METHODS AND COMPOSITIONS FOR WOUND HEALING
20180028713 · 2018-02-01
Inventors
- Ankit Agarwal (Middleton, WI, US)
- Gaurav Pranami (Fitchburg, WI, US)
- Tyler B. Nelson (Madison, WI, US)
- Anna M. O'Keefe (Madison, WI, US)
- Nicholas L. Abbott (Middleton, WI, US)
- Eric Crawford (Madison, WI, US)
Cpc classification
A61K31/155
HUMAN NECESSITIES
A61K47/32
HUMAN NECESSITIES
A61K31/713
HUMAN NECESSITIES
A61L2300/42
HUMAN NECESSITIES
A61L15/24
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C09D133/02
CHEMISTRY; METALLURGY
A61L2420/04
HUMAN NECESSITIES
A61L15/46
HUMAN NECESSITIES
A61K31/4468
HUMAN NECESSITIES
A61K31/167
HUMAN NECESSITIES
A61L2400/12
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61L2300/404
HUMAN NECESSITIES
A61K9/7092
HUMAN NECESSITIES
A61F13/00063
HUMAN NECESSITIES
International classification
C12N15/113
CHEMISTRY; METALLURGY
A61K9/70
HUMAN NECESSITIES
A61K47/32
HUMAN NECESSITIES
A61L15/24
HUMAN NECESSITIES
A61K31/713
HUMAN NECESSITIES
Abstract
The present invention relates to large scale manufacture of nanoscale microsheets for use in applications such as wound healing or modification of a biological or medical surface.
Claims
1. A process for manufacture of an article comprising: a) providing a flexible substrate comprising a low surface energy surface having a surface area of greater than 0.1 square meters; b) depositing a nanoscale polymer layer from about 0.5 nm to 10000 nm thick on the low surface energy surface; and c) introducing a bioactive agent into the nanoscale polymer layer to provide a bioactive nanoscale polymer layer.
2. The process of claim 1, wherein the depositing occurs via a roll to roll coating process.
3. The process of claim 2, wherein the roll to roll coating process comprises transferring the flexible substrate from a first roll to at least a second roll and coating the low surface energy surface of the flexible substrate with the nanoscale polymer layer while the flexible substrate is being transferred between the first roll and the second roll.
4. The process of claim 1, wherein the nanoscale polymer layer is deposited on the low surface energy surface of the flexible substrate by a coating or printing method selected from the group consisting of roll to roll coating, spray coating, dip coating, immersion coating, spin coating, slot die coating, inkjet coating, anilox coating, screen coating, offset lithography printing, flexographic coating, gravure coating, rotogravure coating, reverse roll coating, metering (Meyer) rod coating, blade coating, knife over roll coating, air knife coating, curtain coating, melt extrusion coating, solvent casting and any combinations thereof.
5. The process of claim 1, wherein the nanoscale polymer layer is formed by depositing alternating layers of at least one positively charged polyelectrolyte and at least one negatively charged polyelectrolyte.
6. The process of claim 5, wherein the at least one positively charged polyelectrolyte is selected form the group consisting of poly(allylamine hydrochloride) (PAH), polyl-lysine (PLL), poly(ethylene imine) (PEI), poly(histidine), poly(N,N-dimethyl aminoacrylate), poly(N,N,N-trimethylaminoacrylate chloride), poly(methyacrylamidopropyltrimethyl ammonium chloride), and natural or synthetic polysaccharides such as chitosan.
7. The process of claim 5, wherein the at least one negatively charged polyelectrolyte is selected from the group consisting of poly(acrylic acid) (PAA), poly(styrenesulfonate) (PSS), alginate, hyaluronic acid, heparin, heparan sulfate, chondroitin sulfate, dextran sulfate, poly(methacrylic acid), oxidized cellulose, carboxymethyl cellulose, polyaspartic acid, and polyglutamic acid.
8. The process of claim 5, wherein the polyelectrolytes have a unimodal molecular weight distribution in the range of 1 to 10000 kDa or multimodal molecular weight distribution in the range of 1 to 10000 kDa or is a mixture of multiple polymers of unimodal or multimodal molecular weight distribution in the range of 1 to 10000 kDa.
9. The process of claim 5, wherein the polyelectrolytes are provided in an aqueous solution at a concentration of from 1 to 10000 mM based on polymer repeat unit.
10. The process of claim 9, wherein the pH of the aqueous polyelectrolyte solution is adjusted so that the polymer is at least 0.01% charged.
11. The process of claim 9, wherein the concentration of inorganic or organic salts is from 1 to 10000 mM in the aqueous polyelectrolyte solution.
12. The process of claim 4, wherein the residence time of the polymer formulation on the low surface energy surface of the flexible substrate during the coating of nanoscale polymer layer is from 1 to 600 seconds prior to rinsing.
13. The process of claim 1, wherein the bioactive agent is selected from the group consisting of an antimicrobial agent, an antibiofilm agent, a growth factor, a hemostatic agent, a bioactive peptide, a bioactive polypeptide, an analgesic, a local anesthetic, opioid, opioid agonist, opioid antagonist or mixed agonist/antagonist, an anticoagulant, anti-inflammatory agent, and a drug molecule or a drug compound.
14. The process of claim 13, wherein the antimicrobial agent is a silver ion, silver salt, or silver nanoparticle.
15. The process of claim 13, wherein the antibiofilm agent is a gallium ion, gallium ion salt, gallium ion nanoparticle, gallium alloy, or an alloy of gallium and silver.
16. The process of claim 13, wherein said analgesic is selected from the group consisting of bupivacaine, lidocaine, articaine, prilocaine, and mepivacaine.
17. The process of claim 1, wherein incorporating the bioactive agent into the nanoscale polymer layer to provide a bioactive nanoscale polymer layer comprises introducing silver ions into the nanoscale polymer multilayer and reducing the silver ions in situ to provide silver nanoparticles.
18. The process of claim 17, wherein nanoscale film is doped with silver ions by immersion in silver nitrate solution of concentration of from 0.1 to 10000 mM for from 1 to 3600 seconds.
19. The process of claim 18, wherein silver ion in nanoscale film is reduced into silver nanoparticles by immersing nanoscale film in a solution of a reducing agent solution of concentration of from 0.1 to 10000 mM for from 1 to 3600 seconds.
20. The process of claim 1, further comprising from 2 to 20 repetitions of the step of introducing a bioactive agent into the nanoscale polymer layer.
21. The process of claim 1, further comprising forming or depositing a second polymer layer on the nanoscale polymer-layer so that the nanoscale polymer layer is between the low surface energy surface of the flexible polymer substrate and the second polymer layer.
22. The process of claim 21 wherein the second polymer layer slows the release rate of bioactive agent from nanoscale layer by 1 to 1000 times.
23. The process of claim 21, wherein the second polymer layer comprises polyvinyl alcohol (PVA), polyacrylic acid (PAA), polyvinylpyrrolidone (PVP), carboxymethyl cellulose (CMC), hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose, ethylcellulose, hydroxyethyl cellulose (HEC), alginates, polyvinylacetate (PVAc), polylactic acid (PLA), polylactic-co-glycolic acid (PLGA), polyglycolic acid, or polyanhydrides.
24. The process of claim 21, wherein the polymer has a molecular weight of less than 23 kDa.
25. The process of claim 21, wherein the second polymer layer is ionically, physically or chemically crosslinked.
26. The process of claim 21, wherein the second polymer layer is from about 0.1 m thick to about 100 m thick, from about 0.1 m thick to about 50 m thick, from about 1 m thick to about 20 m thick, or from about 1 m thick to about 10 m thick.
27. The process of claim 21, further comprising introducing a bioactive agent into the second polymer layer.
28. The process of claim 27, wherein the bioactive agent is selected from the group consisting of an antimicrobial agent, an antibiofilm agent, a growth factor, a hemostatic agent, a bioactive peptide, a bioactive polypeptide, an analgesic, an anticoagulant, an anti-inflammatory agent, and a drug molecule or a drug compound.
29. The process of claim 28, wherein the antimicrobial agent is a silver ion, silver salt, or silver nanoparticle.
30. The process of claim 28, wherein the antibiofilm agent is a gallium ion, gallium ion salt, gallium ion nanoparticle, gallium alloy, or an alloy of gallium and silver.
31. The article of claim 28, wherein said local anaesthetic is selected from the group consisting of bupivacaine, lidocaine, articaine, prilocaine, and mepivacaine.
32. The process of claim 1, wherein the bioactive agent is loaded at a concentration of approximately 0.01 to 1000 g/cm.sup.2 in the nanoscale polymer layer.
33. The process of claim 27, wherein the bioactive agent is provided in the second polymer layer at a concentration of approximately 0.01 g/cm2 to 10 mg/cm.sup.2.
34. The process of claim 27, further comprising including a second or more bioactive agent(s) in the combined nanoscale polymer layer and the second polymer layer.
35. The process of claim 1, wherein the low surface energy surface on said flexible substrate has a surface energy of from 10 to 100 mJ/cm.sup.2.
36. The process of claim 35, wherein said flexible substrate is a flexible polymeric sheet of low surface energy or said low surface energy surface is provided by a release coating coated on said flexible polymer.
37. The process of claim 36, wherein said release coating is a silicone coating, a polydimethyl siloxane (PDMS) coating, a fluorocarbon coating, a polyacrylate coating, a polystyrene coating, a polystyreneacrylic coating, a chromium sterate complex coating, or a polyolefin coating.
38. The process of claim 36, wherein the flexible polymeric sheet comprises a polymer film selected from the group consisting of a polyester film, a polyethylene terephthalate (PET) film, a biaxially oriented PET film, a polycarbonate, a polyethylene (including high density polyethylene, medium density polyethylene, low density polyethylene, linear low density polyethylene) film, a polyvinyl chloride film, a polyvinylidene chloride film, a polyvinylidene fluoride film, a nylon film, a polystyrene film, an acetate film, a polyurethane film, an ethylene vinyl acetate copolymer film, a cast polypropylene film, an uniaxially oriented polypropylene film and a biaxially oriented polypropylene film.
39. The process of claim 21, further comprising peeling the nanoscale polymer layer in association with the second polymer layer from the low surface energy surface of the substrate to provide a free standing microsheet.
40. The process of claim 21, wherein said second polymer layer comprises one or more additives selected from the group consisting of surfactants, emulsifiers, wetting agents, rheology modifiers, plasticizers, emollients, humectants, disintigrants, lubricants, binders, compatibilizing agents, antistatic agents, and fillers.
Description
DETAILED DESCRIPTION OF THE INVENTION
[0065] The present invention relates to large scale manufacture of nanoscale microsheets for use in applications such as wound healing or modification of a biological or medical surface. In some preferred embodiments, a substrate comprising a flexible polymeric sheet presenting a low surface energy surface is utilized in a continuous roll-to-roll layer-by-layer coating process for making a freestanding nano- or micro-scale polymeric film containing an active ingredient. The process is conducted at a large scale. Preferably the flexible polymeric sheet presenting a low surface energy surface provides a low surface energy surface having a surface area of at least 0.65, 1, 2, 5, 10, 100 or 500 square meters or from 0.65 to 1.0, 0.65 to 5.0, 0.65 to 10, 0.65 to 20, 0.65 to 50, 0.65 to 100, 0.65 to 200, 0.65 to 300, 0.65 to 400, 0.65 to 500, 1 to 10, 1 to 20, 1 to 50, 1 to 100, 1 to 200, 1 to 300, 1 to 400, 1 to 500, 2 to 10, 2 to 20, 2 to 50, 2 to 100, 2 to 200, 2 to 300, 2 to 400, 2 to 500, 5 to 10, 5 to 20, 5 to 50, 5 to 100, 5 to 200, 5 to 300, 5 to 400, 5 to 500, 10 to 20, 10 to 50, 10 to 100, 10 to 200, 10 to 300, 10 to 400, 10 to 500, 20 to 50, 20 to 100, 20 to 200, 20 to 300, 20 to 400, 20 to 500, 50 to 100, 50 to 200, 50 to 300, 50 to 400, or 50 to 500 square meters. Suitable techniques for coating the low surface energy surface of the substrate include, but are not limited to dip, immersion, spray, spin, slot die, inkjet, flexographic, gravure, reverse roll coating, metering (Meyer) rod, blade, air knife, curtain, melt extrusion, solvent casting and any combinations thereof. See, e.g., US PAT PUBL. 20140079884, US PAT PUBL. 20160068703, US PAT PUBL. 20120269973, US PAT PUBL. 20160114294, US PAT PUBL. 20140112994, US PAT PUBL. 20150086599, Shiratori, Japanese Journal of Applied Physics Vol. 44, No. 3, 2005, L126-L128, and Grunlan, Industrial & Engineering Chemistry Research Vol. 53, 2014, 6409-6416, all of which are incorporated herein by reference in their entirety. In general, the surfaces onto which polymer layers have been deposited at large scale have been high energy surfaces, for example, surfaces which been modified by plasma treatment. In the present invention, it has surprisingly been found that molecularly thin polymer layers may be deposited on large scale rolls of a substrate material in a continuous process so that defect-free molecularly thin polymeric sheets, preferably including a sacrificial layer, may be peeled from the substrate to provide a nano- to microscale polymeric sheet for use in application to a wound or for modification of a biological or medical surface. A bioactive agent is preferably incorporated into the nano- to microscale polymeric sheet to provide a desired level of release of a bioactive agent.
[0066] A. Substrates Having a Low Surface Energy Surface
[0067] In some embodiments, the present invention utilizes a substrate having a low surface energy surface as a substrate onto which a molecularly thin nano- or microscale polymer layer is deposited. In preferred embodiments, the substrate having a low surface energy surface is a flexible polymeric sheet. In some embodiments, the flexible polymeric sheet is amenable to storage and winding onto a roll for use in a continuous roll-to-roll process. As described above, the flexible polymeric sheet presenting a low surface energy surface provides a low surface energy surface having a surface area of at least 0.65, 1, 2, 5, 10, 100 or 500 square meters or from 0.65 to 1.0, 0.65 to 5.0, 0.65 to 10, 0.65 to 20, 0.65 to 50, 0.65 to 100, 0.65 to 200, 0.65 to 300, 00.65 to 400, 0.65 to 500, 1 to 10, 1 to 20, 1 to 50, 1 to 100, 1 to 200, 1 to 300, 1 to 400, 1 to 500, 2 to 10, 2 to 20, 2 to 50, 2 to 100, 2 to 200, 2 to 300, 2 to 400, 2 to 500, 5 to 10, 5 to 20, 5 to 50, 5 to 100, 5 to 200, 5 to 300, 5 to 400, 5 to 500, 10 to 20, 10 to 50, 10 to 100, 10 to 200, 10 to 300, 10 to 400, 10 to 500, 20 to 50, 20 to 100, 20 to 200, 20 to 300, 20 to 400, 20 to 500, 50 to 100, 50 to 200, 50 to 300, 50 to 400, or 50 to 500 square meters. The present invention is not limited to the use of any particular flexible polymeric sheets. Preferred materials include, but are not limited to, a polyester film, a polyethylene terephthalate (PET) film, a biaxially oriented PET film, a polycarbonate, a polyethylene (including high density polyethylene, medium density polyethylene, low density polyethylene, linear low density polyethylene) film, a polyvinyl chloride film, a polyvinylidene chloride film, a polyvinylidene fluoride film, a nylon film, a polystyrene film, an acetate film, a polyurethane film, an ethylene vinyl acetate copolymer film, a cast polypropylene film, an uniaxially oriented polypropylene film and a biaxially oriented polypropylene films. The preferred thickness of the sheet is from 0.5-5 mil. In some preferred embodiments, the flexible polymeric sheet has a surface having a surface energy of from 10 to 100 mJ/cm.sup.2, and most preferably from about 15 to about 45 mJ/cm.sup.2. In some embodiments, the low surface energy surface is provided by inclusion of a release film on the flexible polymeric sheet. In some embodiments, the release coating is a silicone release film, a polydimethyl siloxane (PDMS) coating, a fluorocarbon coating, a polyacrylate coating, a polystyrene coating, a polystyreneacrylic coating, a chromium sterate complex coating, or a polyolefin coating. Suitable release films include, but are not limited, to those provided St. Gobain Performance Plastics, Worcester Mass., such as Saint Gobain 4130, 4159 and 7819 release coatings. In preferred embodiments, the release characteristics of the flexible polymeric sheet support the defect-free layer-by-layer deposition of polyelectrolytes as well as allowing facile and complete peeling of the wound dressing coating without tears or other defects thus resulting in a free standing polymeric film which can incorporate therapeutic agents such as antimicrobial agents and pain relievers as described in more detail below.
[0068] While some preferred embodiments have been described herein as utilizing flexible polymeric sheets, it will be understood that in some embodiments other materials may be substituted for the flexible polymeric sheet. Accordingly, in some embodiments, the substrate having a low surface energy surface may be preferably be a paper or cellulosic substrate such as glassine or supercalendered kraft paper coated with a release coating.
[0069] B. Nanoscale Polymer Layer
[0070] In preferred embodiments, the present invention provides a flexible polymeric sheet having a low surface energy surface as described above onto which a molecular thin, nano- to microscale polymer layer is deposited. In some embodiments, the nanoscale polymer layers, such as polymer multilayers, are nanoscale to microscale in dimension. Accordingly, in some embodiments, the nanoscale polymer matrices are from about 1 nm to 10000 nm thick, from about 1 nm to 5000 nm thick, from about 1 nm to 500 nm thick, from about 1 nm to 100 nm thick, from about 1 nm to about 25 nm thick, from about 1 nm to about 10 nm thick, or less than about 500 nm, 100 nm, 25 nm or 10 nm thick. It is contemplated that the nanoscale dimension of the matrices (i.e., the nanoscale thickness) allows for the loading of a lower total amount of an active agent while still allowing delivery of an effective amount (i.e., an amount of active agent that accelerates wound healing as compared to controls) of the active agent as compared to matrix structures with greater thickness. It is contemplated that the lower total loading levels result in reduced toxicity in the wound environment, especially when antimicrobial compounds are incorporated into the polymer multilayer.
[0071] In some embodiments, the present invention provides compositions comprising a nanoscale polymer layer that can be applied to a wound, a biologic tissue, a cornea, a lens, a bone, a tendon, a surgical mesh, a wound dressing, a biomedical device, a device used for healthcare, or other surface. In some embodiments, the nanoscale polymer layer is functionalized. In some embodiments, the nanoscale polymer layer is not functionalized. In some embodiments, the nanoscale polymer layer comprises one or more polymers, preferably biocompatible, or is formed from one or more proteins, or is a combination of polymers and proteins. In some embodiments, the nanoscale polymer layer is formed from synthetic polymers such as synthetic polyelectrolytes. In other embodiments, the nanoscale polymer layer is formed from naturally occurring polymers such as polysaccharides. In some embodiments, the nanoscale polymer layer is functionalized to allow for covalent interaction and/or binding to the tissue surface or the wound bed, or to allow application ofbioactive agents to the nanoscale polymer layer. In some embodiments, a bioactive agent, for example an antimicrobial agent such as silver, polyhexamethylene biguanide (PHMB), chlorhexidine, or iodine compound, or an antibiotic, is incorporated into the nanoscale polymer layer. The bioactive agent is preferably impregnated, incorporated or interspersed throughout the three dimensional structure of the nanoscale polymer layer. For example, if the nanoscale polymer layer is polyelectrolyte multilayer (PEM), the bioactive agent is preferably incorporated between or within the layers of the polymer multilayer.
[0072] In some embodiments, the layer is a polymer multilayer. In some embodiments, the multilayer structures comprise layers of polyelectrolytes (i.e., forming a polyelectrolyte multilayer), while in other embodiments, the multilayers comprise polymers that do not have a charge (i.e., non-ionic polymers) or a combination of charged and uncharged polymer layers. In some embodiments, it is contemplated that polyelectrolyte films built-up by the alternated adsorption of cationic and anionic polyelectrolyte layers constitute a novel and promising technique to modify wound surfaces in a controlled way (Decher et al., 1992, Thin Solid Films 210/211:831; Decher, 1997, Science 277:1232). One of the most important properties of such multilayers is that they exhibit an excess of alternatively positive and negative charges (Caruso et al., 1999, J Am Chem Soc 121:6039; Ladam et al., 2000, Langmuir 16:1249). Not only can this constitute the motor of their buildup (Joanny, 1999, Eur. Phys. J. Biol. 9:117), but it allows, by simple contact, to adsorb a great variety of compounds such as dyes, particles (Cassagneau et al., 1998, J. Am. Chem. Soc. 120:7848; Caruso et al., 1999, Langmuir 15:8276; Lvov et al., 1997, Langmuir 13:6195), clay microplates (Ariga et al., 1999, Appl. Clay Sci. 15:137) and proteins (Keller et al., 1994, J. Am. Chem. Soc. 116:8817; Lvov et al., 1995, J. Am. Chem. Soc. 117:6117; Caruso et al., 1997, Langmuir 13:3427).
[0073] Polyelectrolyte layers are formed by alternating applications of anionic polyelectrolytes and cationic polyelectrolytes to surfaces to form a polyelectrolyte multilayer. In some embodiments, one or more bioactive agents, such as those described above, are incorporated into the multilayer. Preferably, at least four layers, and, more preferably, at least six layers are used to form the polyelectrolyte multilayer.
[0074] Cationic polyelectrolytes useful in the present invention can be any biocompatible water-soluble polycationic polymer, for example, any polymer having protonated heterocycles attached as pendant groups. As used herein, water soluble means that the entire polymer must be soluble in aqueous solutions, such as buffered saline or buffered saline with small amounts of added organic solvents as co-solvents, at a temperature between 20 and 37 Centigrade. In some embodiments, the material will not be sufficiently soluble (defined herein as soluble to the extent of at least one gram per liter) in aqueous solutions per se but can be brought into solution by grafting the polycationic polymer with water-soluble polynonionic materials such as polyethylene glycol.
[0075] Representative cationic polyelectrolytes include natural and unnatural polyamino acids having net positive charge at neutral pH, positively charged polysaccharides, and positively charged synthetic polymers. Examples of suitable polycationic materials include polyamines having amine groups on either the polymer backbone or the polymer side chains, such as poly-L-lysine (PLL) and other positively charged polyamino acids of natural or synthetic amino acids or mixtures of amino acids, including, but not limited to, poly(D-lysine), poly(ornithine), poly(arginine), and poly(histidine), and nonpeptide polyamines such as poly(aminostyrene), poly(aminoacrylate), poly (N-methyl aminoacrylate), poly (N-ethylaminoacrylate), poly(N,N-dimethyl aminoacrylate), poly(N,N-diethylaminoacrylate), poly(aminomethacrylate), poly(N-methyl amino-methacrylate), poly(N-ethyl aminomethacrylate), poly(N,N-dimethyl aminomethacrylate), poly(N,N-diethyl aminomethacrylate), poly(ethyleneimine), polymers of quaternary amines, such as poly(N,N,N-trimethylaminoacrylate chloride), poly(methyacrylamidopropyltrimethyl ammonium chloride), and natural or synthetic polysaccharides such as chitosan.
[0076] In general, the polymers must include at least five charges, and the molecular weight of the polycationic material must be sufficient to yield the desired degree of binding to a tissue or other surface, having a molecular weight of at least 1000 g/mole.
[0077] Polyanionic materials useful in the present invention can be any biocompatible water-soluble polyanionic polymer, for example, any polymer having carboxylic acid groups attached as pendant groups. Suitable materials include alginate, carrageenan, furcellaran, pectin, xanthan, hyaluronic acid, heparin, heparan sulfate, chondroitin sulfate, polyacrylic acid (PAA), dermatan sulfate, dextran sulfate, poly(meth)acrylic acid, oxidized cellulose, carboxymethyl cellulose and crosmarmelose, synthetic polymers and copolymers containing pendant carboxyl groups, such as those containing maleic acid or fumaric acid in the backbone. Polyaminoacids of predominantly negative charge are also suitable. Examples of these materials include polyaspartic acid, polyglutamic acid, and copolymers thereof with other natural and unnatural amino acids. Polyphenolic materials such as tannins and lignins can be used if they are sufficiently biocompatible. Preferred materials include alginate, pectin, carboxymethyl cellulose, heparin and hyaluronic acid.
[0078] In some embodiments, the cationic polyelectrolyte used is PLL and the anionic polyelectrolyte used is poly(L-glutamic acid) (PGA). In some further preferred embodiments, the cationic polyelectrolyte used is polyallylamine hydrochloride (PAH) and the anionic polyelectrolyte used is polyacrylic acid (PAA). Indeed, the use of a variety of polyelectrolytes is contemplated, including, but not limited to, poly(ethylene imine) (PEI), poly(sodium 4-styrenesulfonate) (PSS), poly(acrylic acid) (PAC), poly(maleic acid-co-propylene) (PMA-P), and poly(vinyl sulfate) (PVS). It is also possible to use naturally occurring polyelectrolytes, including hyaluronic acid and chondroitin sulfate. In still further embodiments, the polymer is a dendrimer, grafted polymer, or star architecture polymer.
[0079] In some embodiments, the multilayer structures are formed from uncharged polymers or from a combination of charged and uncharged polymers. Examples of uncharged polymers include, but are not limited to, dextran, dextran sulfate, diethylaminoethyl (DEAE)-dextran, hydroxyethyl cellulose, ethyl(hydroxyethyl) cellulose, acrylamide, polyethylene oxide, polypropylene oxide, polyethylene oxidepolypropylene oxide copolymers, PAAN.sub.a, Ficoll, polyvinylpyrolidine, and polyacrylic acid.
[0080] In some embodiments, the multilayer structures are formed from one or more amphoteric polymers, alone in combination with the other polymers described herein. In some embodiments, the amphoteric polymers comprise one or more of acrylic acid (AA), DMAEMA (dimethylaminoethyl methacrylate), APA (2-aminopropyl acrylate), MorphEMA (morpholinoethyl methacrylate), DEAEMA (diethylaminoethyl methacrylate), t-ButylAEMA (t-butylaminoethyl methacrylate), PipEMA (piperidinoethyl methacrylate), AEMA (aminoethyl methacrylate), HEMA (2-hydroxyethyl methacrylate), MA (methyl acrylate), MAA (methacrylic acid) APMA (2-aminopropyl methacrylate), AEA (aminoethyl acrylate). In some embodiments, the amphoteric polymer comprises (a) carboxylic acid, (b) primary amine, and (c) secondary and/or tertiary amine. The amphoteric polymers have an isoelectric point of 4 to 8, preferably 5 to 7 and have a number average molecular weight in the range of 10,000 to 150,000.
[0081] Polymer layers may be formed on the low surface energy surface of the substrate by a variety of methods, including but not limited to the following techniques: spray coating, dip coating, immersion coating, spin coating, slot die coating, inkjet coating, anilox coating, screen coating, offset lithography printing, flexographic coating, gravure coating, rotogravure coating, reverse roll coating, metering (Meyer) rod coating, blade coating, knife over roll coating, air knife coating, curtain coating, melt extrusion coating, solvent casting and any combinations thereof. In some preferred embodiments, the flexible polymeric sheet is provided on a roll or is wound onto a roll. The leading edge of the sheet is then routed past one or more rolls (i.e., a series of rolls) and wound onto a receiving rolls. During this routing procedure, a primary layer-by-layer coating is deposited on low surface energy surface of the flexible polymeric sheet substrate by sequential deposition of at least two different materials of opposite charge from their solutions in suitable solvents. These polymers can be multivalent polymer salts and their solutions may contain univalent or multivalent organic or inorganic salts such as but not limited to chloride, sulfate, nitrate or acetate salts of univalent or divalent or trivalent metal cations in the concentration of 0.1-10000 mM and more preferably 0.5-50 mM. In some embodiments, the sheet is routed past one or more sprayers (i.e., a series of sprayers) and/or rinse basins and dryers. In other embodiments, the sheet is routed through one or more basins containing a polymer solution and/or one or more rinse basins and dryers. In some preferred embodiments, each polymer forming the polymer multilayer is deposited by allowing the flexible sheet substrate a residence time <600 seconds, preferably from 1-90 seconds, in the preferred solvent (e.g., an aqueous solution) followed by optional rinsing and drying. In some preferred embodiments, the thickness of final polymer multilayer coating is from 5-10000 nm, preferably from 5-5000 nm thick, and most preferably from 100-1000 nm thick. In some preferred embodiments, a bioactive agent, as described in more detail below, is then loaded into the polymer multilayer.
[0082] C. Second Polymer Layer
[0083] In some embodiments, a second polymer layer is deposited on or associated with the nano- to microscale polymer layer. In some preferred embodiments, the secondary polymer film has a thickness of from 1-50 m, preferably 5-25 m, and is coated onto the nano- to microscale polymer layer as described above for the deposition of the nano- to microscale polymer layer.
[0084] In some embodiments the nanoscale polymer matrix is supported by a second polymer layer, e.g., a non-sacrificial polymer layer. For example, in some embodiments, the nanoscale polymer matrix is supported by a second polymer layer, e.g., a non-sacrificial polymer layer, that comprises a hydrogel, a hydrocolloid, and/or collagen as a support.
[0085] In other embodiments, the nanoscale polymer matrix is supported on a sacrificial polymer layer, preferably a sacrificial polymer layer, formed from a degradable or dissolvable support material such as a dissolvable polymer. In preferred embodiments, sacrificial polymer layer of a microsheet is water soluble. In some embodiments, the sacrificial polymer layer is made of non-toxic polymer, and in some embodiments the sacrificial polymer layer is poly vinyl alcohol (PVA). In some embodiments the sacrificial polymer layer is made of polyacrylic acid (PAA), polyvinylpyrrolidone (PVP), carboxymethyl cellulose (CMC), sodium carboxymethyl cellulose, methylcellulose, ethylcellulose, ethylmethyl cellulose, hydroxyethyl cellulose (HEC), hydroxylpropyl cellulose (HPC), hydroxypropyl methylcellulose (HPMC), alginates, polyvinylacetate (PVAc), polylactic acid (PLA), polylactic-co-glycolic acid (PLGA), polyglycolic acid, or polyanhydrides. In some embodiments, the nanoscale polymer layer is first formed on a solid support as described above and then a sacrificial polymer layer is formed on the nanoscale polymer matrix, for example, by spray coating, spin coating, slot die coating, anilox coating, screen coating, inkjet coating, offset lithography printing, flexographic coating, gravure coating, rotogravure coating, reverse roll coating, metering (Meyer) rod coating, blade coating, knife over roll coating, air knife coating, curtain coating, melt extrusion coating, solvent casting and any combinations thereof. In preferred embodiments, the sacrificial polymer layer material is dissolvable in aqueous environments or environments where moisture is present, such as moist surfaces like wound beds, internal body surfaces, epithelial surfaces and the like. In preferred embodiments, the sacrificial polymer layer material is dissolvable in aqueous solutions after application of the nanoscale polymer matrix on the surface. In some embodiments, the sacrificial polymer layer is microscale in dimension, and may range from 0.2 m to 1000 m, 0.2 m to 500 m, 0.2 m to 200 m, 0.2 m to 100 m, 1 m to 50 m, 1 m to 20 m, 0.2 m to 10 m or 1 m to 10 m, and is preferably less than 100, 50, 20, or 10 m in thickness.
[0086] In some embodiments, a freestanding film is obtained by peeling the combined nano- to microscale polymer layer and second polymer layer from the substrate. This freestanding film comprising a nano- to microscale polymer layer adjacent to a second polymer layer may be referred to as a microsheet. In some embodiments, the substrate supporting the combined nano- to microscale polymer layer and second polymer layer is cut to a predetermined size and/or state before the microsheet is peeled away. In some embodiments, sacrificial polymer layer of a microsheet contains bioactive agents, antimicrobial agents, antibiofilm agents, microparticles, nanoparticles, magnetic particles as described in more detail below. In some embodiments, microparticles or nanoparticles in the sacrificial polymer layer contain bioactive agents or antimicrobial agents. In some embodiments, the second polymer layer comprises an antibiofilm agent. The technology is not limited in the antibiofilm agent that is used in embodiments of the device and associated method, kit, and method of treatment embodiments. For example, in some embodiments the antibiofilm agent is a small molecule antibiofilm agent, a charged small molecule antibiofilm agent, an antibiofilm polypeptide, an antibiofilm enzyme (e.g., Dispersin B), a metallic particle, or a metal ion antibiofilm agent (e.g., a metal ion, metal ion salt, or metal ion nanoparticle). Further, in some embodiments, the metal ion antibiofilm agent is a gallium ion, a gallium ion salt, a gallium ion nanoparticle, an alloy of gallium, or an alloy of gallium and silver.
[0087] D. Bioactive Agents
[0088] In some embodiments, the nano- to microscale polymeric sheets may function as a drug delivery scaffold to deliver one or more bioactive agents to the wound. Bioactive agents that may be desirable to deliver include, but are not limited to, trophic factors, extracellular matrices (ECMs), ECM fragments or synthetic constructs, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents (including antimicrobials, antivirals and antifungals), buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, anti-inflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents. In addition, would active agents include chlorhexidine, iodine based antimicrobials such as PVP-iodine; selenium based antimicrobials such as 7-azabenzisoselenazol-3(2H)-ones, selenium disulfide, and selenides; silver based antimicrobials (e.g., silver sulfadiazine, ionic silver, elemental silver, silver nanoparticles)) and gallium based antimicrobials. With respect to selenides, with the use of standard and variations of typical protein and carbohydrate attachment chemistries, carboxyl and amino containing selenides may be routinely attached to many polymers, peptides, antibodies, steroids and drugs. Polymers and other molecules with attached selenides generate superoxide in a dose dependent manner in biological solutions, in cells or attached to insoluble matrixes such as silicones.
[0089] A wide variety of bioactive agents can be incorporated into the polyelectrolyte layer or second polymer layer, referred to collectively as the microsheet. The present invention is not limited to a particular mechanism by which one or more bioactive agents are released from the microsheet. Indeed, an understanding of the mechanism is not necessary to practice the present invention. Nonetheless, in some embodiments, the present invention contemplates release of the one or more incorporated agents from the microsheet layers to the wound by diffusion from the polyelectrolyte layer. In other embodiments, the one or more bioactive agents may be released from the microsheet layers over time or in response to an environmental condition. The one or more bioactive agents may be attached by a degradable linkage, such as a linkage susceptible to degradation via hydrolysis or enzymatic degradation. The linkage may be one that is susceptible to degradation at a certain pH, for example.
[0090] In some embodiments, the one or more bioactive agents are applied to form a gradient with respect to the wound modifying agent. In general, the gradients present a higher contraction of bioactive agent at one or more first desired locations in the wound following application of the wound modifying agent to the wound and a lower concentration of bioactive agent at one or second location in the wound following application of the wound modifying agent to the wound. For example, the concentrations of the bioactive agents are layered in a wound bed in a gradient such that higher concentrations of a particular composition is greater proximal to the wound bed than distal to the wound bed in a vertical fashion. The converse, where concentrations of compositions is greater distal to the wound bed than proximal, is also contemplated. Concentration of compositions in a wound bed wherein a horizontal gradient is deposited is also contemplated. Topographical gradients are also contemplated, wherein compositions are deposited such that the concentrations of compositions in a wound bed or on a biocompatible particle follow the topography of the substrate, for example, a higher concentration of compositions is deposited in the valleys of undulations of an exemplary substrate compared to the peaks of the undulations.
[0091] In some embodiments, the gradient comprises a higher concentration of the bioactive agent in the center of the wound modifying agent which transitions to a lower concentration of the bioactive agent away from the center of the wound modifying agent. Accordingly, when the wound modifying agent is applied to a wound, the gradient results in a higher concentration of bioactive agent in the center of the wound and a lower concentration of bioactive agent as one moves to the periphery of the wound. In some embodiments, the gradient comprises a lower concentration of the bioactive agent in the center of the wound modifying agent which transitions to a higher concentration of the bioactive agent away from the center of the wound modifying agent. Accordingly, the gradient results in a lower concentration of bioactive agent in the center of the wound and a higher concentration of bioactive agent as one moves to the periphery of the wound. If two or more bioactive agents are utilized, they can be presented as similar gradients or the gradients can be varied so that the concentrations of the two or more bioactive agents vary across the wound. The gradients of high or low concentration can be any shape, such as circular, square, rectangular, oval, oblong, etc. so that the matrix and gradient can conform to a variety of wound shapes. For example, for long, incision type wound, the gradient may be centered on a longitudinal axis that extends along the length of the wound and can be centered on the wound. As another example, the gradient can be circular or oval-shaped for application to open type wounds, burns, sores and ulcers that are roughly circular or oval. In other embodiments, the gradients comprise a series of features arranged in a pattern. For example, the gradients can form a series of stripes or high and low concentrations of one or more bioactive agents along a longitudinal axis of the matrix. Alternatively, the gradients can form a checkerboard pattern, array, concentric circles, overlapping circles or oval, etc.
[0092] The present invention contemplates delivery of a wide variety of bioactive agents to the wound. In some embodiments, the present invention provides the delivery of trophic factors, including, but not limited to, agrin, amphiregulin, artemin, cardiotrophin-1, epidermal growth factors including EGF; fibroblast growth factors (e.g., FGF-1, FGF-2, FGF-3, FGF-4, FGF-5, FGF-6, and FGF-7); LIF, CSF-1, CSF-2, CSF-3, erythropoietin, endothelial cell growth factors including ECGF; FGF-related and ECGF-related growth factors (e.g., endothelial cell stimulating angiogenesis factor, tumor angiogenesis factor, retina-derived growth factor (RDGF), vascular endothelium growth factor (VEGF), brain-derived growth factors (BDGF-A and B), astroglial growth factors (AGF 1 and 2), omentum-derived growth factor, fibroblast-stimulating factor (FSF), and embryonal carcinoma-derived growth factor (ECDGF)); neurotrophic growth factors (e.g, nerve growth factors (NGFs), neurturin, brain-derived neurotrophic factor (BDNF), neurotrophin-3, neurotrophin-4, and ciliary neurotrophic factor (CNTF)); glial growth factors (e.g., GGF-I, GGF-II, GGF-III, glia maturation factor (GMF), and glial-derived neurotrophic factor (GDNF)); liver growth factors (e.g., hepatopoietin A, hepatopoietin B, and hepatocyte growth factors including HGF); prostate growth factors including prostate-derived growth factors (PGFs); mammary growth factors including mammary-derived growth factor 1 (MDGF-1) and mammary tumor-derived factor (MTGF); heart growth factors including nonmyocyte-derived growth factor (NMDGF); melanocyte growth factors including melanocyte-stimulating hormone (MSH) and melanoma growth-stimulating activity (MGSA); angiogenic factors (e.g., angiogenin, angiotropin, platelet-derived ECGF, VEGF, and pleiotrophin); transforming growth factors including TGF- and TGF-; TGF-like growth factors (e.g., TGF-beta.sub.1, TGF-beta.sub.2, TGF-beta.sub.3, GDF-1, CDGF, tumor-derived TGF-like factors, ND-TGF, and human epithelial transforming factor); regulatory peptides with growth factor-like properties (e.g., bombesin and bombesin-like peptides ranatensin and litorin, angiotensin, endothelin, atrial natriuretic factor, vasoactive intestinal peptide, and bradykinin); platelet-derived growth factors including PDGF-A, PDGF-B, and PDGF-AB; neuropeptides (e.g., substance P, calcitonin gene-regulated peptide (CGRP), and neuropeptide Y); neurotransmitters and their analogs including norepinephrine, acetylcholine and carbachol; hedgehog, heregulin/neuregulin, IL-1, osteoclast-activating factor (OAF), lymphocyte-activating factor (LAF), hepatocyte-stimulating factor (HSF), B-cell-activating factor (BAF), tumor inhibitory factor 2 (TIF-2), keratinocyte-derived T-cell growth factor (KD-TCGF), IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, stromal cell-derived cytokine (SCDC), IL-12, IL-13, IL-14, IL-15, insulin, insulin-like growth factors including IGF-1, IGF-2, and IGF-BP; interferons including INF-alpha, INF-beta, and INF-gamma; leptin, midkine, tumor necrosis factors (TNF-alpha and beta), netrins, saposins, semaphorins, somatrem, somatropin, stem cell factor, VVGF, bone morphogenetic proteins (BMPs), adhesion molecules, other cytokines, heparin-binding growth factors, and tyrosine kinase receptor ligands. In some embodiments, the bioactive agent is a peptide such as AcEEED, which is the N terminal peptide for alpha smooth muscle actin and has been shown to inhibit contractile properties of myofibroblasts.
[0093] In some embodiments, the present invention provides the delivery of ECMs, including, but not limited to native constructs, fragments of native constructs and synthetic analogs of: extracellular matrix proteins, reconstituted basement membrane-like complexes derived from eukaryotic cell lines, collagens, fibronectin, laminin, VCAM-1, vitronectin and gelatin, a bacterial extracellular matrix, a gel matrix, and polymeric matrices. In some embodiments, the bioactive agents are integrin binding sequences exemplified by, but not limited to RGD, EILDV, VCAM-1 and their recombined or synthetic analogs, enzymes, enzyme inhibitors, and polypeptides.
[0094] In some embodiments, the present invention provides the delivery of enzymes, including, but not limited to, exopeptidases and endopeptidases (also known as proteases and proteinases), including but not limited to the serine proteinases chymotrypsin, trypsin, elastase, and kallikrein, bacterial enzymes, the cysteine proteases papain, actinin, bromelain, cathepsins, cytosolic calpains, parasitic proteases, aspartic proteinases, the pepsin family of proteases pepsin and chymosin, lysosomal cathepsins D, renin, fungal proteases, the viral proteases, AIDS virus retropepsin, and the metalloproteinases (MMPs), collagenases, Maggott enzyme, MMP1, MMP2, MMP8, MMP13, gelatinases, MMP2, MMP9, MMP3, MMP7, MMP10, MMP11, and MMP12.
[0095] In some embodiments, the present invention provides the delivery of enzyme inhibitors, including, but not limited to captopril, thiorphan, phosphoramidon, teprotide, protease and proteinase inhibitors, metalloproteinase inhibitors and exopeptidase inhibitors.
[0096] In some embodiments, the present invention provides the delivery of defensins, including, but not limited to, alpha-defensins HNP 1, 2, 3 and 4, and beta-defensins HBD-1 and HBD-2.
[0097] In some embodiments, the present invention provides the delivery of polypeptides, including, but not limited to, fibronectin, serotonin, PAF, PDEGF, TNFa, IL1, IL6, IGF, IGF-1, IGF-2, IL-1, PDGF, FGF, KGF, VEGF, bradykinin, prothymosin-alpha, and thymosin-alphal.
[0098] In some embodiments, the present invention provides the delivery of antimicrobials, including, but not limited to, magainin (e.g., magainin I, magainin II, xenopsin, xenopsin precursor fragment, caerulein precursor fragment), magainin I and II analogs (e.g., PGLa, magainin A, magainin G, pexiganin, Z-12, pexigainin acetate, D35, MSI-78A, MGO (K10E, K11E, F12W-magainin 2), MG2+(K10E, F12W-magainin-2), MG4+(F12W-magainin 2), MG6+(f12W, E19Q-magainin 2 amide), MSI-238, reversed magainin II analogs (e.g., 53D, 87-ISM, and A87-ISM), Ala-magainin II amide, magainin II amide), cecropin P1, cecropin A, cecropin B, indolicidin, nisin, ranalexin, lactoferricin B, poly-L-lysine, cecropin A (1-8)-magainin II (1-12), cecropin A (1-8)-melittin (1-12), CA(1-13)-MA(1-13), CA(1-13)-ME(1-13), gramicidin, gramicidin A, gramicidin D, gramicidin S, alamethicin, protegrin, histatin, dermaseptin, lentivirus amphipathic peptide or analog, parasin I, lycotoxin I or II, globomycin, gramicidin S, surfactin, ralinomycin, valinomycin, polymyxin B, PM2 ((+/) 1-(4-aminobutyl)-6-benzylindane), PM2c ((+/)-6-benzyl-1-(3-carboxypropyl)indane), PM3 ((+/)1-benzyl-6-(4-aminobutyl)indane), tachyplesin, buforin I or II, misgurin, melittin, PR-39, PR-26, 9-phenylnonylamine, (KLAKKLA)n, (KLAKLAK)n, where n=1, 2, or 3, (KALKALK)3, KLGKKLG)n, and KAAKKAA)n, wherein N=1, 2, or 3, paradaxin, Bac 5, Bac 7, ceratoxin, mdelin 1 and 5, bombin-like peptides, PGQ, cathelicidin, HD-5, Oabac5alpha, ChBac5, SMAP-29, Bac7.5, lactoferrin, granulysin, thionin, hevein and knottin-like peptides, MPG1, lbAMP, snakin, lipid transfer proteins, and plant defensins. Exemplary sequences for the above compounds are provided in Table 1. In some embodiments, the antimicrobial peptides are synthesized from L-amino acids, while in other embodiments, the peptides are synthesized from, or comprise, D-amino acids.
TABLE-US-00001 TABLE 1 Antimicrobial Peptides SEQ ID NO: Name Organism Sequence 1 lingual antimicrobial Bos taurus mrlhhlllallflvlsagsgftqgvrnsqscrrnkgicvp peptide precursor ircpgsmrqigtclgaqvkccrrk (Magainin) 2 antimicrobial peptide Xenopus laevis gvlsnvigylkklgtgalnavlkq PGQ 3 Xenopsin Xenopus laevis mykgiflcvllavicanslatpssdadedndeveryvrgw askigqtlgkiakvglkeliqpkreamlrsaeaqgkrpwil 4 magainin precursor Xenopus laevis mfkglficsliavicanalpqpeasadedmderevrgigk flhsagkfgkafvgeimkskrdaeavgpeafadedldere vrgigkflhsakkfgkafvgeimnskrdaeavgpeafade dlderevrgigkflhsakkfgkafvgeimnskrdaeavgp eafadedlderevrgigkflhsakkfgkafvgeimnskrd aeavgpeafadedfderevrgigkilhsakkfgkafvgei mnskrdaeavgpeafadedlderevrgigkflhsaldcfgk afvgeimnskrdaeavddrrwve 5 tachyplesin I Tachypleus kwcfrvcyrgicyrrcr gigas 6 tachyplesin II Tachypleus rwcfrvcyrgicyrkcr gigas 7 buforin I Bufo bufo msgrgkqggkvrakaktrssraglqfpvgrvhrllrkgny gagarizans aqrvgagapvylaavleyltaeilelagnaardnkktrii prhlqlavrndeelnkllggvtiaqggvlpniqavllpkt esskpaksk 8 buforin II Bufo bufo trssraglqfpvgrvhrllrk gagarizans 9 cecropin A Bombyx mori mnfvrilsfvfalvlalgavsaapeprwklikkiekvgrn vrdglikagpaiavigqakslgk 10 cecropin B Bombyx mori mnfakilsfvfalvlalsmtsaapeprwkifkkiekmgrn irdgivkagpaievlgsakaigk 11 cecropin C Drosophila mnfykifvfvalilaisigqseagwlkklgkrierigqht melanogaster rdatiqglgiaqqaanvaatarg 12 cecropin P1 Sus scrofa swlsktakklensakkrisegiaiaiqggpr 13 indolicidin Bos taurus ilpwkwpwwpwrr 14 nisin Lactococcus itsislctpgcktgalmgcnmktatchcsihvsk lactis 15 ranalexin Rana flgglikivpamicavtkkc catesbeiana 16 lactoferricin B Bos taurus fkcrrwqwrmkklgapsitcvrraf 17 protegrin-1 Sus scrofa rggrlcycrrrfcvcvgrx 18 protegrin-2 Sus scrofa ggrlcycrrrfcicvg 19 histatin precursor Homo sapiens mkffvfalilalmlsmtgadshakrhhgykrkfhekhhsh rgyrsnylydn 20 histatin 1 Macaca dsheerhhgrhghhkygrkfhekhhshrgyrsnylydn fascicularis 21 dermaseptin Phyllomedusa alwktmlkklgtmalhagkaalgaaadtisqtq sauvagei 22 dermaseptin 2 Phyllomedusa alwftmlkklgtmalhagkaalgaaantisqgtq sauvagei 23 dermaseptin 3 Phyllomedusa alwknmlkgigklagkaalgavkklvgaes sauvagei 24 misgurin Misgurnus rqrveelskfskkgaaarrrk anguillicaudatus 25 melittin Apis mellifera gigavlkylttglpaliswisrkkrqq 26 pardaxin-1 Pardachirus gffalipkiisspliktllsavgsalsssgeqe pavoninus 27 pardaxin-2 Pardachirus gffalipkiisspifktllsavgsalsssggqe pavoninus 28 bactenecin 5 precursor Bos taurus metqraslslgrcslwllllglvlpsasaqalsyreavlr avdqfnersseanlyrlleldptpnddldpgtrkpvsfrv ketdcprtsqqpleqcdfkenglvkqcvgtvtldpsndqf dincnelqsvrfrppirrppirppfyppfrppirppifpp irppfrpplgpfpgrr 29 bactenecin precursor Bos taurus metpraslslgrwslwllllglalpsasaqalsyreavlr avdqlneqssepniyrlleldqppqddedpdspluvsfrv ketvcsrttqqppeqcdfkengllkrcegtvtldqvrgnf ditcnnhqsiritkqpwappqaarlcrivvirvcr 30 ceratotoxin A Ceratitis sigsalkkalpvakkigkialpiakaalp capitata 31 ceratotoxin B Ceratitis sigsafkkalpvakkigkaalpiakaalp capitata 32 cathelicidin Homo sapiens mktqrnghslgrwslvllllglvmplaiiaqvlsykeavl antimicrobial peptide raidginqrssdanlyrlldldprptmdgdpdtpkpvsft vketvcprttqqspedcdfkkdglvkrcmgtvtlnqargs fdiscdkdnkrfallgclffrkskekigkefkrivqrikdf lrnlvprtes 33 myeloid cathelicidin 3 Equus caballus metqrntrclgrwsplllllglvippattqalsykeavlr avdglnqrssdenlyrlleldplpkgdkdsdtpkpvsfmv ketvcprimkqtpeqcdfkenglvkqcvgtvildpvkdyf dascdepqrvkrfhsvgsliqrhqqmirdkseatrhgiri itrpklllas 34 myeloid antimicrobial Bos taurus metqraslslgrwslwllllglalpsasaqalsyreavlr peptide BMAP-28 avdqlneksseanlyrlleldpppkeddenpnipkpvsfr vketvcprtsqqspeqcdfkengllkecvgtvtldqvgsn fditcavpqsvgglrslgrkilrawkkygpiivpiirig 35 myeloid cathelicidin 1 Equus caballus metqrntrclgrwsplllllglvippattqalsykeavlr avdglnqrssdenlyrlleldplpkgdkdsdtpkpvsfmv ketvcprimkqtpeqcdfkenglvkqcvgtvilgpvkdhf dvscgepqrvkrfgrlaksflrmrillprrkillas 36 SMAP 29 Ovis aries metqraslslgrcslwllllglalpsasaqvlsyreavlr aadqlneksseanlyrlleldpppkqddensnipkpvsfr vketvcprtsqqpaeqcdfkengllkecvgtvtldqvrnn fditcaepqsvrglrrlgrkiahgvkkygptvlriiriag 37 BNP-1 Bos taurus rlcrivvirvcr 38 HNP-1 Homo sapiens acycripaciagerrygtciyqgrlwafcc 39 HNP-2 Homo sapiens cycripaciagerrygtciyqgrlwafcc 40 HNP-3 Homo sapiens dcycripaciagerrygtciyqgrlwafcc 41 HNP-4 Homo sapiens vcscrlvfcrrtelrvgncliggvsftycctrv 42 NP-1 Oryctolagus vvcacrralclprerragfcrirgrihplccrr cuniculus 43 NP-2 Oryctolagus vvcacrralclplerragfcrirgrihplccrr cuniculus 44 NP-3A Oryctolagus gicacrrrfcpnserfsgycrvngaiyyrccsrr cuniculus 45 NP-3B Oryctolagus grcycrkqllcsyrerrigdckirgvrfpfccpr cuniculus 46 NP-4 Oryctolagus vsctcrrfscgfgerasgsctvnggvrhtlccrr cuniculus 47 NP-5 Oryctolagus vfctcrgflcgsgerasgsctingvrhtlccrr cuniculus 48 RatNP-1 Rattus vtcycrrtrcgfrerlsgacgyrgriyrlccr norvegicus 49 Rat-NP-3 Rattus csclysscrfgerllsgacringriyrlcc norvegicus 50 Rat-NP-4 Rattus actcrigacvsgerltgacglngriyrlccr norvegicus 51 GPNP Guinea pig rrcicttrtcrfpyrrlgtcifqnrytfcc 52 beta defensin-3 Homo sapiens mrihyllfallflflvpvpghggiintlqkyycrvrggrc avlsclpkeeqigkcstrgrkccrrkk 53 theta defensin-1 Macaca mulatta rcictrgfcrcicrrgvc 54 defensin CUA1 Helianthus mkssmkmfaalllvvmcllanemggplvveartcesqshk annuus fkgtclsdtncanychserfsggkcrgfrrrcfctthc 55 defensin SD2 Helianthus mkssmkmfaalllvvmcllanemggplvveartcesqshk annuus fkgtclsdtncanychserfsggkcrgfrrrcfctthc 56 neutrophil defensin 2 Macaca mulatta acycripaclagerrygtcfymgrywafcc 57 4 KDA defensin Androctonus gfgcpfnqgachrhcrsirrrggycaglfkqtctcyr australis hector 58 defensin Mytilus gfgcpnnyqchrhcksipgrcggycggxhrlrctcyrc galloprovincialis 59 defensin AMP1 Heuchera dgvklcdvpsgtwsghcgssskcsqqckdrehfayggach sanguinea yqfpsykcfckrqc 60 defensin AMP1 Clitoria nlcerasltwtgncgntghcdtqcrnwesakhgachkrgn ternatea wkcfcyfnc 61 cysteine-rich Mus musculus mkklvllfalvllafqvqadsiqntdeetkteeqpgekdq cryptdin-1 homolog aysvsfgdpqgsalqdaalgwgrrcpqcprcpscpscprc prcprckcnpk 62 beta-defensin-9 Bos taums qgvrnfvtcrinrgfcvpircpghrrqigtclgpqikccr 63 beta-defensin-7 Bos taums qgvrnfvtcrinrgfcvpircpghrrqigtclgprikccr 64 beta-defensin-6 Bos taums qgvrnhvtcriyggfcvpircpgrtrqigtcfgrpvkccrrw 65 beta-defensin-5 Bos taums qvvrnpqscrwnmgvcipiscpgnmrqigtcfgprvpccr 66 beta-defensin-4 Bos taums qrvrnpqscrwnmgvcipflcrvgmrqigtcfgprvpccrr 67 beta-defensin-3 Bos taurus qgvrnhvtcrinrgfcvpircpgrtrqigtcfgprikccrsw 68 beta-defensin-10 Bos taurus qgvrsylscwgnrgicllnrcpgrmrqigtclaprvkccr 69 beta-defensin-13 Bos taurus sgisgpiscgrnggvcipircpvpmrqigtcfgrpvkccrsw 70 beta-defensin-1 Bos taurus dfaschtnggiclpnrcpghmiqigicfrprvkccrsw 71 coleoptericin Zophobas slqggapnfpqpsqqnggwqvspdlgrddkgntrgqieiq atratus nkgkdhdfnagwgkvirgpnkakptwhvggtyrr 72 beta defensin-3 Homo sapiens mrihyllfallflflvpvpghggiintiqkyycrvrggrc aviscipkeeqigkcstrgrkccrrkk 73 defensin C Aedes aegypti atcdllsgfgvgdsacaahciargnrggycnskkvcvcrn 74 defensin B Mytilus edulis gfgcpndypchrhcksipgryggycggxhrlrctc 75 sapecin C Sarcophaga atcdllsgigvqhsacalhcvfrgnrggyctgkgicvcrn peregrina 76 macrophage antibiotic Oryctolagus mrtlallaaillvalqaqaehvsysidevvdqqppqaedq peptide MCP-1 cuniculus dvaiyvkehessalealgvkagvvcacrralclprerrag fcrirgrihplccrr 77 cryptdin-2 Mus musculus mkplvllsalvllsfqvqadpiqntdeetkteeqsgeedq avsvsfgdregaslqeeslrdlvcycrtrgckrrermngt crkghlmytlcc 78 cryptdin-5 Mus musculus mktfvllsalvllafqvqadpihktdeetnteeqpgeedq avsisfggqegsalheelskklicycrirgckrrervfgt crnlfltfvfccs 79 cryptdin 12 Mus musculus lrdlycycrargckgrermngtcrkghllymlccr 80 defensin Pyrrhocoris atcdilsfqsqwvtpnhagcalhcvikgykggqckitychcrr apterus 81 defensin R-5 Rattus vtcycrstrcgfrerlsgacgyrgriyrlccr norvegicus 82 defensin R-2 Rattus vtcscrtsscrfgerlsgacringriyrlcc norvegicus 83 defensin NP-6 Oryctolagus gicacrrrfclnfeqfsgycrvngaryvrccsrr cuniculus 84 beta-defensin-2 Pan troglodytes mrvlyllfsflfiflmplpgvfggisdpvtclksgaichp vfcprrykqigtcglpgtkcckkp 85 beta-defensin-2 Homo sapiens mrvlyllfsflfiflmplpgvfggigdpvtclksgaichp vfcprrykqigtcglpgtkcckkp 86 beta-defensin-1 Homo sapiens mrtsylllftclllsemasggnfltglghrsdhyncvss ggqclysacpiftkiqgtcyrgkakcck 87 beta-defensin-1 Capra hircus mrlhhlllvlfflvlsagsgftqgirsrrschrnkgvcal trcprnmrqigtcfgppvkccrkk 88 beta defensin-2 Capra hircus mrlhhlllalfflvlsagsgftqgiinhrscyrnkgvcap arcprnmrqigtchgppvkccrkk 89 defensin-3 Macaca mrtlvilaaillvalqaqaeplqartdeataaqeqiptdn mulatta pevvvslawdeslapkdsvpglrknmacycripaclager rygtcfyrrrywafcc 90 defensin-1 Macaca mrtivilaaillvalqaqaeplqartdeataaqeqiptdn mulatta pevvvslawdeslapkdsvpglrknmacycripaclager rygtcfylgrvwafcc 91 neutrophil defensin 1 Mesocricetus vtcfcrrrgcasrerhigycrfgntiyrlccrr auratus 92 neutrophil defensin 1 Mesocricetus cfckrpvcdsgetqigycrlgutfyrlccrq auratus 93 Gallinacin 1-alpha Gallus gallus grksdcfrkngfcaflkcpyltlisgkcsrfhlcckriw 94 defensin Allomyrina vtcdllsfeakgfaanhslcaahclaigrrggscergvcicrr dichotoma 95 neutrophil cationic Cavia porcellus rrcicttrtcrfpyrrlgtcifqnrvytfcc peptide 1
[0099] In some embodiments, the present invention provides the delivery of antimicrobials, including, but not limited to, loracarbef, cephalexin, cefadroxil, cefixime, ceftibuten, cefprozil, cefpodoxime, cephradine, cefuroxime, cefaclor, neomycin/polymyxin/bacitracin, dicloxacillin, nitrofurantoin, nitrofurantoin macrocrystal, nitrofurantoin/nitrofuran mac, dirithromycin, gemifloxacin, ampicillin, gatifloxacin, penicillin V potassium, ciprofloxacin, enoxacin, amoxicillin, amoxicillin/clavulanate potassium, clarithromycin, levofloxacin, moxifloxacin, azithromycin, sparfloxacin, cefdinir, ofloxacin, trovafloxacin, lomefloxacin, methenamine, erythromycin, norfloxacin, clindamycin/benzoyl peroxide, quinupristin/dalfopristin, doxycycline, amikacin sulfate, vancomycin, kanamycin, netilmicin, streptomycin, tobramycin sulfate, gentamicin sulfate, tetracyclines, framycetin, minocycline, nalidixic acid, demeclocycline, trimethoprim, miconazole, colistimethate, piperacillin sodium/tazobactam sodium, paromomycin, colistin/neomycin/hydrocortisone, amebicides, sulfisoxazole, pentamidine, sulfadiazine, clindamycin phosphate, metronidazole, oxacillin sodium, nafcillin sodium, vancomycin hydrochloride, clindamycin, cefotaxime sodium, co-trimoxazole, ticarcillin disodium, piperacillin sodium, ticarcillin disodium/clavulanate potassium, neomycin, daptomycin, cefazolin sodium, cefoxitin sodium, ceftizoxime sodium, penicillin G potassium and sodium, ceftriaxone sodium, ceftazidime, imipenem/cilastatin sodium, aztreonam, cinoxacin, erythromycin/sulfisoxazole, cefotetan disodium, ampicillin sodium/sulbactam sodium, cefoperazone sodium, cefamandole nafate, gentamicin, sulfisoxazole/phenazopyridine, tobramycin, lincomycin, neomycin/polymyxin B/gramicidin, clindamycin hydrochloride, lansoprazole/clarithromycin/amoxicillin, alatrofloxacin, linezolid, bismuth subsalicylate/metronidazole/tetracycline, erythromycin/benzoyl peroxide, mupirocin, fosfomycin, pentamidine isethionate, imipenem/cilastatin, troleandomycin, gatifloxacin, chloramphenicol, cycloserine, neomycin/polymyxin B/hydrocortisone, ertapenem, meropenem, cephalosporins, fluconazole, cefepime, sulfamethoxazole, sulfamethoxazole/trimethoprim, neomycin/polymyxin B, penicillins, rifampin/isoniazid, erythromycin estolate, erythromycin ethylsuccinate, erythromycin stearate, ampicillin trihydrate, ampicillin/probenecid, sulfasalazine, sulfanilamide, sodium sulfacetamide, dapsone, doxycycline hyclate, trimenthoprim/sulfa, methenamine mandelate, plasmodicides, pyrimethamine, hydroxychloroquine, chloroquine phosphate, trichomonocides, anthelmintics, atovaquone, bacitracin, bacitracin/polymyxin b, gentamycin, neomycin/polymyxin/dexameth, neomycin sulf/dexameth, sulfacetamide/prednisolone, sulfacetamide/phenylephrine, tobramycin sulfate/dexameth, bismuth tribromophenate, silver ion compounds, silver nanoparticles, zerovalent silver, multivalent silver, elemental silver, and silver containing compounds such as silver sulfadiazine and related compounds, gallium ion compounds, gallium ion salst, a gallium ion nanoparticles, alloys of gallium, and alloys of gallium and silver.
[0100] In some embodiments, the present invention provides the delivery of antivirals, including, but not limited to, amantadine, acyclovir, foscarnet, indinavir, ribavirin, enfuvirtide, emtricitabine, lamivudine, abacavir sulfate, fomivirsen, valacyclovir, tenofovir, cidofovir, atazanavir, amprenavir, delavirdine mesylate, famciclovir, adefovir, didanosine, efavirenz, trifluridine, inidinavir, lamivudine, vidarabine, lopinavir/ritonavir, ganciclovir, zanamivir, abacavir/lamivudine/zidovudine, lamivudine/zidovudine, nelfinavir, nelfinavir mesylate, nevirapine, ritonavir, saquinavir, saquinavir mesylate, rimantadine, stavudine, docosanol, zalcitabine, idoxuridine, zidovudine, zidovudine/didanosine, valganciclovir, penciclovir, lamivudine, and oseltamivir.
[0101] In some embodiments, the present invention provides the delivery of antifungals, including, but not limited to, amphotericin B, nystatin, nystatin/triamcinolone, itraconazole, ketoconazole, miconazole, sulconazole, clotrimazole, clotrimazole/betamethasone, enilconazole, econazole, oxiconazole, tioconazole, terconazole, butoconazole, thiabendazole, flucytosine, butenafine, ciclopirox, haloprogin, naftifine, tolnaftate, natamycin, undecylenic acid, mafenide, dapsone, clioquinol, clioquinol/hydrocortisone, potassium iodide, silver sulfadiazine, gentian violet, carbol-fuchsin, cilofungin, sertaconazole, voriconazole, fluconazole, terbinafine, caspofungin, other topical azole drugs, and griseofulvin. In some embodiments, the present invention provides the use and delivery of buffering agents, including, but not limited to, Maleic acid, Phosphoric acid, Glycine, Chloroacetic acid, Formic acid, Benzoic acid, Acetic acid, Pyridine, Piperazine, MES, Bis-tris, Carbonate, ACES, ADA MOPSO, PIPES, Phosphoric acid, BES, MOPS, TES, HEPES, DIPSO, TAPSO, Triethanolamine, HEPSO, Tris, Tricine, Bicine, TAPS, Borate, Ammonia, CHES, Ethanolamine, CAPSO, Glycine, Carbonate, CAPS, Methylamine, Piperidine, and Phosphoric acid.
[0102] In some embodiments, the present invention provides the delivery of vitamins and minerals, including, but not limited to, Vitamin A, Carotenoids, Vitamin D, Vitamin E, Vitamin K, Vitamin C/ascorbic acid, B1/thiamin, B2/riboflavin, B3/niacin, B5/pantothenic acid, B6/pyridoxine, B12/cobalamin, Biotin, Calcium, Magnesium, Phosphorus, Sodium, Chloride, Potassium, Boron, Chromium, Copper, Iodine, Iron, Manganese, Selenium, and Zinc.
[0103] In some embodiments, the present invention provides the delivery of analgesics, including, but not limited to, acetaminophen, anileridine, acetylsalicylic acid, buprenorphine, butorphanol, fentanyl, fentanyl citrate, codeine, rofecoxib, hydrocodone, hydromorphone, hydromorphone hydrochloride, levorphanol, alfentanil hydrochloride, meperidine, meperidine hydrochloride, methadone, morphine, nalbuphine, opium, levomethadyl, hyaluronate sodium, sufentanil citrate, capsaicin, tramadol, leflunomide, oxycodone, oxymorphone, celecoxib, pentazocine, propoxyphene, benzocaine, lidocaine, dezocine, clonidine, butalbital, phenobarbital, tetracaine, phenazopyridine, sulfamethoxazole/phenazopyridine, and sulfisoxazole/phenazopyridine.
[0104] In some embodiments, the present invention provides the delivery of local anesthetics (which may also be analgesics as is known in the art), including, but not limited to, amylocaine, ambucaine, articaine, benzocaine, benzonatate, bupivacaine, butacaine, butanilicaine, chloroprocaine, cinchocaine, cyclomehtycaine, dibucaine, diperodon, dimethisoquin, dimethocaine, eucaine, etidocaine, hexylcaine, fomocaine, fotocaine, hydroxyprocaine, isobucaine, levobupivicaine, iodocaine, mepivacaine, meprylcaine, metabutoxycaine, nitracaine, orthocaine, oxetacaine, oxybuprocaine, paraethocycaine, phenacaine, piperocaine, piridocaine, pramocaine, prilocaine, primacaine, procaine, procainamide, proparacaine, propoxycaine, pyrrocaine, quinisocaine, ropivacaine, trimecaine, tetracaine, tolycaine, and tropacocaine.
[0105] In some embodiments, the present invention provides the delivery of opioid antagonists and/or mixed opioid agonist/antagonists (which may also be opioid analgesic as is known in the art), including, but not limited to, naloxone, diprenorphine, naltrexone, buprenorphine, bupremorphine/naloxone, nalodeine, nalorphine, levallorphan, nalmefene, naloxol, alvimopan, naldemedine, eluxadoline, asimadoline, naloxegol, methylnaltrexone, dezocine, naloxegol, eptazocine, butorphanol, levorphanol, nalbuphine, pentazocine, phenazocine, cyprodime, naltrindole, norbinaltorphimine, and J113,393.
[0106] In some embodiments, the present invention provides the delivery of anticoagulants, including, but not limited to, coumarins, 1,3-indandione, anisindione, fondaparinux, heparin, lepirudin, antithrombin, warfarin, enoxaparin, dipyridamole, dalteparin, ardeparin, nadroparin, and tinzaparin.
[0107] In some embodiments, the present invention provides the delivery of coagulation factors, including, but not limited to, Factor I (fibrinogen), Factor II (prothrombin), Factor III (thromboplastin, tissue factor), Factor IV (calcium), Factor V (labile factor), Factor VII (stable factor), Factor VIII (antihemophilic globulin, antihemophilic globulin, antihemophilic factor A), Factor IX (plasma thromboplastin component, Christmas factor, antihemophilic factor B), Factor X (Stuart factor, Prower factor, Stuart-Prower factor), Factor XI (plasma thromboplastin antecedent, antihemophilic factor C), Factor XII (Hageman factor, surface factor, contact factor), and Factor XIII (fibrin stabilizing factor, fibrin stabilizing enzyme, fibri-nase).
[0108] In some embodiments, the present invention provides the delivery of anti-inflammatory agents, including, but not limited to, non steroidal anti-inflammatory drugs (NSAIDs) including diclofenac (also known as Voltaren, Abitren, Allvoran, Almiral, Alonpin, Anfenax, Artrites, Betaren, Blesin, Bolabomin, Cataflam, Clofec, Clofen, Cordralan, Curinflam, Diclomax, Diclosian, Dicsnal, Difenac, Ecofenac, Hizemin, Inflamac, Inflanac, Klotaren, Lidonin, Monoflam, Naboal, Oritaren, Remethan, Savismin, Silino, Staren, Tsudohmin, Voltarol, Voren, Voveran, and Vurdon), diflunisal (also known as Dolobid, Adomal, Diflonid, Diflunil, Dolisal, Dolobis, Dolocid, Donobid, Dopanone, Dorbid, Dugodol, Flovacil, Fluniget, Fluodonil, Flustar, Ilacen, Noaldol, Reuflos, and Unisal), etodolac (also known as Lodine), fenoprofen (also known as Nalfon, Fenoprex, Fenopron, Fepron, Nalgesic, and Progesic), flurbiprofen (also known as Ansaid and Ocuflur), ibuprofen (also known as Rufen, Motrin, Aches-N-Pain, Advil, Nuprin, Dolgesic, Genpril, Haltran, Ibifon, Ibren, Ibumed, Ibuprin, Ibupro-600, Ibuprohm, Ibu-Tab, Ibutex, Ifen, Medipren, Midol 200, Motrin-IB, Cramp End, Profen, Ro-Profen, Trendar, Alaxan, Brofen, Alfam, Brufen, Algofen, Brufort, Amersol, Bruzon, Andran, Buburone, Anflagen, Butacortelone, Apsifen, Deflem, Artofen, Dolgit, Artril, Dolocyl, Bloom, Donjust, Bluton, Easifon, Ebufac, Emflam, Emodin, Fenbid, Fenspan, Focus, Ibosure, Ibufen, Ibufug, Ibugen, Ibumetin, Ibupirac, Imbun, Inabrin, Inflam, Irfen, Librofen, Limidon, Lopane, Mynosedin, Napacetin, Nobafon, Nobgen, Novogent, Novoprofen, Nurofen, Optifen, Paduden, Paxofen, Perofen, Proartinal, Prontalgin, Q-Profen, Relcofen, Remofen, Roidenin, Seclodin, Tarein, and Zofen), indomethacin (also known as Indameth, Indocin, Amuno, Antalgin, Areumatin, Argilex, Artherexin, Arthrexin, Artrinovo, Bavilon, Bonidon, Boutycin, Chrono-Indocid, Cidalgon, Confortid, Confortind, Domecid, Durametacin, Elemetacin, Idicin, Imbrilon, Inacid, Indacin, Indecin, Indocap, Indocen, Indocid, Indoflex, Indolag, Indolar, Indomed, Indomee, Indometacinum, Indometicina, Indometin, Indovis, Indox, Indozu, Indrenin, Indylon, Inflazon, Inpan, Lauzit, Liometace, Metacen, Metindon, Metocid, Mezolin, Mobilan, Novomethacin, Peralgon, Reflox, Rheumacid, Rheumacin, Salinac, Servindomet, Toshisan, and Vonum), ketoprofen (also known as Orudis, Alrheumat, Alrheumun, Alrhumat, Aneol, Arcental, Dexal, Epatec, Fastum, Keduril, Kefenid, Keprofen, Ketofen, Ketonal, Ketosolan, Kevadon, Mero, Naxal, Oruvail, Profenid, Salient, Tofen, and Treosin), ketorolac (also known as Toradol), meclofenamate (also known as Meclofen, Meclomen, and Movens), mefenamic acid (also known as Ponstel, Alpain, Aprostal, Benostan, Bonabol, Coslan, Dysman, Dyspen, Ecopan, Lysalgo, Manic, Mefac, Mefic, Mefix, Parkemed, Pondex, Ponsfen, Ponstan, Ponstyl, Pontal, Ralgec, and Youfenam), nabumetone (also known as Relafen), naproxen (also known as Naprosyn, Anaprox, Aleve, Apranax, Apronax, Arthrisil, Artrixen, Artroxen, Bonyl, Congex, Danaprox, Diocodal, Dysmenalgit, Femex, Flanax, Flexipen, Floginax, Gibixen, Headlon, Laraflex, Laser, Leniartil, Nafasol, Naixan, Nalyxan, Napoton, Napren, Naprelan, Naprium, Naprius, Naprontag, Naprux, Napxen, Narma, Naxen, Naxid, Novonaprox, Nycopren, Patxen, Prexan, Prodexin, Rahsen, Roxen, Saritilron, Sinartrin, Sinton, Sutony, Synflex, Tohexen, Veradol, Vinsen, and Xenar), oxaprozin (also known as Daypro), piroxicam (also known as Feldene, Algidol, Antiflog, Arpyrox, Atidem, Bestocam, Butacinon, Desinflam, Dixonal, Doblexan, Dolonex, Feline, Felrox, Fuldin, Indene, Infeld, Inflamene, Lampoflex, Larapam, Medoptil, Novopirocam, Osteral, Pilox, Piraldene, Piram, Pirax, Piricam, Pirocam, Pirocaps, Piroxan, Piroxedol, Piroxim, Piton, Posidene, Pyroxy, Reucam, Rexicam, Riacen, Rosic, Sinalgico, Sotilen, Stopen, and Zunden), sulindac (also known as Clinoril, Aflodac, Algocetil, Antribid, Arthridex, Arthrocine, Biflace, Citireuma, Clisundac, Imbaral, Lindak, Lyndak, Mobilin, Reumofil, Sudac, Sulene, Sulic, Sulindal, Suloril, and Sulreuma), tolmetin (also known as Tolectin, Donison, Midocil, Reutol, and Safitex), celecoxib (also known as Celebrex), meloxicam (also known as Mobic), rofecoxib (also known as Vioxx), valdecoxib (also known as Bextra), aspirin (also known as Anacin, Ascriptin, Bayer, Bufferin, Ecotrin, and Excedrin) and steroidal anti-inflammatory drugs including cortisone, prednisone and dexamethasone.
[0109] In some embodiments, the present invention provides the delivery of vasoconstrictors, including, but not limited to, epinephrine (adrenaline, Susphrine), phenylephrine hydrochloride (Neo-Synephrine), oxymetazoline hydrochloride (Afrin), norepinephrine (Levophed), and caffeine.
[0110] In some embodiments, the present invention provides the delivery of vasodilators, including, but not limited to, bosentan (Tracleer), epoprostenol (Flolan), treprostinil (Remodulin), sitaxsentan, nifedipine (Adalat, Procardia), nicardipine (Cardene), verapamil (Calan, Covera-HS, Isoptin, Verelan), diltiazem (Dilacor XR, Diltia XT, Tiamate, Tiazac, Cardizem), isradipine (DynaCirc), nimodipine (Nimotop), amlodipine (Norvasc), felodipine (Plendil), nisoldipine (Sular), bepridil (Vascor), hydralazine (Apresoline), minoxidil (Loniten), isosorbide dinitrate (Dilatrate-SR, Iso-Bid, Isonate, Isorbid, Isordil, Isotrate, Sorbitrate), isorbide mononitrate (IMDUR), prazosin (Minipress), cilostazol (Pletal), treprostinil (Remodulin), cyclandelate, isoxsuprine (Vasodilan), nylidrin (Arlidin), nitrates (Deponit, Minitran, Nitro-Bid, Nitrodisc, Nitro-Dur, Nitrol, Transderm-Nitro), benazepril (Lotensin), benazepril and hydrochlorothiazide (Lotensin HCT), captopril (Capoten), captopril and hydrochlorothiazide (Capozide), enalapril (Vasotec), enalapril and hydrochlorothiazide (Vaseretic), fosinopril (Monopril), lisinopril (Prinivil, Zestril), lisinopril and hydrochlorothiazide (Prinzide, Zestoretic), moexipril (Univasc), moexipril and hydrochlorothiazide (Uniretic), perindopril (Aceon), quinapril (Accupril), quinapril and hydrochlorothiazide (Accuretic), ramipril (Altace), trandolapril (Mavik), papaverine (Cerespan, Genabid, Pavabid, Pavabid HP, Pavacels, Pavacot, Pavagen, Pavarine, Pavased, Pavatine, Pavatym, Paverolan).
[0111] In some embodiments, the present invention provides the delivery of diuretics, including, but not limited to, acetazolamide (Diamox), dichlorphenamide (Daranide), methazolamide (Neptazane), bendroflumethiazide (Naturetin), benzthiazide (Exna), chlorothiazide (Diuril), chlorthalidone (Hygroton), hydrochlorothiazide (Esidrix, HydroDiuril, Microzide), hydroflumethiazide (Diucardin), indapamide (Lozol), methyclothiazide (Enduron), metolazone (Zaroxolyn, Mykrox), polythiazide (Renese), quinethazone (Hydromox), trichlormethiazide (Naqua), bumetanide (Bumex), ethacrynic acid (Edecrin), furosemide (Lasix), torsemide (Demadex), amiloride (Midamor), amiloride and hydrochlorothiazide (Moduretic), spironolactone (Aldactone), spironolactone and hydrochlorothiazide (Aldactazide), triamterene (Dyrenium), triamterene and hydrochlorothiazide (Dyazide, Maxzide).
[0112] In some embodiments, the present invention provides the delivery of anti-cancer agents, including, but not limited to, aldesleukin, alemtuzumab, alitretinoin, allopurinol, altretamine, amifostine, anagrelide, anastrozole, arsenic trioxide, asparaginase, bexarotene, bicalutamide, bleomycin, busulfan, calusterone, capecitabine, carboplatin, carmustine, celecoxib, chlorambucil, cisplatin, cladribine, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, darbepoetin alpha, daunorubicin, daunomycin, dexrazoxane, docetaxel, doxorubicin, epoetin alpha, estramustine, etoposide, etoposide phosphate, exemestane, filgrastim, floxuridine, fludarabine, flutamide, fulvestrant, gemcitabine, gemtuzumab ozogamicin, goserelin acetate, hydroxyurea, ibritumomab tiuxetan, idarubicin, ifosfamide, imatinib mesylate, interferon alpha-2a, interferon alpha-2b, irinotecan, leflunomide, letrozole, leucovorin, levamisole, lomustine, meclorethamine (nitrogen mustard), megestrol acetate, melphalan, mercaptopurine, mesna, methotrexate, methoxsalen, mitomycin C, mitotane, mitoxantrone, mycophenolate mofetil, nandrolone phenpropionate, nilutamide, nofetumomab, oprelvekin, oxaliplatin, paclitaxel, pamidronate, pegademase, pegaspargase, pegfilgrastim, pentostatin, pipobroman, plicamycin, porfimer sodium, procarbazine, quinacrine, rasburicase rituximab, sargramostim, streptozocin, tacrolimus, tamoxifen, temozolomide, teniposide, testolactone, thioguanine, thiotepa, topotecan, toremifene, tositumomab, trastuzumab, tretinoin, uracil mustard, valrubicin, vinblastine, vincristine, vinorelbine, and zoledronate.
[0113] In other embodiments, the bioactive agent is an siRNA. The RNAi constructs of the present invention are gene(s) that express RNAs that base pair to form a dsRNA RNA region. The RNAs may be a part of the same molecule or different molecules. In preferred embodiments, the RNAi construct comprises a promoter operably linked to a nucleic acid sequence encoding two complementary sequences separated by a loop sequence. The complementary regions correspond to a target RNA sequence separated by a loop sequence. When the RNAi construct is expressed, the complementary regions of the resulting RNA molecule pair with one another to form a double stranded RNA region. The present invention is not limited to loop sequences of any particular length. In some preferred embodiments, the loop sequences range from about 4 to about 20 nucleotides in length. In more preferred embodiments, the loop sequences are from about 6 to about 12 nucleotides in length. In other preferred embodiments, the dsRNA regions are from about 19 to about 23 in length.
[0114] In other embodiments, the dsRNA is formed from RNA transcribed from a vector as two separate stands. In other embodiments, the two strands of DNA used to form the dsRNA may belong to the same or two different duplexes in which they each form with a DNA strand of at least partially complementary sequence. When the dsRNA is thus-produced, the DNA sequence to be transcribed is flanked by two promoters, one controlling the transcription of one of the strands, and the other that of the complementary strand. These two promoters may be identical or different. In some embodiments, a DNA duplex provided at each end with a promoter sequence can directly generate RNAs of defined length, and which can join in pairs to form a dsRNA. See, e.g., U.S. Pat. No. 5,795,715, incorporated herein by reference. RNA duplex formation may be initiated either inside or outside the cell.
[0115] It will be recognized that after processing the resulting siRNA can comprise two blunt ends, one blunt end and one end with an overhang, or two ends with overhangs. In some embodiments, the end or ends with overhangs comprise an overhang of either one or two nucleotides. As a non-limiting example, a siRNA of 23 nucleotides in length comprises two 19mers with a two nucleotide overhang at each end. As another non-limiting example, a siRNA of 21 nucleotides in length comprises two 19mers with a single nucleotide overhang at each end. As still another non-limiting example, a siRNA of 22 nucleotides in length comprises two 22mers with no overhangs at either end.
[0116] Inhibition is sequence-specific in that nucleotide sequences corresponding to the duplex region of the RNA are targeted for genetic inhibition. RNA molecules containing a nucleotide sequence identical to a portion of the target gene are preferred for inhibition. RNA sequences with insertions, deletions, and single point mutations relative to the target sequence have also been found to be effective for inhibition. Thus, sequence identity may optimized by sequence comparison and alignment algorithms known in the art (see Gribskov and Devereux, Sequence Analysis Primer, Stockton Press, 1991, and references cited therein) and calculating the percent difference between the nucleotide sequences by, for example, the Smith-Waterman algorithm as implemented in the BESTFIT software program using default parameters (e.g., University of Wisconsin Genetic Computing Group). Greater than 90% sequence identity, or even 100% sequence identity, between the inhibitory RNA and the portion of the target gene is preferred. Alternatively, the duplex region of the RNA may be defined functionally as a nucleotide sequence that is capable of hybridizing with a portion of the target gene transcript.
[0117] There is no upper limit on the length of the dsRNA that can be used. For example, the dsRNA can range from about 21 base pairs (bp) of the gene to the full length of the gene or more. In one embodiment, the dsRNA used in the methods of the present invention is about 1000 bp in length. In another embodiment, the dsRNA is about 500 bp in length. In yet another embodiment, the dsRNA is about 22 bp in length. In some preferred embodiments, the sequences that mediate RNAi are from about 21 to about 23 nucleotides. The isolated iRNAs of the present invention mediate degradation of the target RNA.
[0118] The double stranded RNA of the present invention need only be sufficiently similar to natural RNA that it has the ability to mediate RNAi for the target RNA. In one embodiment, the present invention relates to RNA molecules of varying lengths that direct cleavage of specific mRNA to which their sequence corresponds. It is not necessary that there be perfect correspondence of the sequences, but the correspondence must be sufficient to enable the RNA to direct RNAi cleavage of the target mRNA. In a particular embodiment, the RNA molecules of the present invention comprise a 3 hydroxyl group.
[0119] E. Medical Devices
[0120] In some embodiments, the present invention provides a freestanding microsheet of a desired size and shape as described above, preferably comprising a bioactive compound (e.g., antimicrobial silver compounds, antimicrobial gallium compounds, or analgesic compounds). The microsheet may preferably be provided in a desired size and shape by cutting the substrate material to a desired size and shape and peeling the microsheet from the substrate. The microsheet may then be applied to a biological surface such as a wound or a medical surface such as the surface of a medical device such as wound covering.
[0121] In some embodiments, the microsheet is used to modify a wound dressing or biologic wound dressing that is compatible with functionalization by addition of a matrix material. Examples of commercially available wound dressings that can be modified by addition of a microsheet include, but are not limited to, Biobrane, gauze, adhesive tape, bandages such as Band-Aids, and other commercially available wound dressings including but not limited to COMPEEL, DUODERM, TAGADERM, and OPSITE. In some embodiments, the present invention provides methods for transferring a polymer multilayer to a desired surface, such as soft surface. Such soft surfaces include, but are not limited to, skin, a wound bed, a tissue, artificial tissues including artificial skin tissues such as organotypically cultured skin tissues, Apligraf, Dermagraft, Oasis, Transcyte, Cryoskin and Myskin, artificial tissue matrices, gels comprising biomolecules, a wound dressing, and a biologic wound dressing. In some embodiments, the desired surface is contacted with a polymer multilayer, e.g., a polymer multilayer supported on a support and pressure is applied to effect transfer of the polymer multilayer from the support to the desired surface. In some embodiments, the pressure is from about 10 to about 500 kPa. In some embodiments, the transfer is performed in the substantial, or complete, absence of solution. Such dry transfer processes do not involve exposure of biological components of the desired surface to aqueous solutions containing species that may influence the activity of the biological components. In some embodiments, the transfer is performed through a gas phase. In some embodiments, the transfer is performed in an environment where the humidity is less than 100% of saturation. In some embodiments, the transfer is performed in the absence of liquid water.
[0122] Accordingly, in some embodiments, the present invention provides wound dressings comprising a support material having a surface oriented to a wound, wherein the surface oriented to the wound is modified with a microsheet material of the present invention. When applied to a wound, the surface of the support material modified with the matrix material is put into contact with the wound bed.
[0123] In some embodiments, the support is a biologic wound dressing. In some embodiments, the biologic wound dressing is a type of wound dressing that comprises, e.g., is coated with or incorporates, cells (e.g., keratinocytes or fibroblasts and combinations thereof) and/or one or more biomolecules or fragments of biomolecules that can be placed in contact with the wound surface. The biomolecules may be provided in the form of an artificial tissue matrix comprising one or more biomolecules. Examples of such biomolecules include, but are not limited, to collagen, glycosaminoglycans, hyaluronic acid, laminin, vitronectin, fibronectin, keratin, antimicrobial polypeptides and combinations thereof. Examples of suitable biologic wound dressings include, but are not limited to, BIOBRANE, Integra, Apligraf, Dermagraft, Oasis, Transcyte, Cryoskin and Myskin.
[0124] In some embodiments, the microsheets are sued to modify a biosynthetic wound dressing constructed of an elastomeric film (e.g., a silicone film) supported on support material, such as a fabric, preferably a polymeric fabric such as a nylon fabric. In some embodiments, the fabric is at least partially imbedded into the film (e.g., BioBrane). In some embodiments, the elastomeric film is coated with one or more biomaterials, for example collagen, keratin, fibronectin, vitronectin, laminin and combinations thereof. Accordingly, the fabric presents to the wound bed a complex 3-D structure to which a biomaterial (e.g., collagen) has been bound, preferably chemically bound. In some preferred embodiments, the surface presented to the wound is further modified with a microsheet material as described above. In some preferred embodiments, the microsheet material is a polyelectrolyte membrane comprising a bioactive agent, preferably selected from one or more of silver nanoparticles, elemental silver, and silver containing compounds such as silver sulfadiazine and/or gallium ions and related compounds, and preferably included in the concentration ranges described above. In some embodiments, the microsheet further comprises nanoscale or microscale particles.
[0125] In some embodiments, the microsheet is used to modify an adhesive bandage comprising an adhesive portion (such as an adhesive strip) and an absorbent material, preferably treated or coated with a material (i.e., a non-adherent material) to prevent adhesion to the wound or comprising a layer of non-adherent material, such as Teflon, on the surface of the absorbent pad that will contact the wound. In some embodiments, the support material is an absorbent pad (e.g., a gauze pad or polymer foam) preferably treated or coated with a material (i.e., a non-adherent material) to prevent adhesion to the wound or comprising a layer of non-adherent material, such as Teflon or other suitable material, on the surface of the absorbent pad that will contact the wound. In some embodiments, the non-adhesive material or layer is breathable. In some embodiments, the wound dressing comprises a gel-forming agent, for example, a hydrocolloid such as sodium carboxymethylcellulose. In some embodiments, the absorbent pads or gel-forming agents are affixed to a material that is waterproof and/or breathable. Examples include, but are not limited, semipermeable polyurethane films. The waterproof and/or breathable material may further comprise an adhesive material for securing the bandage to the skin of a subject. The waterproof and/or breathable material preferably forms the outer surface of the adhesive bandage or pad, i.e., is the surface opposite of the surface comprising the matrix which contacts the wound. Examples of such adhesive bandages and absorbent pads include, but are not limited to, to adhesive bandages and pads from the Band-Aid line of wound dressings, adhesive bandages and pads from the Nexcare line of wound dressings, adhesive bandages and non-adhesive pads from the Kendall Curity Tefla line of wound dressings, adhesive bandages and pads from the Tegaderm line of wound dressings, adhesive bandages and pads from the Steri-Strip line of wound dressings, the COMFEEL line of wound dressings, adhesive bandages and pads, the Duoderm line of wound dressings, adhesive bandages and pads, the TEGADERM line of wound dressings, adhesive bandages and pads, the OPSITE line of wound dressings, adhesive bandages and pads, adhesive bandages and pads from the Allevyn line of wound dressings, adhesive bandages and pads from the Duoderm line of wound dressings, and adhesive bandages and pads from the Xeroform line of wound dressings.
[0126] In some embodiments, the nanoscale polymer matrix is used to modify a medical device such as a surgical mesh. Examples of commercially available surgical meshes that can be modified by addition of a matrix as described below include, but are not limited to, polypropyelene, polyester, polytetrafluoroethylene meshes, or absorbable biomeshes, or biological meshes (biomeshes), including but not limited to ULTRAPRO mesh, PROCEED mesh, PROLENE polypropyelene mesh, Ethicon Physiomesh, MERSILENE polyester mesh, PARIETEX mesh, DOLPHIN polypropylene mesh, GORE INFINIT mesh, PERFIX, KUGEL, 3DMAX, BARD, VISILEX, XENMATRIX, ALLOMAX, SURGISIS BIODESIGN, and TIGR MATRIX.
[0127] G. Use of Matrices
[0128] In some embodiments, a microsheet as described above is applied to a wound under conditions such that wound healing, as measured by wound contraction, is accelerated. In some embodiments of the invention, the microsheet containing one or more bioactive agents is transferred to a wound or tissue so that the sacrificial polymer layer lies on top of the nanoscale polymer layer after transfer to the wound or tissue. In some embodiments, a wound dressing is placed on top of the sacrificial polymer layer before or after the sacrificial polymer layer is dissolved or partially dissolved in an aqueous liquid. In some embodiments, a nanoscale polymer matrix made with PEMs containing one or more bioactive agents and a dissolvable sacrificial second polymer layer is transferred to a wound or tissue surface such that sacrificial layer dissolves completely in wound and PEMs are in direct contact with the wound tissue and a primary/secondary wound dressing placed over the wound. In some embodiments, the primary dressing is a biologic dressing and the nanoscale polymer matrix does not hinder integration of biologic dressing in the wound-bed.
[0129] In some embodiments, the microsheets are provided as kits, preferably with the microsheet in a sterile package. In some embodiments the microsheet provided in the kit comprises at least one bioactive agent. In other embodiments, the kits comprise a bioactive agent and instructions from applying the bioactive agent to the matrix prior to application to a wound.
[0130] A microsheet with one or more bioactive agents, as described above, can be applied to all types of wounds. Furthermore, a wound modifying agent with one or more bioactive agents can be applied to skin, mucous membranes, body cavities, and to internal surfaces of bones, tissues, etc. that have been damaged. A microsheet with one or more bioactive agents can be used on wounds such as cuts, abrasions, ulcers, surgical incision sites, burns, and to treat other types of tissue damage. In some embodiments of the present invention, the microsheets enhance wound healing. The present invention contemplates that wound healing may be enhanced in a variety of ways. In some embodiments, the compositions and methods minimize contracture of the wound as to best favor function and cosmesis. In some embodiments, compositions and methods promote wound contracture to best favor function and cosmesis. In some embodiments, the compositions and methods promote vascularization. In some embodiments, the compositions and methods inhibit vascularization. In some embodiments, the compositions and methods promote fibrosis. In some embodiments, the compositions and methods inhibit fibrosis. In some embodiments, the compositions and methods promote epithelial coverage. In some embodiments, the compositions and methods inhibit epithelial coverage. In some embodiments, the compositions and methods of the present invention modulates one or properties of cells in the wound environment or in the immediate vicinity of the wound. The properties that are modulated, e.g., are increased or decreased, include, but are not limited to adhesion, migration, proliferation, differentiation, extracellular matrix secretion, phagocytosis, MMP activity, contraction, and combinations thereof. The microsheets of the present invention can be covered with a secondary dressing, or bandage, if desired to protect the layer or to provide additional moisture absorption, for example.
EXPERIMENTAL
[0131] The examples below serve to further illustrate the invention, to provide those of ordinary skill in the art with a complete disclosure and description of how the compounds, compositions, articles, devices, and/or methods claimed herein are made and evaluated, and are not intended to limit the scope of the invention. The examples are not intended to restrict the scope of the invention.
Example 1
A. Coating and Release
[0132] Materials. [0133] 1. 20 mM solution of polycation (polyallylamine hydrochloride, PAH) at pH=6.8-7.2. [0134] 2. 20 mM solution of polyanion (polyacrylic acid, PAA) at pH=2.1-2.3. [0135] 3. 10 mM solution of active agent (silver nitrate). [0136] 4. 1 mM solution of reducing agent (sodium borohydride). [0137] 5. 21% aqueous solution of polyvinyl alcohol on weight basis. [0138] 6. A flexible polymeric sheet of thickness 1-10 mil (1 mil=1/1000 inch) pre-coated with a release layer as substrate for depositing polyelectrolyte multilayers.
[0139] Procedure. [0140] 1. Coat a polyelectrolyte multilayer comprising of 10 bilayers of PAH and PAA via layer-by-layer assembly by incubating the substrate in aqueous solutions of PAH and PAA for 6 min each mediated by rinsing and drying after each incubation step. [0141] 2. Load silver into polyelectrolyte multilayer coating by [0142] a. Incubating polyelectrolyte multilayer supported on the substrate in silver nitrate solution for 30 min followed by rinsing with water and drying. Incubate in sodium borohydride solution for 1 min followed by rinsing. [0143] b. Repeat (a.) [0144] c. Incubating polyelectrolyte multilayer supported on the substrate in silver nitrate solution for 30 min followed by rinsing with water and drying. [0145] 3. Cast a 20 m (dry thickness) PVA film over silver loaded polyelectrolyte multilayer supported on the substrate [0146] 4. Obtain a freestanding film by peeling the coating off the substrate.
Results.
[0147] Each substrate was evaluated based on the following Yes/No tests and the results are documented in the table below: [0148] 1. Based on visual inspection, did polyelectrolyte multilayer coating detach partially or completely from the substrate after the completion of Procedure step #1? [0149] 2. Based on visual inspection, did polyelectrolyte multilayer coating detach partially or completely from the substrate after the completion of Procedure step #2? [0150] 3. Based on visual inspection, did polyelectrolyte multilayer coating transfer completely from the substrate to PVA coating after the completion of Procedure step #4?
TABLE-US-00002 PEM Silver Peeling and Coating loading Complete Detachment Detachment Transfer without (Yes/ (Yes/ Tears (Yes/ Substrate No/Slight) No/Slight) No/Slight) 3M Scotchpak No No No 9742 Release Liner Linear Release <100 g/in* 3M Scotchpak No No No 1022 Release Liner Linear Release <100 g/in* 3M Scotchpak No No No 9744 Release Liner Linear Release <100 g/in* 3M Scotchpak No No No 9755 Release Liner Linear Release <40 g/in* Saint Gobain No No Yes 4130 Release Coating Liner Release <10 g/in** Saint Gobain 4150 Release Coating No Slight Yes Liner Release N/A Saint Gobain No No Yes 8711 Release Coating Liner Release <15-50 g/in** Saint Gobain No No Yes 7819 Release Coating Liner Release <10 g/in** Pass Criteria No No Yes *Test method not available **Saint Gobain Test #125 Wet Spread Release
B. Process
[0151] Materials
[0152] 1. 20 mM solution of polycation (polyallylamine hydrochloride, PAH, 150 kDa) at pH=6.8-7.2. (unless otherwise noted) [0153] 2. 20 mM solution of polyanion (polyacrylic acid, PAA, 100 kDa) at pH=2.1-2.3. (unless otherwise noted) [0154] 3. S mM solution of active agent (silver nitrate). [0155] 4. R mM solution of reducing agent (sodium borohydride). [0156] 5. 21.25% aqueous solution of polyvinyl alcohol. [0157] 6. A flexible polymeric sheet pre-coated with a release layer as substrate for depositing poly electrolyte multilayers.
[0158] Procedure [0159] 1. Coat a polyelectrolyte multilayer comprising of N bilayers of PAH and PAA via layer-by-layer assembly by incubating the substrate in aqueous solutions of PAH and PAA for X s (or min) each mediated by rinsing and drying after each incubation step. [0160] 2. Load silver into polyelectrolyte multilayer coating by [0161] a. Incubating polyelectrolyte multilayer supported on the substrate in silver nitrate solution for Y s (or min) followed by rinsing with water and drying. Incubate in sodium borohydride solution for 1 min followed by rinsing. [0162] b. Repeat (a.) n times [0163] c. Incubating polyelectrolyte multilayer supported on the substrate in silver nitrate solution for Y s (or min) followed by rinsing with water and drying. [0164] 3. Measure silver loading in the films by extracting silver from films into nitric acid and analyzing the extract using Inductively Coupled PlasmaOptical Emission Spectroscopy (ICP-OES).
[0165] Results [0166] 1. Y=30 min, N=10, n=2, R=1 mM
TABLE-US-00003 TABLE Silver loading (g/cm.sup.2) in polyelectrolyte multilayers: Silver Loading S X = 10 s X = 30 s X = 1 min 10 mM 5.8 0.5 5.7 0.5 5.7 0.7 100 mM 6.4 0.6 7.0 0.5 7.2 0.5 [0167] 2. X=6 min, n=2, R=1 mM
TABLE-US-00004 TABLE Silver loading (g/cm.sup.2) in polyelectrolyte multilayers: Silver Loading S N Y = 1 min Y = 8 min Y = 60 min 10 mM 10 8.24 0.3 7.2 0.3 9.1 0.2 100 mM 4 N/A 2.3 0.1 2.5 0.2 100 mM 10 9.2 1.4 10.6 0.8 11.4 0.2 [0168] 3. X=6 min,
TABLE-US-00005 TABLE Silver loading (g/cm.sup.2) in polyelectrolyte multilayers: Silver Loading N S R n Y = 20 min 20 10 mM 1 mM 1 10.9 20 10 mM 10 mM 1 12.4 15 10 mM 1 mM 2 9.5 15 10 mM 10 mM 2 15.8 10 10 mM 10 mM 4 16.0 [0169] 4. X=6 min, Y=60 min, N=10, n=2, S=10 mM, R=1 mM, Mw PAH=150 kDa
TABLE-US-00006 TABLE Silver loading (g/cm.sup.2) in polyelectrolyte multilayers: Mw PAA Mw PAA Silver (5 kDa) (100 kDa) Loading 100% (w/w) 0% (w/w) 8.62 0.62 0% (w/w) 100% (w/w) 6.41 0.53 70% (w/w) 30% (w/w) 17.79 0.44 30% (w/w) 70% (w/w) 7.99 0.89
[0170] All publications and patents mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described method and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in relevant fields are intended to be within the scope of the following claims.