides in chronic obstructive pulmonary disease. Am Rev Respir Dis. 1992; 145:1077-1081. 94. Reiser K, McCormick R J, Rucker R B: Enzymatic and nonenzymatic cross-linking of collagen and elastin. FASEB J. 1992; 6:2439-2449. 95. Foster J A, Bruenger E, Rubin L, Imberman M, Kagan H, Mecham R, Franzblau C: Circular-dichroism studies of an elastin crosslinked peptide. Biopolymers. 1976; 15:833-841. 96. Gerber G E, Anwar R A: Comparative studies of the crosslinked regions of elastin from bovine ligamentum nuchae and bovine, porcine and human aorta. Biochem J. 1975; 149:685-695. 97. Mecham R P, Foster J A: Structural model for desmosine crosslinked peptides. Biochem J. 1978; 173:617-625. 98. Brown-Augsburger P, Tisdale C, Broekelmann T, Sloan C, Mecham R P: Identification of an elastin cross-linking domain that joins 3 peptide chainspossible role in nucleated assembly. J Biol Chem. 1995; 270:17778-17783. 99. Mecham R P, Broekelmann T J, Fliszar C J, Shapiro S D, Welgus H G, Senior R M: Elastin degradation by matrix metalloproteinasescleavage site specificity and mechanisms of elastolysis. J Biol Chem. 1997; 272:18071-18076. 100. Barroso B, Abello N, Bischoff R: Study of human lung elastin degradation by different elastases using high-performance liquid chromatography/mass spectrometry. Anal Biochem. 2006; 358:216-224. 101. Russell REK, Thorley A, Culpitt S V, Dodd S, Donnelly L E, Demattos C, Fitzgerald M, Barnes P J: Alveolar macrophage mediated elastolysis: roles of matrix metalloproteinases, Experimental Lung Research Lung Elastin-Derived Peptides in COPD 557 cysteine, and serine proteases. Am J Physiol Lung Cell Mol Physiol. 2002; 283: L867-L873. 102. Senior R M, Griffin G L, Mecham R P: Chemotactic responses of fibroblasts to tropoelastin and elastin-derived peptides. J Clin Invest. 1982; 70:614-618. 103. Hunninghake G W, Davidson J M, Rennard S, Szapiel S, Gadek J E, Crystal R G: Elastin fragments attract macrophage precursors to diseased sites in pulmonary-emphysema. Science. 1981; 212:925-927. 104. Yusa T, Blood C H, Zetter B R: Tumor-cell interactions with elasting implications for pulmonary metastasis. Am Rev Respir Dis. 1989; 140:1458-1462. 105. Houghton A M, Quintero P A, Perkins D L, Kobayashi D K, Kelley D G, Marconcini L A, Mecham R P, Senior R M, Shapiro S D: Elastin fragments drive disease progression in a murine model of emphysema. J Clin Invest. 2006; 116:753-759. 106. Lee S-H, Goswami S, Grudo A, Song L-z, Bandi V, Goodnight-White S, Green L, Hacken-Bitar J, Huh J, Bakaeen F, et al.: Antielastin autoimmunity in tobacco smoking-induced emphysema. Nat Med. 2007; 13:567-569. 107. Cosia M G, Saetta M, Agusti A: Immunologic aspects of chronic obstructive pulmonary disease. N Engl J Med. 2009; 360:2445-2454. 108. Twumasi D Y, Liener I E: Protease from purulent sputum, purification and properties of the elastase and chymotrypsin-like enzymes. J Biol Chem 1972; 252:1917-1926. 109. Banda M J, Werb Z: Mouse macrophage elastase. Purification and characterization as metalloproteinase. Biochem J. 1981; 193:589-605. 110. Shapiro S D, Griffin G, Gilbert D J, Jenkins N A, Copeland N G, Welgus H G, Senior R M, Ley T J: Molecular cloning, chromosomal localization, and bacterial expression of a murine macrophage metalloelastase. J Biol Chem. 1992; 267: 4664-4671. 111. Shapiro S D, Kobayashi D K, Ley T J: Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages. J Biol Chem. 1993; 268:23824-23829. 112. Biemann K: Sequencing of peptides by tandem mass spectrometry and high-energy collision-induced dissociation. Methods Enzymol. 1990; 193:455-479. 113. Papayannopoulos I A: The interpretation of collision-induced dissociation tandem mass-spectra of peptides. Mass Spectrom Rev. 1995; 14:49-73. 114. Vrhovski B, Weiss A S: Biochemistry of tropoelastin. Eur J Biochem. 1998; 258:1-18. 115. Indik Z, Yeh H, Ornsteingoldstein N, Sheppard P, Anderson N, Rosenbloom J C, Peltonen L, Rosenbloom J: Alternative splicing of human elastin messenger-RNA indicated by sequence analysis of cloned genomic and complementary-DNA. Proc Natl Acad Sci USA. 1987; 84:5680-5684. 116. Senior R M, Griffin G L, Mecham R P, Wrenn D S, Prasad K U, Urry D W: Val-Gly-Val-Ala-Pro-Gly, a repeating peptide in elastin, is chemotactic for fibroblasts and monocytes. J Cell Biol. 1984; 99:870-874. 117. Gosline J M: Hydrophobic interaction and a model for elasticity of elastin. Biopolymers. 1978; 17:677-695. 118. Urry D W: Protein elasticity based on conformations of sequential polypeptidesthe biological elastic fiber. J Protein Chem. 1984; 3:403-436. 119. Urry D W: Entropic elastic processes in protein mechanisms. 1. Elastic structure due to an inverse temperature transition and elasticity due to internal chain dynamics. J Protein Chem. 1988; 7:1-34. 120. Morelli MAC, Bisaccia F, Spisani S, DeBiasi M, Traniello S, Tamburro A M: Structure-activity relationships for some elastin-derived peptide chemoattractants. J Pept Res. 1997; 49:492-499. 121. Brassart B, Fuchs P, Huet E, Alix A J P, Wallach J, Tamburro A M, Delacoux F, Haye B, Emonard H, Hornebeck W, et al.: Conformational dependence of collagenase (matrix metalloproteinase-1) up-regulation by elastin peptides in cultured fibroblasts. J Biol Chem. 2001; 276:5222-5227. 122. Starcher B and Peterson B: The kinetics of elastolysis: elastin catabolism during experimentally induced fibrosis. Exp Lung Res. 1999; 25:407-424. 123. Stolk J, Veldhuisen B, Annovazzi L, Zanone C, Versteeg E M, van Kuppevelt, T H, Nieuwenhuizen, W, Iadarola P and Luisetti M: Short-term variability of biomarkers of proteinase activity in patients with emphysema associated with type Z alpha-1 antitrypsin deficiency. Respir Res 2005, 6:47. 124. Starcher B C and Galione M J: Purification and comparisons of elastin from different animal species. Analytical Biochemistry 1976, 74:441-447.
(279) Although illustrative embodiments of the present invention have been described herein, it should be understood that the invention is not limited to those described, and that various other changes or modifications may be made by one skilled in the art without departing from the scope or spirit of the invention.