Therapeutic peptides

11607443 · 2023-03-21

Assignee

Inventors

Cpc classification

International classification

Abstract

Compositions containing micropeptides capable of modulating the accumulation of miRs involved in certain pathologies, and the use of these micropeptides for treating the certain pathologies. Also, methods of identifying these micropeptides modulating the accumulation of miRs involved in pathologies. Further, nuclei acids encoding those micropeptides that modulate the accumulation of miRs involved in pathologies.

Claims

1. A pharmaceutical composition comprising: a miPEP consisting of SEQ ID NO: 11 745, SEQ ID NO: 11 747, or SEQ ID NO: 11 749, or a fragment of said miPEP consisting of: SEQ ID NO: 11 751, SEQ ID NO: 11 752, or SEQ ID NO: 11 753, said miPEP, or said fragment of said miPEP, being capable of modulating the accumulation of said miR in a eukaryotic cell; or a nucleic acid consisting of SEQ ID NO: 11 746, SEQ ID NO: 11 748, or SEQ ID NO: 11 750, said nucleic acid encoding said miPEP, or a nucleic acid encoding said fragment of said miPEP, said miPEP, or said fragment of said miPEP, being capable of modulating the accumulation of said miR in a eukaryotic cell, and a pharmaceutically acceptable excipient.

2. The pharmaceutical composition of claim 1, wherein said miPEP is identified, or as identified, by implementing of a process for identifying a miPEP modulating the accumulation of a miR involved in osteoporosis, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide, in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in osteoporosis.

3. The pharmaceutical composition of claim 1, wherein said miPEP, or said fragment of said miPEP, is fused or linked to one or more molecules facilitating the entry of the miPEP, or miPEP fragment, into the cell.

4. The pharmaceutical composition of claim 1, wherein said miPEP, or fragment of said miPEP, is fused in N-ter or in C-ter to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754).

5. A method of treatment of osteoporosis comprising the administration of a microRNA encoded PEPtides (miPEP), or a fragment of said miPEP, as a drug, wherein said miPEP consists of: SEQ ID NO: 11 745, SEQ ID NO: 11 747 or SEQ ID NO: 11 749, or said fragment of said miPEP consists of: SEQ ID NO: 11 751, SEQ ID NO: 11 752 or SEQ ID NO: 11 753, the sequence of which is encoded by a nucleotide sequence contained in the primary transcript of a microRNA (miR), said miPEP or said fragment of said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, which miR regulates expression of at least one gene involved in said osteoporosis.

6. The method of claim 5, wherein said miPEP is identified, or as identified, by implementing of a process for identifying a miPEP modulating the accumulation of a miR involved in osteoporosis, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide, in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in said osteoporosis.

7. The method of claim 5, wherein said miPEP is encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the group consisting of: miR15a-16-1, miR125a-1, and miR145-2 .

8. The method of claim 5, wherein said miPEP, or said fragment of said miPEP, is fused or linked to one or more molecules facilitating the entry of the miPEP, or miPEP fragment, into the cell.

9. The method of claim 5, wherein said miPEP, or fragment of said miPEP, is fused in N-ter or in C-ter to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754).

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1: List indicating the corresponding miPEPs and miORPs, as well as the associated miRs.

(2) FIG. 2: Expression of the iBSP gene in mesenchymal stem cells cultured in DIF+BMP4 medium in presence of miPEP//125a-1.

(3) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//125a-1, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the iBSP gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(4) FIG. 3: Expression of the PTHR1 gene in mesenchymal stem cells cultured in DIF+BMP4 medium in presence of miPEP//125a-1.

(5) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//125a-1, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the PTHR1. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(6) FIG. 4: Expression of the STMN2 gene in mesenchymal stem cells cultured in DIF+BMP4 medium in presence of miPEP//125a-1.

(7) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//125a-1, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the STMN2 gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(8) FIG. 5: Expression of the OSTERIX gene in mesenchymal stem cells cultured in DIF+BMP4 medium in presence of miPEP//125a-1.

(9) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//125a-1, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the OSTERIX gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(10) FIG. 6: Expression of the STMN2 gene in mesenchymal stem cells cultured in DIF+BMP4 medium in presence of miPEP//145-2.

(11) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//145-2, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the STMN2 gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(12) FIG. 7: Expression of the STMN2 gene in mesenchymal stem cells cultured in DIF 4 BMP4 medium in presence of miPEP//125a-1.

(13) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//125a-1, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the STMN2 gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(14) FIG. 8: Expression of the OSTERIX gene in mesenchymal stem cells cultured in DIF BMP4 medium in presence of miPEP//125a-1.

(15) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//125a-1, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the OSTERIX gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(16) FIG. 9: Expression of the STMN2 gene in mesenchymal stem cells cultured in DIF 4 BMP4 medium in presence of miPEP//145-2.

(17) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//145-2, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the STMN2 gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(18) FIG. 10: Expression of the OSTERIX gene in mesenchymal stem cells cultured in DIF BMP4 medium in presence of miPEP//145-2.

(19) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//145-2, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the OSTERIX gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(20) FIG. 11: Expression of the STMN2 gene in mesenchymal stem cells cultured in DIF BMP4 medium in presence of miPEP//145-2.

(21) The mesenchymal stem cells were treated for 4 days with 100 μM of miPEP//145-2, with 100 μM of control peptide (ScmiPEP//125a) or untreated (NT). The y-axis indicates the relative expression of the STMN2 gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(22) FIG. 12: Entry of miPEP//15a-16-FAM in mesenchymal stem cells.

(23) The undifferentiated mesenchymal stem cells were treated for 6 hours with miPEP//15a-16-1-1-FAM at 5 μM (A), 10 μM (B), 50 μM (C) or 100 μM (D).

(24) FIG. 13: Entry of miPEP//15a-16-FAM in mesenchymal stem cells.

(25) The undifferentiated mesenchymal stem cells were treated with 100 μM of miPEP//15a-16-1-1-FAM for 2 hours (A), 4 hours (B), 6 hours (C), 8 hours (D) and 24 hours (E).

(26) FIG. 14: Entry of miPEP//15a-16-FAM-TAT in mesenchymal stem cells.

(27) The undifferentiated mesenchymal stem cells were treated for 6 hours with miPEP//15a-16-1-1-FAM-TAT at 5 μM (A), 10 μM (B), 20 μM (C), 50 μM (D) or 100 μM (E).

(28) FIG. 15: Entry of miPEP//15a-16-FAM-TAT in mesenchymal stem cells.

(29) The undifferentiated mesenchymal stem cells were treated for 2 hours with miPEP//15 a-16-1-1-FAM-TAT at 10 μM.

(30) FIG. 16: Accumulation of the miR16-1 precursor in the presence of miPEP//15a-16-1-TAT.

(31) The mesenchymal stem cells were treated with 10 μM of miPEP//15a-16-1-TAT, treated with 10 μM of control peptide (ScmiPEP//21-1) or untreated (NT) for 3 hours. The amount of miR16-1 precursor in cells has been measured by quantitative RT-PCR. The measurement of the amount of miR16-1 precursor was normalized with respect to the PPIA household gene. Analyzes and statistics were performed with the Mann-Withney test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

(32) FIG. 17: Evaluation of the effects of miPEP125a-1 on bone formation in vivo.

(33) Nude mice were grafted with

(34) A. the biomaterial alone, B. mesenchymal stem cells mixed with biomaterial (granules of βTCP [20/80]), C. & D. mesenchymal stem cells pretreated for 4 days with miPEP//125a-1 mixed with biomaterial (granules of βTCP [20/80]), E. & F. mesenchymal stem cells pre-treated 4 days with the control miPEP (scramble) mixed with biomaterial (granules of βTCP [20/80]).

(35) For D. and F. conditions, mice also received regular injections (once a week) of either miPEP//125a-1 (D) or scramble miPEP (F) during the study. After 4 weeks, the mice are euthanized and the grafts were then isolated, fixed, included in methacrylate, cut and treated for histology. The cuts were scanned (NDPview) and bone formation (dark grey) is evaluated (A to F) and is also quantified (G) using the Fiji image analysis software and the total area of new bone is reported to the total area of the cut

(36) With regard to microscopic photographs A to F, the scale is indicated in the figure. For G, the y-axis indicates the percentage of bone formation and the statistical analyzes were performed with the paired t-test (p-value: * p<0.05; ** p<0.01 and *** p<0.001).

DETAILED DESCRIPTION

(37) In one aspect, the invention relates to a pharmaceutical composition comprising: a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, and a pharmaceutically acceptable excipient.

(38) In the invention, the terms “microARN”, “non coding microARN” and “miR” are equivalent and may be used interchangeably. They define small molecules of RNA of about 21 nucleotides, which are not translated and do not lead to a peptide or a protein.

(39) However, in this mature form, the microRNAs perform a function of regulation of certain genes via post-transcriptional mechanisms, for example by means of the RISC complex.

(40) The primary transcript of the microRNA or “pri-miR” corresponds to the RNA molecule obtained directly from transcription of the DNA molecule. Generally, this primary transcript undergoes one or more post-transcriptional modifications, involving for example a particular structure of the RNA or cleavage of certain portions of the RNA, and which lead to the precursor form of the microRNA or “pre-miR”, then to the mature form of the microRNA or “miR”.

(41) The terms “micropeptides” and “miPEPs” (microRNA encoded PEPtides) are equivalent and may be used interchangeably. They define a peptide that is encoded by an open reading frame present on the primary transcript of a microRNA, and which is capable of modulating the accumulation of said microRNA. The micropeptides within the meaning of the present invention are not to be understood as necessarily being small peptides, as “micro” does not correspond to the size of the peptide.

(42) According to the invention, a miPEP can also be considered as a transcription modulator, and in particular a transcription activator. Such a transcription modulator can operate at the transcription level to modulate the accumulation of pri-miR, pre-miR and miR.

(43) Taking into account the degeneracy of the genetic code, one and the same micropeptide may be encoded by several nucleotide sequences. Nucleotide sequences of this kind, differing from one another by at least one nucleotide but encoding one and the same peptide, are called “degenerate sequences”.

(44) The terms “open reading frame” or “ORF” are equivalent and may be used interchangeably. They correspond to a nucleotide sequence in a DNA or RNA molecule that may potentially encode a peptide or a protein: said open reading frame begins with a start codon (the start codon generally encoding a methionine), followed by a series of codons (each codon encoding an amino acid), and ends with a stop codon (the stop codon not being translated).

(45) In the invention, the ORFs may be called specifically “miORFs” when they are present on the primary transcripts of microRNA.

(46) The miORFs may be contained in the 5′ or 3′ portion of said primary microAR transcript, preferably in the 5′ portion.

(47) The 5 or 3 portions of the primary microRNA transcript correspond to the terminal portions of the RNA molecule that are cleaved during microRNA processing.

(48) The miORFs as defined in the particular invention may have a size from 12 to 1503 nucleotides and may encode peptides from 3 to 500 amino acids.

(49) In particular, the miORFs encode miPEPs having a size of: 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499 or 500 amino acids.

(50) The miPEPs may especially have a size from 100 to 500 amino acids, from 101 to 500 amino acids, from 200 to 500 amino acids, from 300 to 500 amino acids, or from 400 to 500 amino acids.

(51) According to the invention, a “miPEP fragment” corresponds to an N-terminal part, a C-terminal part or an internal part of the sequence of a miPEP.

(52) In others words, a “miPEP fragment” corresponds to a part of a miPEP containing the first N-terminal amino acid, to a part of the miPEP containing the last C-terminal amino acid or to a part containing neither the first N-terminal amino acid or the last C-terminal amino acid.

(53) In particular, a miPEP fragment has a size from 2 to 20 amino acids, preferably from 5 to 10 amino acids.

(54) In particular, a miPEP fragment has a size of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids.

(55) Preferably, a miPEP fragment has a size of 10 amino acids and corresponds to the N-terminal portion of a miPEP.

(56) In the present invention, a miPEP fragment may be referred to as “miPEP//”.

(57) In the invention, “accumulation” means the production of a molecule, such as a microRNA or a micropeptide, in the cell.

(58) The accumulation of a microRNA or a micropeptide can be determined using assay methods known to those skilled in the art, such as for example by RT-qPCR or by the quantification of the fluorescence due to the fusion of a peptide or protein to a fluorescent marker.

(59) Thus, “modulation” of the accumulation of a molecule in a cell corresponds to a modification of the quantity of this molecule present in the cell.

(60) Moreover, the effect of a miPEP can be observed through the modulation of the accumulation of the miR, but also through the modulation of the accumulation of the corresponding pri-miR or pre-miR.

(61) In one embodiment, the invention relates to a composition as defined above, wherein the modulation of the accumulation of said microRNA is a decrease or an increase in the accumulation of said microRNA, in particular an increase.

(62) A “decrease in the accumulation” corresponds to a decrease in the quantity of said molecule in a cell relative to a control cell.

(63) Conversely, an “increase in the accumulation” corresponds to an increase in the quantity of said molecule in a cell relative to a control cell.

(64) According to the invention, a miPEP is capable of modulating the accumulation of pri-miR, pre-miR and miR. Therefore, if a primary transcript contains more than one miR, a same miPEP encoded by said primary transcript is capable of modulating the accumulation of at least one of the miRs present on the primary transcript.

(65) In a particular embodiment, the invention relates to a pharmaceutical composition comprising: a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, which miR regulates expression of at least one gene involved in a pathology, a pharmaceutically acceptable excipient.

(66) According to the invention, said pharmaceutical composition comprises at least one miPEP but may also comprise a mixture of several miPEPs.

(67) In a nonlimiting manner, said pharmaceutical composition may for example comprise 2, 3, 4, 5, 6, 7, 8, 9 or 10 miPEPs.

(68) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP is selected from the group of miPEPs consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875.

(69) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP is selected from the group of miPEPs consisting of:

(70) TABLE-US-00001 miPEP 145-2  (MVGLNPPLWQETGEYT, SEQ ID NO: 11 745),  miPEP 125a-1  (MSLCLSPSLTPTPGSTGPPHTMLPVSRSLRPFNL, SEQ ID NO: 11 747), ant  miPEP 15a-16-1  (MFKHRFFYMHSFFPERKYFLYSLGANVCLKKIKPWSKV  AAHNGLWILKRCRPYCAASKIQGSDLLKKIYFFLFIALMIAMSAVP,  SEQ ID NO: 11 749). 

(71) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751 (MVGLNPPLWQ).

(72) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is the miPEP//145-2 consisting of SEQ ID NO: 11 751 (MVGLNPPLWQ).

(73) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752 (MSLCLSPSLT).

(74) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is the miPEP//125a-1 consisting of SEQ ID NO: 11 752 (MSLCLSPSLT).

(75) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753 (MFKHRFFYMH).

(76) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is the miPEP//15a-16-1 consisting of SEQ ID NO: 11 753 (MFKHRFFYMH).

(77) The list of all miPEPs, and corresponding miORPs, is presented in FIG. 1 and is incorporated in this application.

(78) In a particular embodiment, the pharmaceutical compositions comprising the miPEPs are in the form of a unit dose comprising from 10.sup.−4 M to 10.sup.−10 M of miPEP.

(79) In a particular embodiment, the compositions according to the invention can be administered in one or more times.

(80) In a particular embodiment, the pharmaceutical compositions are suitable for oral, ocular, nasal, parenteral (intravenous, intraarterial, subcutaneous, intradermal, intramuscular), rectal, vaginal, topical or auricular administration.

(81) In a particular embodiment, the miPEP can be vectorized or encapsulated.

(82) In the invention, the miPEP, or the fragment of said miPEP, may be fused or linked to one or more molecules facilitating the entry of the miPEP, or miPEP fragment, into the cell.

(83) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP, or said fragment of said miPEP, is fused to a peptide facilitating the entry into the cell of the miPEP, or miPEP fragment.

(84) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP, or said fragment of said miPEP, is fused to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754).

(85) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP, or said fragment of said miPEP, is fused in N-ter or in C-ter to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754).

(86) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP fragment is selected from:

(87) TABLE-US-00002 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(88) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP, or said fragment of said miPEP, is fused to penetratin, to a polyhistidine peptide (in particular a peptide of at least 6 histidine residues) or to a polyarginine peptide (in particular a peptide of 9 arginine residues).

(89) In a particular embodiment, the invention relates to a pharmaceutical composition as defined above, wherein said miPEP, or said fragment of said miPEP, is linked to one or more palmitic acid molecules.

(90) The amount of miPEP present in the composition or used for the treatment of a pathology may vary depending on whether or not the miPEP is modified with a molecule facilitating cell penetration.

(91) In another aspect, the invention relates to a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, for its use as a drug.

(92) In a particular embodiment, the invention relates to a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, which miR regulates expression of at least one gene involved in a pathology, for its use as a drug.

(93) In the invention, a gene is involved in a pathology if the expression of said gene varies significantly between a patient suffering from said pathology and a healthy individual.

(94) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being identified, or as identified, by implementing of a process for identifying a miPEP modulating the accumulation of a miR involved in a pathology, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide,

(95) in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in a pathology.

(96) In the invention, a miR is involved in a pathology if said miR is capable of regulating the expression of a gene involved in said pathology and/or of reducing the symptoms of said pathology.

(97) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from those presented in Tables 2, 3, 4, 5 and 6.

(98) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the group consisting of:

(99) hsa-mir-103-1, hsa-mir-103-2, hsa-mir-107, hsa-mir-122, hsa-mir-155, hsa-mir-21, hsa-mir-33, hsa-mir-15a, hsa-miR-15b, hsa-mir-451, hsa-mir-92a-1, hsa-mir-92a-2, hsa-mir-92b, hsa-mir-208, hsa-mir-208b, hsa-mir-29a, hsa-mir-29b-1, hsa-mir-29b-2, hsa-mir-29c, hsa-mir-143, hsa-mir-145, hsa-mir-206, hsa-mir-378, hsa-mir-34a, hsa-mir-34b, hsa-mir-34c, hsa-let-7, hsa-mir-16-1, hsa-mir-16-2 and hsa-mir-125a.

(100) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the group consisting of: hsa-mir-125a, hsa-mir-15a-16-1 and hsa-mir145.

(101) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being selected from the group consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875.

(102) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being selected from the group consisting of: miPEP 145-2 (SEQ ID NO: 11745), miPEP 125a-1 (SEQ ID NO: 11747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(103) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(104) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being miPEP//145-2 consisting of SEQ ID NO: 11 751.

(105) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(106) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(107) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753.

(108) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(109) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, wherein said miPEP, or said fragment of said miPEP, is fused to the TAT peptide.

(110) In a particular embodiment, the invention relates to a miPEP fragment for its use as defined above, said miPEP fragment being selected from:

(111) TABLE-US-00003 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(112) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, wherein said miPEP, or said fragment of said miPEP, being fused to penetratin, to a polyhistidine peptide (in particular a peptide of at least 6 histidine residues) or to a polyarginine peptide (in particular a peptide of 9 arginine residues).

(113) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, wherein said miPEP, or said fragment of said miPEP, being linked to one or more palmitic acid molecules.

(114) Another aspect of the invention relates to a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, for its use in the treatment of a pathology selected from: cancer, bacterial infections, mycoses, cardiovascular diseases, hereditary congenital diseases, skin diseases, eye diseases, diseases of the digestive system, diseases of the endocrine system, diseases of the nervous system, diseases related to viruses, diseases related to nutrition and metabolism, lymphatic diseases and hemopathies, neonatal and hereditary diseases, respiratory diseases, urogenital diseases in humans, urogenital diseases in women, disorders of the immune system, musculoskeletal disorders, diseases or trauma of bone tissue or cartilage tissue.

(115) Another aspect of the invention relates to a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue.

(116) In the invention, the term “bone tissue disease” refers to any disease reducing bone capital, such as osteoporosis.

(117) In the invention, the term “bone tissue trauma” refers to a break in continuity or fracture of a bone.

(118) In a particular embodiment, the invention relates to a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, for its use as defined above, which miR regulates expression of at least one gene involved in a pathology.

(119) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being identified, or as identified, by implementing of a process for identifying a miPEP modulating the accumulation of a miR involved in a pathology, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide,

(120) in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in a pathology.

(121) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being selected from the group consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875.

(122) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being selected from the group consisting of: miPEP 145-2 (SEQ ID NO: 11745), miPEP 125a-1 (SEQ ID NO: 11747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(123) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(124) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being miPEP//145-2 consisting of SEQ ID NO: 11 751.

(125) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(126) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(127) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753.

(128) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP fragment being miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(129) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, wherein said miPEP, or said fragment of said miPEP, is fused to the TAT peptide.

(130) In a particular embodiment, the invention relates to a miPEP fragment for its use as defined above, said miPEP fragment being selected from:

(131) TABLE-US-00004 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(132) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, wherein said miPEP, or said fragment of said miPEP, being fused to penetratin, to a polyhistidine peptide (in particular a peptide of at least 6 histidine residues) or to a polyarginine peptide (in particular a peptide of 9 arginine residues).

(133) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, wherein said miPEP, or said fragment of said miPEP, being linked to one or more palmitic acid molecules.

(134) Tables 2 to 6 present the different miRs and the pathologies in which they are involved.

(135) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a cancer, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the cancer-related miRs in Table 2, particularly among the cancer-related miRs in Table 5.

(136) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a bacterial infection or mycosis, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the bacterial infection- and mycosis-related miRs in Table 2, particularly among the bacterial infection- and mycosis-related miRs in Table 5.

(137) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a cardiovascular disease, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the cardiovascular disease-related miRs in Table 2, particularly among the cardiovascular disease-related miRs in Table 5.

(138) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a hereditary congenital disease, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the hereditary congenital disease-related miRs in Table 2, particularly among the hereditary congenital disease-related miRs in Table 5.

(139) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a skin disease, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the skin disease-related miRs in Table 2, particularly among the skin disease-related miRs in Table 5.

(140) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a eye disease, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from the eye disease-related miRs in Table 2, particularly among the eye disease-related miRs in Table 5.

(141) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a disease of the digestive system, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from disease of the digestive system-related miRs in Table 3, particularly among disease of the digestive system-related miRs in Table 5.

(142) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a disease of the endocrine system, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from disease of the endocrine system-related miRs in Table 3, particularly among disease of the endocrine system-related miRs in Table 6.

(143) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a disease of the nervous system, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from disease of the nervous system-related miRs in Table 3, particularly among disease of the nervous system-related miRs in Table 6.

(144) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a disease linked to a virus, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from disease linked to a virus-related miRs in Table 3, particularly among disease linked to a virus-related miRs in Table 6.

(145) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a disease related to nutrition and metabolism, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from disease related to nutrition and metabolism-related miRs in Table 3, particularly among disease related to nutrition and metabolism-related miRs in Table 6.

(146) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a lymphatic disease or hemopathy, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from lymphatic disease or hemopathy-related miRs in Table 3, particularly among lymphatic disease or hemopathy-related miRs in Table 6.

(147) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a neonatal and hereditary disease, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from neonatal and hereditary disease-related miRs in Table 3, particularly among neonatal and hereditary disease-related miRs in Table 6.

(148) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a respiratory disease, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from respiratory disease-related miRs in Table 4, particularly among respiratory disease-related miRs in Table 6.

(149) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a urogenital disease in men, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from urogenital disease in men-related miRs in Table 4, particularly among urogenital disease in men-related miRs in Table 6.

(150) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a urogenital disease in women, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from urogenital disease in women-related miRs in Table 4, particularly among urogenital disease in women-related miRs in Table 6.

(151) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a disorder of the immune system, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from disorder of the immune system-related miRs in Table 4, particularly among disorder of the immune system-related miRs in Table 6.

(152) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a musculoskeletal disorder, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR selected from musculoskeletal disorder-related miRs in Table 4, particularly among musculoskeletal disorder-related miRs in Table 6.

(153) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a metabolism disorder, said miR being selected from: hsa-miR-103-1, hsa-miR-103-2 and hsa-mir-107, said miPEP being preferably selected from SEQ ID NOs: 73, 75, 77, 79, 81, 83, 85, 87, 2 547, 2 549, 2 551, 2 553, 3 921, 3 923, 3 925 and 3 927.

(154) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a hepatitis C virus infection, said miR being the hsa-miR-122, said miPEP being preferably selected from SEQ ID NOs: 97, 99, 101, 103, 2561, 2563, 2 565 and 2 567.

(155) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being an inflammatory disease, said miR being the hsa-miR-155, said miPEP being preferably selected from SEQ ID NOs: 4 433, 4 435, 4 437, 4 439, 4 441, 4 443, 4 445, 4 447, 8 377, 8 379, 8 381 and 8 383.

(156) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a fibrosis, said miR being the hsa-miR-21, said miPEP being preferably selected from SEQ ID NOs: 497, 499, 501, 503, 2 793, 2 795, 2 797, 2 799, 3 425, 3 427, 3 429, 3 431, 4 937, 4 939, 4 941, 4 943, 8 545, 8 547, 8 549, 8 551, 801, 10 803, 10 805 and 10 807.

(157) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being atherosclerosis, said miR being the hsa-miR-33, said miPEP being preferably selected from SEQ ID NOs: 5 609, 5 611, 5 613, 5 615, 8 673, 8 675, 8 677 and 8 679.

(158) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a cardiovascular disease, said miR being selected from: hsa-miR-15a and has-miR-15b, said miPEP being preferably selected from SEQ ID NOs: 4 449, 4 451, 4 453, 4 455, 4 457, 4 459, 4 461, 4 463, 4 465, 4 467, 4 469 and 4 471.

(159) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a myeloproliferative disease, said miR being the hsa-miR-451, said miPEP being preferably selected from SEQ ID NOs: 1 017, 1 019, 1 021, 1 023, 3 609, 3 611, 3 613, 3 615, 6 113, 6 115, 6 117 and 6 119.

(160) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being linked to neoangiogenesis, said miR being selected from: hsa-mir-92a-1, hsa-mir-92a-2 and hsa-mir-92b, said miPEP being preferably selected from SEQ ID NOs: 1 777, 1 779, 1 781, 1 783, 1 785, 1 787, 1 789, 1 791, 8 033, 8 035, 8 037, 8 039, 8 041, 8 043, 8 045, 8 047, 8 049, 8 051, 8 053, 8 055, 9 225, 9 227, 9 229, 9 231, 9 233, 9 235, 9 237, 9 239, 9 241, 9 243, 9 245, 9 247, 10 345, 10 347, 10 349, 351, 10 353, 10 355, 10 357, 10 359, 10 361, 10 363, 10 365, 10 367, 11 489, 11 491, 11 493, 11 495, 11 497, 11 499, 11 501, 11 503, 11 505, 11 507, 11 509 and 11 511.

(161) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a cardiac disorder, said miR being selected from: hsa-mir-208 and hsa-mir-208b, said miPEP being preferably selected from SEQ ID NOs: 4 889, 4 891, 4 893, 4 895, 4 897, 4 899, 4 901, 4 903, 4 905, 4 907, 4 909, 4911, 4913, 4915, 4 917 and 4919.

(162) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a pulmonary fibrosis, said miR being the hsa-mir-208, said miPEP being preferably selected from SEQ ID NOs: 4 889, 4 891, 4 893, 4 895, 4 897, 4 899, 4 901, 4 903, 4 905, 4 905, 4 907, 4 909, 4 911, 4 913, 4 915, 4 917 and 4 919.

(163) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a cancer, said miR being the hsa-let-7, said miPEP being preferably selected from SEQ ID NO: 2q-1, q varying from 1 to 28, from 1 225 to 1 260, from 1 561 to 1 576, from 1 865 to 1 916, from 4 065 to 4 100, from 4 645 to 4 668, from 5 197 to 5 228.

(164) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a cardiovascular disease, in particular the ischemia-reperfusion syndrome, said miR being the hsa-miR-7, said miPEP being preferably selected from SEQ ID NOs: 3 089, 3 091, 3 093, 3 095, 3 689, 3 691, 3 693, 3 695, 7 881, 7 883, 7 885, 7 887, 7 889, 7 891, 7 893, 7 895, 7 897, 7 899, 7 901, 7 903, 9 209, 9 211, 9 213, 9 215, 11 473, 11 475, 11 477 and 11 479.

(165) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a hepatitis C virus infection, said miR being the hsa-mir-181c, said miPEP being preferably selected from SEQ ID NOs: 321, 323, 325, 327, 2 657, 2 659, 2 661, 2 663, 4 537, 4 539, 4 541, 4 543, 8 409, 8 411, 8 413, 8 415, 9 497, 9499, 9 501 and 9503.

(166) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said pathology being a pulmonary fibrosis, said miR being the hsa-miR-29, said miPEP being preferably selected from SEQ ID NOs: 633, 635, 637, 639, 641, 643, 645, 647, 649, 651, 653, 655, 657, 659, 661, 663, 2 905, 2 907, 2 909, 2 911, 2 913, 2 915, 2 917, 2 919, 3 529, 3 531, 3 533, 3 535, 3 537, 3 539, 3 541, 3 543, 5 281, 5 283, 285, 5 287, 5 289, 5 291, 5 293, 5 295, 5 297, 5 299, 5 301, 5 303, 5 305, 5 307, 5 309, 311, 11 657, 11 659, 11 661, 11 663, 11 665, 11 667, 11 669 and 11 671.

(167) In a particular embodiment, the invention relates to a miPEP for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP being selected from the group of miPEPs consisting of: miPEP 145-2 (SEQ ID NO: 11 745), miPEP 125a-1 (SEQ ID NO: 11 747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(168) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being a fragment of the miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(169) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being the miPEP//145-2 consisting of SEQ ID NO: 11 751.

(170) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being a fragment of the miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(171) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being the miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(172) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being a fragment of the miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753.

(173) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being the miPEP//15a-16-1 consisting of SEQ ID NO: 11 754.

(174) In a particular embodiment, the invention relates to a miPEP fragment for its use in the treatment of a disease or trauma of bone tissue or cartilage tissue, said miPEP fragment being selected from:

(175) TABLE-US-00005 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(176) Another aspect of the invention relates to process for identifying a miPEP, or a fragment of said miPEP, modulating the accumulation of a miR involved in a pathology, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide,

(177) in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in a pathology.

(178) Another aspect of the invention also relates to a miPEP from 101 to 500 amino acids, or a fragment of said miPEP, encoded by a nucleotide sequence contained in the primary transcript of a microRNA, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell.

(179) In particular, a miPEP may have a size from 200 to 500 amino acids, from 300 to 500 amino acids or from 400 to 500 amino acids.

(180) In particular, a miPEP may have a size of 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499 or 500 amino acids.

(181) In a particular embodiment, the invention relates to a miPEP selected from the group consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875, or a fragment of said miPEP. In a particular embodiment, the invention relates to a miPEP selected from the group consisting of: miPEP 145-2 (SEQ ID NO: 11 745), miPEP 125a-1 (SEQ ID NO: 11 747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(182) In a particular embodiment, the invention relates to a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(183) In a particular embodiment, the invention relates to miPEP//145-2 consisting of SEQ ID NO: 11 751.

(184) In a particular embodiment, the invention relates to a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(185) In a particular embodiment, the invention relates to miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(186) In a particular embodiment, the invention relates to a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753.

(187) In a particular embodiment, the invention relates to miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(188) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, vectorized or encapsulated.

(189) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, fused to a peptide facilitating the entry into the cell of the miPEP, or miPEP fragment.

(190) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, wherein said miPEP, or said fragment of said miPEP, fused to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754).

(191) In a particular embodiment, the invention relates to a miPEP fragment, said miPEP fragment being selected from:

(192) TABLE-US-00006 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(193) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, as defined above, fused to penetratin, to a polyhistidine peptide (in particular a peptide of at least 6 histidine residues) or to a polyarginine peptide (in particular a peptide of 9 arginine residues).

(194) In a particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, as defined above, linked to one or more palmitic acid molecules.

(195) In another aspect, the invention relates to a composition comprising a miPEP or a fragment of said miPEP.

(196) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP is selected from the group of miPEP consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875.

(197) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP is selected from the group of miPEP consisting of: miPEP 145-2 (SEQ ID NO: 11745), miPEP 125a-1 (SEQ ID NO: 11747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(198) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment is a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(199) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment is the miPEP//145-2 consisting of SEQ ID NO: 11 751.

(200) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment is a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(201) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment is the miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(202) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment is a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO 11 753.

(203) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment is the miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(204) In a particular embodiment, the invention relates to a composition as defined above, wherein said miPEP fragment being selected from:

(205) TABLE-US-00007 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(206) In a particular embodiment, the invention relates to a composition as defined above, wherein said composition additionally contains growth factors and/or cell differentiation factors.

(207) In a particular embodiment, the invention relates to a composition as defined above, wherein said composition additionally contains BMP4.

(208) In a particular embodiment, the invention relates to a composition as defined above, wherein said composition additionally contains cell culture medium.

(209) In another aspect, the invention relates to the in vitro or ex vivo use of a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell, to promote cell differentiation of cells.

(210) In a particular embodiment, the invention relates to the in vitro or ex vivo use of a miPEP, or a fragment of said miPEP, to promote cell differentiation of mesenchymal stem cells (also called bone marrow stromal cells or mesenchymal stromal cells).

(211) In a particular embodiment, the invention relates to the in vitro or ex vivo use of a miPEP, or a fragment of said miPEP, to promote cell differentiation of mesenchymal stem cells in osteoblasts.

(212) In a particular embodiment, the invention relates to the use as defined above, wherein cells are cultured in the presence of said miPEP, or a fragment of said miPEP.

(213) In a particular embodiment, the invention relates to the use as defined above, wherein cells are cultured in the presence of said miPEP, or a fragment of said miPEP, and in the presence of growth factors and/or cell differentiation factors.

(214) In a particular embodiment, the invention relates to the use as defined above, wherein cells are cultured in the presence of said miPEP, or a fragment of said miPEP, and in the presence of BMP4 (Bone Morphogenetic Protein 4).

(215) In a particular embodiment, the invention relates to the use as defined above, wherein said miPEP is selected from the group of miPEPs consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875.

(216) In a particular embodiment, the invention relates to the use as defined above, wherein said miPEP selected from the group consisting of: miPEP 145-2 (SEQ ID NO: 11 745), miPEP 125a-1 (SEQ ID NO: 11 747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(217) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(218) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is the miPEP//145-2 consisting of SEQ ID NO: 11 751.

(219) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(220) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is the miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(221) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753.

(222) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is the miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(223) In a particular embodiment, the invention relates to the use as defined above, wherein said miPEP fragment is selected from:

(224) TABLE-US-00008 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(225) In a particular embodiment, the invention relates to the in vitro or ex vivo use of a miPEP, or a fragment of said miPEP, to induce or promote bone formation.

(226) In a particular embodiment, the invention relates to the in vitro or ex vivo use of a miPEP, or a fragment of said miPEP, to form a mineralized bone matrix.

(227) In a particular embodiment, the invention relates to the in vitro or ex vivo use of a miPEP, or a fragment of said miPEP, to promote bone formation with the help of a bone biomaterial.

(228) In a particular embodiment, the invention relates to the use as defined above, wherein mesenchymal stem cells are cultured in the presence of said miPEP, or a fragment of said miPEP.

(229) In a particular embodiment, the invention relates to the use as defined above, wherein mesenchymal stem cells are cultured in the presence of said miPEP, or a fragment of said miPEP, and in the presence of growth factors and/or cell differentiation factors.

(230) In a particular embodiment, the invention relates to the use as defined above, wherein mesenchymal stem cells are cultured in the presence of said miPEP, or a fragment of said miPEP, and in the presence of BMP4.

(231) In a particular embodiment, the invention relates to the use as defined above, wherein said miPEP is selected from the group of miPEPs consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875.

(232) In a particular embodiment, the invention relates to the use as defined above, wherein said miPEP selected from the group consisting of: miPEP 145-2 (SEQ ID NO: 11 745), miPEP 125a-1 (SEQ ID NO: 11 747) and miPEP 15a-16-1 (SEQ ID NO: 11 749).

(233) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is a fragment of miPEP 145-2, preferably consisting of SEQ ID NO: 11 751.

(234) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is the miPEP//145-2 consisting of SEQ ID NO: 11 751.

(235) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is a fragment of miPEP 125a-1, preferably consisting of SEQ ID NO: 11 752.

(236) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is the miPEP//125a-1 consisting of SEQ ID NO: 11 752.

(237) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is a fragment of miPEP 15a-16-1, preferably consisting of SEQ ID NO: 11 753.

(238) In a particular embodiment, the invention relates to the use as defined above, wherein said fragment is the miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(239) In a particular embodiment, the invention relates to the use as defined above, wherein said miPEP fragment is selected from:

(240) TABLE-US-00009 miPEP//145-2-TAT consisting of SEQ ID NO: 11 755  (MVGLNPPLWQ-YGRKKRRQRRR),  miPEP//125a-1-TAT consisting of SEQ ID NO: 11 756  (MSLCLSPSLT-YGRKKRRQRRR),  and  miPEP//15a-16-1-TAT consisting of SEQ ID NO: 11 757 (MFKHRFFYMH-YGRKKRRQRRR). 

(241) In another aspect, the invention relates to the in vivo use of a miPEP, or a fragment of said miPEP, to induce or promote bone formation.

(242) In another aspect, the invention relates to the in vivo use of a miPEP, or a fragment of said miPEP, to form a mineralized bone matrix.

(243) In another aspect, the invention relates to the in vivo use of a miPEP, or a fragment of said miPEP, to promote bone formation with the help of a bone biomaterial.

(244) Another aspect of the invention relates to a nucleic acid encoding a miPEP as defined above, or a fragment of said miPEP.

(245) In a particular embodiment, the invention relates to a nucleic acid as defined above, said nucleic acid being selected from the group consisting of SEQ ID NO: 2q, q varying from 1 to 5 875.

(246) In another aspect, the invention relates to an antibody specifically recognizing a miPEP selected from the group consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875, or a fragment of said miPEP.

(247) Such antibody can be obtained from a method known to those skilled in the art, such as for example by injecting said miPEP with a non-human animal to trigger an immunization reaction and the production of antibodies by said animal.

(248) In another aspect, the invention relates to an antibody specifically recognizing a miPEP, or a fragment of said miPEP, for its use as a drug.

(249) In a particular embodiment, the invention relates to an antibody specifically recognizing a miPEP selected from the group consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875, or a fragment of said miPEP, for its use as a drug.

(250) In another aspect, the invention relates to an antibody specifically recognizing a miPEP, or a fragment of said miPEP, for immunostaining said miPEP or a fragment of said miPEP.

(251) In a particular embodiment, the invention relates to the use of an antibody as defined above, wherein said specifically recognizing a miPEP selected from the group consisting of SEQ ID NO: 2q-1, q varying from 1 to 5 875, or a fragment of said miPEP.

(252) According to a particular embodiment, the invention relates to a miPEP from 3 to 500 amino acids encoded by a nucleotide sequence contained in the primary transcript of a miR, or a fragment of said miPEP, said miPEP being capable of modulating the accumulation of said miR in a eukaryotic cell,

(253) for its use as a drug in the treatment of musculoskeletal disorders, or disease or trauma of bone tissue or cartilage tissue, said primary transcript of a miR being selected from the group consisting of:

(254) let-7b, let-7g, miR-15a, miR16-1, miR106a, miR10a, miR10b, miR1246, miR125a-1, miR132, miR134, miR142, miR145, miR145-2, miR146a, miR150, miR155, miR181c, miR182, miR183, miR184, miR18b, miR192, miR195, miR200a, miR202, miR203, miR205, miR206, miR20b, miR21, miR210, miR27a, miR29a, miR29c, miR30b, miR345, miR377, miR409, miR495, miR520h, miR542, miR572, miR648, miR96 and miR99b;

(255) preferably among the group consisting of: miR15a, miR16-1, miR125a-1 and miR145-2.

(256) According to another particular embodiment, the invention relates to a miPEP as defined above having in particular a size from 3 to 50 amino acids, from 50 to 100 amino acids, from 100 to 500 amino acids, from 101 to 500 amino acids, from 200 to 500 amino acids, from 300 to 500 amino acids, from 400 to 500 amino acids, from 100 to 200 amino acids, from 200 to 300 amino acids or from 300 to 400 amino acids.

(257) According to another particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being identified, or as identified, by implementing of a process for identifying a miPEP modulating the accumulation of a miR involved in a musculoskeletal disorder, or disease or trauma of bone tissue or cartilage tissue, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide,

(258) in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in a musculoskeletal disorder, or disease or trauma of bone tissue or cartilage tissue.

(259) According to another particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being selected from the group of miPEPs consisting of SEQ ID NO: 2q-1,

(260) q varying

(261) from 45 to 48, from 89 to 92, from 101 to 104, from 121 to 124, from 133 to 140, from 153 to 156, from 161 to 164, from 169 to 192, from 221 to 224, from 233 to 256, from 301 to 304, from 317 to 320, from 329 to 332, from 337 to 340, from 381 to 384, from 445 to 448, from 469 to 472, from 533 to 536, from 693 to 696, from 789 to 792, from 909 to 916, from 977 to 980, from 1 021 to 1 024, from 1 237 to 1 240, from 1 277 to 1 280, from 1 329 to 1 332, from 1 337 to 1 344, from 1 350 to 1 353, from 1 361 to 1 364, from 1 374 to 1 377, from 1 385 to 1 388, from 1 393 to 1 404, from 1 445 to 1 448, from 1 453 to 1 456, from 1 469 to 1 472, from 1 533 to 1 536, from 1 549 to 1 552, from 1 557 to 1 560, from 1 581 to 1 584, from 1 645 to 1 652, from 1 677 to 1 680, from 1 705 to 1 716, from 1 769 to 1 772, from 1 877 to 1 880, from 1 909 to 1 912, from 1 953 to 1 956, from 1 965 to 1972, from 2 061 to 2 064, from 2 073 to 2 076, from 2 117 to 2 120, from 2 129 to 2 140, from 2 185 to 2 188, from 2 217 to 2 244, from 2 269 to 2 288, from 2 317 to 2 320, from 2 337 to 2 340, from 2 361 to 2 364, from 2 413 to 2 416, from 2 425 to 2 432, from 2 437 to 2 444, from 2 465 to 2 476, from 2 609 to 2 612, from 2 641 to 2 644, from 2 653 to 2 656, from 2 689 to 2 692, from 2 825 to 2 828, from 2 949 to 2 952, from 2 977 to 2 980, from 3 141 to 3 144, from 3 317 to 3 320, from 3 373 to 3 376, from 3 517 to 3 520, from 3 861 to 3 868, from 4 041 to 4 044, from 4 061 to 4 064, from 4 093 to 4 096, from 4 113 to 4 116, from 4 121 to 4 128, from 4 157 to 4 164, from 4 189 to 4 192, from 4 205 to 4 208, from 4 225 to 4 228, from 4 242 to 4 245, from 4 269 to 4 276, from 4 309 to 4 312, from 4 341 to 4 344, from 4 421 to 4 424, from 4 637 to 4 640, from 4 661 to 4 664, from 4 677 to 4 680, from 4 685 to 4 692, from 4 705 to 4 708, from 4 749 to 4 752, from 4 757 to 4 764, from 4 777 to 4 780, from 4 793 to 4 796, from 4 813 to 4 816, from 4 825 to 4 828, from 4 833 to 4 840, from 4 898 to 4 901, from 4 985 to 4 988, from 5 157 to 5 160, from 5 189 to 5 196, from 5 221 to 5 224, from 5 241 to 5 244, from 5 249 to 5 300, from 5 341 to 5 344, from 5 357 to 5 360, from 5 381 to 5 384, from 5 397 to 5 408, from 5 437 to 5 440, from 5 473 to 5 476, from 5 563 to 5 570, from 5 717 to 5 720, from 5 765 to 5 768, from 5 793 to 5 800, from 5 809 to 5 812, from 5 826 to 5 829, from 5 833 to 5 836 and from 5 869 to 5 875;

(262) preferably selected from the group consisting of: SEQ ID NO: 11 745, SEQ ID NO: 11 747 and SEQ ID NO: 11 749.

(263) According to another particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above for its use in the treatment of one or more musculoskeletal disorders, or diseases or traumas of bone tissue or cartilage tissue, selected from the group comprising:

(264) arthritis, craniosynostosis, fibrous dysplasia, multiple hereditary exostoses, cleft palates, fibrodysplasia ossificans progressiva, non-ossifying fibroma, bone fracture, hyperostosis, infantile cortical hyperostosis, hyperostosis porotid, hyperparathyroidism, hypophosphatasia, Kienbock's disease, Kohler-Mouchet's disease, Paget's disease, Panner's disease, Scheuermann's disease, Osgood-Schlatter's disease or tibial osteochondrosis, melorheostosis, multiple myeloma, osteitis, osteitis condensas, osteitis fibrosa cystica or osteitis fibrosa or von Recklinghausen's disease, osteoarthritis, deforming osteochondritis of the hip, osteochondritis dissecans, osteochondroma, osteogenesis imperfecta or glass bone disease, osteolysis, osteomalacia, osteomyelitis, osteopenia, osteopetrosis, osteophyte, osteoporosis, osteosclerosis, pseudarthrosis, pseudarthritis pink (or non-consolidation or delayed consolidation), pycnodysostosis, Coffin-Lowry syndrome, Hajdu-Cheney syndrome, Klippel-Feil syndrome, giant cell tumor and bone tumor.

(265) According to another particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP being selected from the group of miPEPs consisting of: SEQ ID NO: 2q-1,

(266) q varying from 45 to 48, from 89 to 92, from 101 to 104, from 121 to 124, from 133 to 140, from 153 to 156, from 161 to 164, from 169 to 192, from 221 to 224, from 233 to 256, from 301 to 304, from 317 to 320, from 329 to 332, from 337 to 340, from 381 to 384, from 445 to 448, from 469 to 472, from 533 to 536, from 693 to 696, from 789 to 792, from 909 to 916, from 977 to 980, from 1 021 to 1 024, from 1 237 to 1 240, from 1 277 to 1 280, from 1 329 to 1 332, from 1 337 to 1 344, from 1 350 to 1 353, from 1 361 to 1 364, from 1 374 to 1 377, from 1 385 to 1 388, from 1 393 to 1 404, from 1 445 to 1 448, from 1 453 to 1 456, from 1 469 to 1 472, from 1 533 to 1 536, from 1 549 to 1 552, from 1 557 to 1 560, from 1 581 to 1 584, from 1 645 to 1 652, from 1 677 to 1 680, from 1 705 to 1 716, from 1 769 to 1 772, from 1 877 to 1 880, from 1 909 to 1 912, from 1 953 to 1 956, from 1 965 to 1 972, from 2 061 to 2 064, from 2 073 to 2 076, from 2 117 to 2 120, from 2 129 to 2 140, from 2 185 to 2 188, from 2 217 to 2 244, from 2 269 to 2 288, from 2 317 to 2 320, from 2 337 to 2 340, from 2 361 to 2 364, from 2 413 to 2 416, from 2 425 to 2 432, from 2 437 to 2 444, from 2 465 to 2 476, from 2 609 to 2 612, from 2 641 to 2 644, from 2 653 to 2 656, from 2 689 to 2 692, from 2 825 to 2 828, from 2 949 to 2 952, from 2 977 to 2 980, from 3 141 to 3 144, from 3 317 to 3 320, from 3 373 to 3 376, from 3 517 to 3 520, from 3 861 to 3 868, from 4 041 to 4 044, from 4 061 to 4 064, from 4 093 to 4 096, from 4 113 to 4 116, from 4 121 to 4 128, from 4 157 to 4 164, from 4 189 to 4 192, from 4 205 to 4 208, from 4 225 to 4 228, from 4 242 to 4 245, from 4 269 to 4 276, from 4 309 to 4 312, from 4 341 to 4 344, from 4 421 to 4 424, from 4 637 to 4 640, from 4 661 to 4 664, from 4 677 to 4 680, from 4 685 to 4 692, from 4 705 to 4 708, from 4 749 to 4 752, from 4 757 to 4 764, from 4 777 to 4 780, from 4 793 to 4 796, from 4 813 to 4 816, from 4 825 to 4 828, from 4 833 to 4 840, from 4 898 to 4 901, from 4 985 to 4 988, from 5 157 to 5 160, from 5 189 to 5 196, from 5 221 to 5 224, from 5 241 to 5 244, from 5 249 to 5 300, from 5 341 to 5 344, from 5 357 to 5 360, from 5 381 to 5 384, from 5 397 to 5 408, from 5 437 to 5 440, from 5 473 to 5 476, from 5 563 to 5 570, from 5 717 to 5 720, from 5 765 to 5 768, from 5 793 to 5 800, from 5 809 to 5 812, from 5 826 to 5 829, from 5 833 to 5 836 and from 5 869 to 5 875;

(267) preferably selected from the group consisting of: SEQ ID NO: 11 745, SEQ ID NO: 11 747 and SEQ ID NO: 11 749.

(268) According to another particular embodiment, the invention relates to a miPEP fragment for its use as defined above, said miPEP fragment being selected from: miPEP//145-2 consisting of SEQ ID NO: 11 751, miPEP//125a-1 consisting of SEQ ID NO: 11 752, and miPEP//15a-16-1 consisting of SEQ ID NO: 11 753.

(269) According to another particular embodiment, the invention relates to a miPEP, or a fragment of said miPEP, for its use as defined above, said miPEP, or said fragment of said miPEP, being fused to or linked to one or more molecules facilitating the entry into the cell of the miPEP or miPEP fragment,

(270) said miPEP, or fragment of said miPEP, being preferably fused in N-ter or in C-ter to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754).

(271) According to another particular embodiment, the invention relates to a miPEP selected from the group of miPEPs consisting of: SEQ ID NO: 2q-1, q varying from 45 to 48, from 89 to 92, from 101 to 104, from 121 to 124, from 133 to 140, from 153 to 156, from 161 to 164, from 169 to 192, from 221 to 224, from 233 to 256, from 301 to 304, from 317 to 320, from 329 to 332, from 337 to 340, from 381 to 384, from 445 to 448, from 469 to 472, from 533 to 536, from 693 to 696, from 789 to 792, from 909 to 916, from 977 to 980, from 1 021 to 1 024, from 1 237 to 1 240, from 1 277 to 1 280, from 1 329 to 1 332, from 1 337 to 1 344, from 1 350 to 1 353, from 1 361 to 1 364, from 1 374 to 1 377, from 1 385 to 1 388, from 1 393 to 1 404, from 1 445 to 1 448, from 1 453 to 1 456, from 1 469 to 1 472, from 1 533 to 1 536, from 1 549 to 1 552, from 1 557 to 1 560, from 1 581 to 1 584, from 1 645 to 1 652, from 1 677 to 1 680, from 1 705 to 1 716, from 1 769 to 1 772, from 1 877 to 1 880, from 1 909 to 1 912, from 1 953 to 1 956, from 1 965 to 1 972, from 2 061 to 2 064, from 2 073 to 2 076, from 2 117 to 2 120, from 2 129 to 2 140, from 2 185 to 2 188, from 2 217 to 2 244, from 2 269 to 2 288, from 2 317 to 2 320, from 2 337 to 2 340, from 2 361 to 2 364, from 2 413 to 2 416, from 2 425 to 2 432, from 2 437 to 2 444, from 2 465 to 2 476, from 2 609 to 2 612, from 2 641 to 2 644, from 2 653 to 2 656, from 2 689 to 2 692, from 2 825 to 2 828, from 2 949 to 2 952, from 2 977 to 2 980, from 3 141 to 3 144, from 3 317 to 3 320, from 3 373 to 3 376, from 3 517 to 3 520, from 3 861 to 3 868, from 4 041 to 4 044, from 4 061 to 4 064, from 4 093 to 4 096, from 4 113 to 4 116, from 4 121 to 4 128, from 4 157 to 4 164, from 4 189 to 4 192, from 4 205 to 4 208, from 4 225 to 4 228, from 4 242 to 4 245, from 4 269 to 4 276, from 4 309 to 4 312, from 4 341 to 4 344, from 4 421 to 4 424, from 4 637 to 4 640, from 4 661 to 4 664, from 4 677 to 4 680, from 4 685 to 4 692, from 4 705 to 4 708, from 4 749 to 4 752, from 4 757 to 4 764, from 4 777 to 4 780, from 4 793 to 4 796, from 4 813 to 4 816, from 4 825 to 4 828, from 4 833 to 4 840, from 4 898 to 4 901, from 4 985 to 4 988, from 5 157 to 5 160, from 5 189 to 5 196, from 5 221 to 5 224, from 5 241 to 5 244, from 5 249 to 5 300, from 5 341 to 5 344, from 5 357 to 5 360, from 5 381 to 5 384, from 5 397 to 5 408, from 5 437 to 5 440, from 5 473 to 5 476, from 5 563 to 5 570, from 5 717 to 5 720, from 5 765 to 5 768, from 5 793 to 5 800, from 5 809 to 5 812, from 5 826 to 5 829, from 5 833 to 5 836 and from 5 869 to 5 875;

(272) preferably selected from the group consisting of: SEQ ID NO: 11 745, SEQ ID NO: 11 747 and SEQ ID NO: 11 749,

(273) said miPEP, or fragment of said miPEP, being preferably fused to the TAT peptide (YGRKKRRQRRR, SEQ ID NO: 11 754), fused to penetratin, fused to a polyhistidine peptide, fused to a polyarginine peptide, or linked to one or more palmitic acid molecules.

(274) According to another particular embodiment, the invention relates to a nucleic acid encoding one of the miPEPs selected from the group of miPEPs consisting of SEQ ID NO: 2q, q varying from 45 to 48, from 89 to 92, from 101 to 104, from 121 to 124, from 133 to 140, from 153 to 156, from 161 to 164, from 169 to 192, from 221 to 224, from 233 to 256, from 301 to 304, from 317 to 320, from 329 to 332, from 337 to 340, from 381 to 384, from 445 to 448, from 469 to 472, from 533 to 536, from 693 to 696, from 789 to 792, from 909 to 916, from 977 to 980, from 1 021 to 1 024, from 1 237 to 1 240, from 1 277 to 1 280, from 1 329 to 1 332, from 1 337 to 1 344, from 1 350 to 1 353, from 1 361 to 1 364, from 1 374 to 1 377, from 1 385 to 1 388, from 1 393 to 1 404, from 1 445 to 1 448, from 1 453 to 1 456, from 1 469 to 1 472, from 1 533 to 1 536, from 1 549 to 1 552, from 1 557 to 1 560, from 1 581 to 1 584, from 1 645 to 1 652, from 1 677 to 1 680, from 1 705 to 1 716, from 1 769 to 1 772, from 1 877 to 1 880, from 1 909 to 1 912, from 1 953 to 1 956, from 1 965 to 1 972, from 2 061 to 2 064, from 2 073 to 2 076, from 2 117 to 2 120, from 2 129 to 2 140, from 2 185 to 2 188, from 2 217 to 2 244, from 2 269 to 2 288, from 2 317 to 2 320, from 2 337 to 2 340, from 2 361 to 2 364, from 2 413 to 2 416, from 2 425 to 2 432, from 2 437 to 2 444, from 2 465 to 2 476, from 2 609 to 2 612, from 2 641 to 2 644, from 2 653 to 2 656, from 2 689 to 2 692, from 2 825 to 2 828, from 2 949 to 2 952, from 2 977 to 2 980, from 3 141 to 3 144, from 3 317 to 3 320, from 3 373 to 3 376, from 3 517 to 3 520, from 3 861 to 3 868, from 4 041 to 4 044, from 4 061 to 4 064, from 4 093 to 4 096, from 4 113 to 4 116, from 4 121 to 4 128, from 4 157 to 4 164, from 4 189 to 4 192, from 4 205 to 4 208, from 4 225 to 4 228, from 4 242 to 4 245, from 4 269 to 4 276, from 4 309 to 4 312, from 4 341 to 4 344, from 4 421 to 4 424, from 4 637 to 4 640, from 4 661 to 4 664, from 4 677 to 4 680, from 4 685 to 4 692, from 4 705 to 4 708, from 4 749 to 4 752, from 4 757 to 4 764, from 4 777 to 4 780, from 4 793 to 4 796, from 4 813 to 4 816, from 4 825 to 4 828, from 4 833 to 4 840, from 4 898 to 4 901, from 4 985 to 4 988, from 5 157 to 5 160, from 5 189 to 5 196, from 5 221 to 5 224, from 5 241 to 5 244, from 5 249 to 5 300, from 5 341 to 5 344, from 5 357 to 5 360, from 5 381 to 5 384, from 5 397 to 5 408, from 5 437 to 5 440, from 5 473 to 5 476, from 5 563 to 5 570, from 5 717 to 5 720, from 5 765 to 5 768, from 5 793 to 5 800, from 5 809 to 5 812, from 5 826 to 5 829, from 5 833 to 5 836 and from 5 869 to 5 875;

(275) preferably selected from the group consisting of: SEQ ID NO: 11 746, SEQ ID NO: 11 748 and SEQ ID NO: 11 750.

(276) Furthermore, the invention also relates to a process for identifying a miPEP modulating the accumulation of a miR involved in a musculoskeletal disorder, or disease or trauma of bone tissue or cartilage tissue, said miPEP being encoded by a nucleotide sequence contained in the primary transcript of a miR, comprising: a) a step of detecting an open reading frame from 12 to 1 503 nucleotides contained in the sequence of the primary transcript of said miR, then b) a step of comparison between: i. the accumulation of said miR in a specified eukaryotic cell expressing the primary transcript of said miR, in the presence of a peptide encoded by a nucleotide sequence that is identical or degenerate relative to that of said open reading frame, said peptide being present in the cell independently of transcription of the primary transcript of said miR, and ii. the accumulation of said miR in a eukaryotic cell of the same type as the aforesaid specified eukaryotic cell expressing the primary transcript of said miR, in the absence of said peptide,

(277) in which a modulation of the accumulation of said miR in the presence of said peptide relative to the accumulation of said miR in the absence of said peptide indicates the existence of a miPEP, the latter being encoded by said open reading frame and being capable of modulating the accumulation of said miR involved in a musculoskeletal disorder, or disease or trauma of bone tissue or cartilage tissue.

(278) According to another aspect, the invention also relates to the in vitro, in vivo or ex vivo use of a miPEP or a fragment of said miPEP,

(279) said miPEP being selected from the group of miPEPs consisting of: SEQ ID NO: 2q-1,

(280) q varying

(281) from 45 to 48, from 89 to 92, from 101 to 104, from 121 to 124, from 133 to 140, from 153 to 156, from 161 to 164, from 169 to 192, from 221 to 224, from 233 to 256, from 301 to 304, from 317 to 320, from 329 to 332, from 337 to 340, from 381 to 384, from 445 to 448, from 469 to 472, from 533 to 536, from 693 to 696, from 789 to 792, from 909 to 916, from 977 to 980, from 1 021 to 1 024, from 1 237 to 1 240, from 1 277 to 1 280, from 1 329 to 1 332, from 1 337 to 1 344, from 1 350 to 1 353, from 1 361 to 1 364, from 1 374 to 1 377, from 1 385 to 1 388, from 1 393 to 1 404, from 1 445 to 1 448, from 1 453 to 1 456, from 1 469 to 1 472, from 1 533 to 1 536, from 1 549 to 1 552, from 1 557 to 1 560, from 1 581 to 1 584, from 1 645 to 1 652, from 1 677 to 1 680, from 1 705 to 1 716, from 1 769 to 1 772, from 1 877 to 1 880, from 1 909 to 1 912, from 1 953 to 1 956, from 1 965 to 1972, from 2 061 to 2 064, from 2 073 to 2 076, from 2 117 to 2 120, from 2 129 to 2 140, from 2 185 to 2 188, from 2 217 to 2 244, from 2 269 to 2 288, from 2 317 to 2 320, from 2 337 to 2 340, from 2 361 to 2 364, from 2 413 to 2 416, from 2 425 to 2 432, from 2 437 to 2 444, from 2 465 to 2 476, from 2 609 to 2 612, from 2 641 to 2 644, from 2 653 to 2 656, from 2 689 to 2 692, from 2 825 to 2 828, from 2 949 to 2 952, from 2 977 to 2 980, from 3 141 to 3 144, from 3 317 to 3 320, from 3 373 to 3 376, from 3 517 to 3 520, from 3 861 to 3 868, from 4 041 to 4 044, from 4 061 to 4 064, from 4 093 to 4 096, from 4 113 to 4 116, from 4 121 to 4 128, from 4 157 to 4 164, from 4 189 to 4 192, from 4 205 to 4 208, from 4 225 to 4 228, from 4 242 to 4 245, from 4 269 to 4 276, from 4 309 to 4 312, from 4 341 to 4 344, from 4 421 to 4 424, from 4 637 to 4 640, from 4 661 to 4 664, from 4 677 to 4 680, from 4 685 to 4 692, from 4 705 to 4 708, from 4 749 to 4 752, from 4 757 to 4 764, from 4 777 to 4 780, from 4 793 to 4 796, from 4 813 to 4 816, from 4 825 to 4 828, from 4 833 to 4 840, from 4 898 to 4 901, from 4 985 to 4 988, from 5 157 to 5 160, from 5 189 to 5 196, from 5 221 to 5 224, from 5 241 to 5 244, from 5 249 to 5 300, from 5 341 to 5 344, from 5 357 to 5 360, from 5 381 to 5 384, from 5 397 to 5 408, from 5 437 to 5 440, from 5 473 to 5 476, from 5 563 to 5 570, from 5 717 to 5 720, from 5 765 to 5 768, from 5 793 to 5 800, from 5 809 to 5 812, from 5 826 to 5 829, from 5 833 to 5 836 and from 5 869 to 5 875;

(282) preferably selected from the group consisting of: SEQ ID NO: 11 745, SEQ ID NO: 11 747 and SEQ ID NO: 11 749,

(283) to promote osteogenesis of cells, particularly mesenchymal stem cells.

(284) According to another particular aspect, the invention relates to the use of a miPEP or fragment of said miPEP as defined above, in combination with one or more additives,

(285) said additives being selected from the group consisting of: cytokines such as bone morphogenetic protein (BMP) and/or dexamethasone.

(286) According to another particular aspect, the invention relates to a use of a miPEP or fragment of said miPEP as defined above, in combination with a biomaterial,

(287) said biomaterial being selected from the following table:

(288) TABLE-US-00010 TABLE 1 List of possible biomaterials for implementing the invention. a) natural polymers b) synthetic polymers c) bioactive glasses gelatin/chitooligosaccharide, poly(lactide-co-glycolide) [PLGA], 45S5 Bioglass ® (registered trademark of the collagen, poly(ε-caprolactone) [PCL] or University of Florida), chitosan, poly(hydroxymethylglycolide-co-ε- CaMgSi.sub.2O.sub.6, chitosan/collagen/beta-glycerophosphate caprolactone) [pHMGCL], 45S5 bioactive glass ® (registered trademark (β-GP), PLGA-poly(ethylene oxide) (PEO) of the University of Florida), silk fibroins, [=PLGA-PEO], 45S bioactive glass ®, alginate/calcium phosphate cement poly(L-lactide-co-ε-caprolactone)/poly(L- bioactive glass ® (BG20), (CPC)[= alginate/CPC] lactide-co-1,5-dioxepan-2-one)[poly(LLA- bioglass ®, or alginate, co-CL)/poly(LLA-co-DXO)], bioactive glass ® (13-93) hyaluronic acid, poly[(ethylglycinato)(p-methylphenoxy) RAD16-I BD ™ (PuraMatrix ™, registered phosphazene]/PLGA [= PPHOS/PLGA], trademark of 3-D Matrix, Ltd.), or PCL/poly(diisopropyl fumarate) (PDIPF) chitosan/peptide “Arginine-Glycine- [= PCL/PDIPF], Aspartic acid” (RGD) poly(ester amide)-g-TA [PEA-g-TA], [=chitosan/peptide RGD] PLGA-poly(ethylene glycol-aspartic acid (PEG-ASP) [=PLGA-(PEG-ASP)], poly(ethylene oxide terephthalate)/poly(butylene terephthalate) [PEOT/PBT], or poly (hydroxyethyl methacrylate) [poly- HEMA] d) calcium phosphates e) coral f) metals CPC, Porites sp., NiTi/Ti, hydroxyapatite [HA] Goniopora coral, titanium (Ti) fiber sheets, β-tricalcium phosphate [βTCP] hydroxyapatite coral, titanium wire, HA/βTCP, coralline in the shape of a condyle, Ti, calcium Aluminate/melatonine, or Porites lutea, TiO.sub.2, CPC/Bioglass ® Porites acropora, or Ti.sub.6Ta.sub.4Sn alloy, natural coral matrices Magnesium W4 alloy (MgY4), or Iron-Manganese alloy g) polymer/ceramic composites h) metal/ceramic composites Nano-apatite/PCL, polyNaSS/Ti, PLGA-PCL-Calcium Phosphate (CP) polylactic acid in crystalline form/PLGA/Ti [= PLGA-PCL-CP], [=PLLA/PLGA/Ti], PEOT/PBT-CP, polyNaSS/Ti, Collagen-CPC, NaSS/methacrylic acid, PCL-TCP, MA/Ti.sub.6Al.sub.4V alloy, Chitosan-CPC, polyNaSS/Ti, Magnesium Phosphate-PCL, SiO.sub.2/CaO/Na.sub.2O/MgO/B.sub.2O.sub.3, PLGA-βTCP, Niobium/fluorapatite, PCLF-PVA-HA (PVA: poly(alcool Ti-HA, vinylic)), TiO.sub.2, Chitosan/poly(DL, lactide-co-glycolide), ZrO.sub.2-CP/PCL, PLGA-nHA, ou K/Sr-calcium polyphosphate (CPP) poly-3-hydroxybutyrate-HA (P3HB-HA) [=K/Sr-CPP], ZrO.sub.2/HA, porous material containing cobalt and a mesoporous Bioglass ® [Co-MBG], porous material containing copper and a mesoporous Bioglass ® [Cu-MBG], β-TCP/Mg, or Sr/CPP

(289) According to another particular aspect, the invention relates to the use of a miPEP or fragment of said miPEP as defined above, in combination with one or more additives, said additives being chosen from the group consisting of: cytokines as well as bone morphogenetic protein (BMP) and/or dexamethasone;

(290) and in combination with a biomaterial, said biomaterial being selected from the group shown in Table 1 (cf. p 39-41).

(291) According to another particular aspect, the invention relates to the use of a miPEP fragment of sequence SEQ ID NO: 11 752 to promote osteogenesis of mesenchymal stem cells in combination with a biomaterial, said biomaterial being the HA/β-TCP in a ratio of 20/80.

(292) Another aspect of the invention is that it relates to osteo-induced cells with one or more miPEP or fragment of said miPEP as defined above, said cells being in particular mesenchymal stem cells.

(293) Another aspect of the invention is that it relates to cells comprising a nucleic acid encoding one or more of the miPEPs as defined above, the expression of said nucleic acid being inducible or not, said cells being in particular mesenchymal stem cells.

(294) According to another particular aspect, the invention relates to a composite biomaterial comprising osteo-induced cells as defined above or cells as defined above, in combination or not with one or more additives, said additives being chosen from the group consisting of: cytokines such as bone morphogenetic proteins (BMP) and/or dexamethasone, said biomaterial being selected from the group shown in Table 1 (cf. p. 39-41).

(295) According to another particular aspect, the invention relates to a composite biomaterial comprising osteo-induced mesenchymal stem cells with a miPEP fragment of sequence SEQ ID NO: 11 752, said biomaterial being the HA/β-TCP in a ratio of 20/80.

(296) TABLE-US-00011 TABLE 2 MiRs involved in cancer, bacterial or fungal infections, cardiovascular diseases, hereditary congenital diseases, skin diseases and eye diseases Hereditary Bacterial or Cardiovascular congenital Cancer fungal infections diseases diseases Skin diseases Eye diseases hsa-let-7a-2 hsa-let-7a-2 hsa-let-7a-2 hsa-let-7a-2 hsa-let-7b hsa-let-7a-2 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7g hsa-let-7a-3 hsa-let-7b hsa-let-7b hsa-let-7b hsa-let-7b hsa-let-7i hsa-let-7b hsa-let-7d hsa-let-7d hsa-let-7d hsa-let-7d hsa-mir-106a hsa-let-7d hsa-let-7e hsa-let-7e hsa-let-7e hsa-let-7e hsa-mir-10a hsa-let-7e hsa-let-7g hsa-let-7g hsa-let-7g hsa-let-7g hsa-mir-10b hsa-let-7g hsa-let-7i hsa-let-7i hsa-let-7i hsa-let-7i hsa-mir-1246 hsa-let-7i hsa-mir-100 hsa-mir-100 hsa-mir-100 hsa-mir-100 hsa-mir-132 hsa-mir-106a hsa-mir-106a hsa-mir-106a hsa-mir-106a hsa-mir-106a hsa-mir-134 hsa-mir-10a hsa-mir-10a hsa-mir-10a hsa-mir-10a hsa-mir-10a hsa-mir-141 hsa-mir-10b hsa-mir-10b hsa-mir-10b hsa-mir-10b hsa-mir-10b hsa-mir-142 hsa-mir-1246 hsa-mir-122 hsa-mir-122 hsa-mir-122 hsa-mir-122 hsa-mir-145 hsa-mir-125a hsa-mir-1246 hsa-mir-1246 hsa-mir-1246 hsa-mir-1246 hsa-mir-146a hsa-mir-134 hsa-mir-125a hsa-mir-129-1 hsa-mir-125a hsa-mir-125a hsa-mir-148a hsa-mir-141 hsa-mir-130b hsa-mir-130b hsa-mir-129-1 hsa-mir-130b hsa-mir-150 hsa-mir-143 hsa-mir-132 hsa-mir-133b hsa-mir-130b hsa-mir-132 hsa-mir-155 hsa-mir-144 hsa-mir-133b hsa-mir-134 hsa-mir-132 hsa-mir-134 hsa-mir-181c hsa-mir-145 hsa-mir-134 hsa-mir-141 hsa-mir-133b hsa-mir-141 hsa-mir-182 hsa-mir-155 hsa-mir-141 hsa-mir-142 hsa-mir-134 hsa-mir-142 hsa-mir-183 hsa-mir-181c hsa-mir-142 hsa-mir-143 hsa-mir-141 hsa-mir-143 hsa-mir-184 hsa-mir-182 hsa-mir-143 hsa-mir-144 hsa-mir-142 hsa-mir-145 hsa-mir-18b hsa-mir-183 hsa-mir-144 hsa-mir-145 hsa-mir-143 hsa-mir-146a hsa-mir-192 hsa-mir-18b hsa-mir-145 hsa-mir-146a hsa-mir-144 hsa-mir-146b hsa-mir-195 hsa-mir-192 hsa-mir-146a hsa-mir-154 hsa-mir-145 hsa-mir-148a hsa-mir-200a hsa-mir-195 hsa-mir-146b hsa-mir-155 hsa-mir-146a hsa-mir-154 hsa-mir-202 hsa-mir-200b hsa-mir-148a hsa-mir-181a-1 hsa-mir-146b hsa-mir-155 hsa-mir-203 hsa-mir-202 hsa-mir-150 hsa-mir-181a-2 hsa-mir-150 hsa-mir-181a-2 hsa-mir-205 hsa-mir-203 hsa-mir-154 hsa-mir-181c hsa-mir-154 hsa-mir-181c hsa-mir-206 hsa-mir-205 hsa-mir-155 hsa-mir-182 hsa-mir-155 hsa-mir-181d hsa-mir-20b hsa-mir-20b hsa-mir-181c hsa-mir-183 hsa-mir-181a-1 hsa-mir-182 hsa-mir-21 hsa-mir-21 hsa-mir-181d hsa-mir-184 hsa-mir-181a-2 hsa-mir-183 hsa-mir-210 hsa-mir-210 hsa-mir-182 hsa-mir-187 hsa-mir-181c hsa-mir-18b hsa-mir-221 hsa-mir-212 hsa-mir-183 hsa-mir-18b hsa-mir-181d hsa-mir-192 hsa-mir-222 hsa-mir-221 hsa-mir-184 hsa-mir-192 hsa-mir-182 hsa-mir-193a hsa-mir-27a hsa-mir-222 hsa-mir-187 hsa-mir-193b hsa-mir-183 hsa-mir-193b hsa-mir-29a hsa-mir-23a hsa-mir-18b hsa-mir-195 hsa-mir-184 hsa-mir-195 hsa-mir-29c hsa-mir-27a hsa-mir-192 hsa-mir-196a-2 hsa-mir-187 hsa-mir-202 hsa-mir-30a hsa-mir-298 hsa-mir-193b hsa-mir-19b-2 hsa-mir-18b hsa-mir-203 hsa-mir-30b hsa-mir-30a hsa-mir-195 hsa-mir-200b hsa-mir-192 hsa-mir-206 hsa-mir-345 hsa-mir-30d hsa-mir-200a hsa-mir-200c hsa-mir-193a hsa-mir-20b hsa-mir-34a hsa-mir-331 hsa-mir-200b hsa-mir-202 hsa-mir-193b hsa-mir-21 hsa-mir-377 hsa-mir-345 hsa-mir-200c hsa-mir-203 hsa-mir-195 hsa-mir-210 hsa-mir-409 hsa-mir-377 hsa-mir-202 hsa-mir-205 hsa-mir-19b-2 hsa-mir-212 hsa-mir-495 hsa-mir-495 hsa-mir-203 hsa-mir-206 hsa-mir-200a hsa-mir-217 hsa-mir-520h hsa-mir-542 hsa-mir-205 hsa-mir-20b hsa-mir-200c hsa-mir-221 hsa-mir-542 hsa-mir-572 hsa-mir-206 hsa-mir-21 hsa-mir-202 hsa-mir-222 hsa-mir-572 hsa-mir-648 hsa-mir-20b hsa-mir-210 hsa-mir-203 hsa-mir-23a hsa-mir-648 hsa-mir-96 hsa-mir-21 hsa-mir-2114 hsa-mir-205 hsa-mir-27a hsa-mir-92b hsa-mir-99b hsa-mir-210 hsa-mir-212 hsa-mir-206 hsa-mir-29a hsa-mir-96 hsa-mir-212 hsa-mir-217 hsa-mir-20b hsa-mir-29c hsa-mir-99b hsa-mir-216a hsa-mir-219-2 hsa-mir-21 hsa-mir-30a hsa-mir-217 hsa-mir-221 hsa-mir-210 hsa-mir-30b hsa-mir-221 hsa-mir-222 hsa-mir-212 hsa-mir-30c-2 hsa-mir-222 hsa-mir-23a hsa-mir-217 hsa-mir-30d hsa-mir-23a hsa-mir-24-2 hsa-mir-221 hsa-mir-3178 hsa-mir-27a hsa-mir-27a hsa-mir-222 hsa-mir-331 hsa-mir-297 hsa-mir-296 hsa-mir-23a hsa-mir-345 hsa-mir-298 hsa-mir-29a hsa-mir-24-2 hsa-mir-34a hsa-mir-29a hsa-mir-29b-1 hsa-mir-27a hsa-mir-363 hsa-mir-29b-1 hsa-mir-29b-2 hsa-mir-29a hsa-mir-369 hsa-mir-29c hsa-mir-29c hsa-mir-29b-1 hsa-mir-371 hsa-mir-301b hsa-mir-30a hsa-mir-29b-2 hsa-mir-372 hsa-mir-30a hsa-mir-30b hsa-mir-29c hsa-mir-373 hsa-mir-30b hsa-mir-30d hsa-mir-30a hsa-mir-374a hsa-mir-30d hsa-mir-331 hsa-mir-30b hsa-mir-377 hsa-mir-320 hsa-mir-345 hsa-mir-30c-2 hsa-mir-379 hsa-mir-331 hsa-mir-34a hsa-mir-30d hsa-mir-409 hsa-mir-345 hsa-mir-648 hsa-mir-3178 hsa-mir-422a hsa-mir-34a hsa-mir-96 hsa-mir-331 hsa-mir-494 hsa-mir-373 hsa-mir-99b hsa-mir-345 hsa-mir-495 hsa-mir-374a hsa-mir-34a hsa-mir-497 hsa-mir-377 hsa-mir-363 hsa-mir-505 hsa-mir-379 hsa-mir-369 hsa-mir-518c hsa-mir-382 hsa-mir-371 hsa-mir-519e hsa-mir-409 hsa-mir-372 hsa-mir-520a hsa-mir-422a hsa-mir-373 hsa-mir-520g hsa-mir-429 hsa-mir-374a hsa-mir-522 hsa-mir-485 hsa-mir-377 hsa-mir-523 hsa-mir-493 hsa-mir-379 hsa-mir-542 hsa-mir-494 hsa-mir-409 hsa-mir-572 hsa-mir-495 hsa-mir-422a hsa-mir-648 hsa-mir-496 hsa-mir-494 hsa-mir-654 hsa-mir-497 hsa-mir-495 hsa-mir-665 hsa-mir-506 hsa-mir-497 hsa-mir-769 hsa-mir-507 hsa-mir-505 hsa-mir-92b hsa-mir-508 hsa-mir-518c hsa-mir-96 hsa-mir-509-1 hsa-mir-519e hsa-mir-99b hsa-mir-510 hsa-mir-520a hsa-mir-520h hsa-mir-520g hsa-mir-523 hsa-mir-520h hsa-mir-525 hsa-mir-522 hsa-mir-542 hsa-mir-523 hsa-mir-568 hsa-mir-542 hsa-mir-570 hsa-mir-572 hsa-mir-572 hsa-mir-648 hsa-mir-633 hsa-mir-654 hsa-mir-648 hsa-mir-665 hsa-mir-7-2 hsa-mir-769 hsa-mir-92b hsa-mir-92b hsa-mir-940 hsa-mir-96 hsa-mir-96 hsa-mir-99b hsa-mir-99b hsa-mir-15a hsa-mir-15b

(297) TABLE-US-00012 TABLE 3 MiRs involved in diseases of the digestive system, diseases of the endocrine system, diseases of the nervous system, diseases related to viruses, diseases related to nutrition and metabolism and lymphatic diseases and hemopathies Diseases of the Diseases related Lymphatic Diseases of the endocrine Diseases of the Diseases related to nutrition and diseases and digestive system system nervous system to viruses metabolism hemopathies hsa-let-7a-2 hsa-let-7a-2 hsa-let-7b hsa-let-7b hsa-let-7b hsa-let-7a-2 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7d hsa-let-7d hsa-let-7g hsa-let-7a-3 hsa-let-7b hsa-let-7b hsa-let-7g hsa-let-7g hsa-let-7i hsa-let-7b hsa-let-7d hsa-let-7d hsa-let-7i hsa-mir-106a hsa-mir-100 hsa-let-7d hsa-let-7e hsa-let-7e hsa-mir-100 hsa-mir-10a hsa-mir-106a hsa-let-7e hsa-let-7g hsa-let-7g hsa-mir-106a hsa-mir-10b hsa-mir-10a hsa-let-7g hsa-let-7i hsa-let-7i hsa-mir-10a hsa-mir-122 hsa-mir-10b hsa-let-7i hsa-mir-100 hsa-mir-106a hsa-mir-10b hsa-mir-1246 hsa-mir-122 hsa-mir-106a hsa-mir-106a hsa-mir-10a hsa-mir-122 hsa-mir-132 hsa-mir-1246 hsa-mir-10a hsa-mir-10a hsa-mir-10b hsa-mir-1246 hsa-mir-134 hsa-mir-125a hsa-mir-125a hsa-mir-10b hsa-mir-1246 hsa-mir-125a hsa-mir-145 hsa-mir-129-1 hsa-mir-130b hsa-mir-122 hsa-mir-132 hsa-mir-129-1 hsa-mir-155 hsa-mir-130b hsa-mir-132 hsa-mir-1246 hsa-mir-134 hsa-mir-130b hsa-mir-181c hsa-mir-132 hsa-mir-141 hsa-mir-125a hsa-mir-142 hsa-mir-132 hsa-mir-182 hsa-mir-133b hsa-mir-142 hsa-mir-130b hsa-mir-145 hsa-mir-133b hsa-mir-183 hsa-mir-134 hsa-mir-143 hsa-mir-132 hsa-mir-150 hsa-mir-134 hsa-mir-18b hsa-mir-141 hsa-mir-144 hsa-mir-134 hsa-mir-155 hsa-mir-141 hsa-mir-192 hsa-mir-142 hsa-mir-145 hsa-mir-141 hsa-mir-181c hsa-mir-142 hsa-mir-195 hsa-mir-143 hsa-mir-146a hsa-mir-143 hsa-mir-182 hsa-mir-143 hsa-mir-202 hsa-mir-144 hsa-mir-150 hsa-mir-145 hsa-mir-183 hsa-mir-144 hsa-mir-206 hsa-mir-145 hsa-mir-155 hsa-mir-146a hsa-mir-184 hsa-mir-145 hsa-mir-20b hsa-mir-146a hsa-mir-181c hsa-mir-148a hsa-mir-18b hsa-mir-146a hsa-mir-21 hsa-mir-146b hsa-mir-182 hsa-mir-150 hsa-mir-192 hsa-mir-146b hsa-mir-210 hsa-mir-154 hsa-mir-183 hsa-mir-154 hsa-mir-195 hsa-mir-154 hsa-mir-212 hsa-mir-155 hsa-mir-187 hsa-mir-155 hsa-mir-200a hsa-mir-155 hsa-mir-217 hsa-mir-181a-1 hsa-mir-18b hsa-mir-182 hsa-mir-202 hsa-mir-181a-1 hsa-mir-296 hsa-mir-181a-2 hsa-mir-192 hsa-mir-183 hsa-mir-203 hsa-mir-181a-2 hsa-mir-30d hsa-mir-181c hsa-mir-193b hsa-mir-18b hsa-mir-205 hsa-mir-181c hsa-mir-345 hsa-mir-181d hsa-mir-195 hsa-mir-192 hsa-mir-20b hsa-mir-181d hsa-mir-34a hsa-mir-182 hsa-mir-200b hsa-mir-195 hsa-mir-21 hsa-mir-182 hsa-mir-648 hsa-mir-183 hsa-mir-202 hsa-mir-200a hsa-mir-210 hsa-mir-183 hsa-mir-96 hsa-mir-184 hsa-mir-203 hsa-mir-200b hsa-mir-212 hsa-mir-184 hsa-mir-99b hsa-mir-187 hsa-mir-205 hsa-mir-200c hsa-mir-29a hsa-mir-187 hsa-mir-18b hsa-mir-20b hsa-mir-202 hsa-mir-29c hsa-mir-18b hsa-mir-192 hsa-mir-21 hsa-mir-203 hsa-mir-30b hsa-mir-192 hsa-mir-193a hsa-mir-210 hsa-mir-205 hsa-mir-30d hsa-mir-193a hsa-mir-193b hsa-mir-216a hsa-mir-206 hsa-mir-331 hsa-mir-193b hsa-mir-195 hsa-mir-221 hsa-mir-20b hsa-mir-345 hsa-mir-195 hsa-mir-19b-2 hsa-mir-222 hsa-mir-21 hsa-mir-34a hsa-mir-19b-2 hsa-mir-200c hsa-mir-23a hsa-mir-210 hsa-mir-377 hsa-mir-200c hsa-mir-202 hsa-mir-27a hsa-mir-212 hsa-mir-409 hsa-mir-202 hsa-mir-203 hsa-mir-298 hsa-mir-217 hsa-mir-495 hsa-mir-203 hsa-mir-205 hsa-mir-301b hsa-mir-221 hsa-mir-520h hsa-mir-205 hsa-mir-206 hsa-mir-30a hsa-mir-222 hsa-mir-542 hsa-mir-206 hsa-mir-20b hsa-mir-331 hsa-mir-23a hsa-mir-572 hsa-mir-20b hsa-mir-21 hsa-mir-345 hsa-mir-27a hsa-mir-648 hsa-mir-21 hsa-mir-210 hsa-mir-34a hsa-mir-296 hsa-mir-96 hsa-mir-210 hsa-mir-212 hsa-mir-373 hsa-mir-29a hsa-mir-99b hsa-mir-212 hsa-mir-217 hsa-mir-374a hsa-mir-29c hsa-mir-217 hsa-mir-221 hsa-mir-377 hsa-mir-30a hsa-mir-221 hsa-mir-222 hsa-mir-485 hsa-mir-30b hsa-mir-222 hsa-mir-23a hsa-mir-493 hsa-mir-30d hsa-mir-23a hsa-mir-24-2 hsa-mir-495 hsa-mir-320 hsa-mir-24-2 hsa-mir-27a hsa-mir-496 hsa-mir-331 hsa-mir-27a hsa-mir-29a hsa-mir-523 hsa-mir-345 hsa-mir-29a hsa-mir-29b-1 hsa-mir-525 hsa-mir-34a hsa-mir-29b-1 hsa-mir-29b-2 hsa-mir-542 hsa-mir-377 hsa-mir-29b-2 hsa-mir-29c hsa-mir-568 hsa-mir-379 hsa-mir-29c hsa-mir-30a hsa-mir-570 hsa-mir-411 hsa-mir-30a hsa-mir-30b hsa-mir-572 hsa-mir-429 hsa-mir-30b hsa-mir-30c-2 hsa-mir-633 hsa-mir-494 hsa-mir-30c-2 hsa-mir-30d hsa-mir-648 hsa-mir-497 hsa-mir-30d hsa-mir-3178 hsa-mir-92b hsa-mir-648 hsa-mir-3178 hsa-mir-331 hsa-mir-99b hsa-mir-96 hsa-mir-331 hsa-mir-345 hsa-mir-451 hsa-mir-99b hsa-mir-345 hsa-mir-34a hsa-mir-34a hsa-mir-363 hsa-mir-363 hsa-mir-369 hsa-mir-369 hsa-mir-371 hsa-mir-371 hsa-mir-372 hsa-mir-372 hsa-mir-373 hsa-mir-373 hsa-mir-374a hsa-mir-374a hsa-mir-379 hsa-mir-379 hsa-mir-409 hsa-mir-409 hsa-mir-422a hsa-mir-422a hsa-mir-494 hsa-mir-494 hsa-mir-497 hsa-mir-495 hsa-mir-505 hsa-mir-497 hsa-mir-518c hsa-mir-505 hsa-mir-519e hsa-mir-518c hsa-mir-520a hsa-mir-519e hsa-mir-520g hsa-mir-520a hsa-mir-522 hsa-mir-520g hsa-mir-523 hsa-mir-522 hsa-mir-572 hsa-mir-523 hsa-mir-648 hsa-mir-572 hsa-mir-654 hsa-mir-648 hsa-mir-665 hsa-mir-654 hsa-mir-769 hsa-mir-665 hsa-mir-92b hsa-mir-769 hsa-mir-96 hsa-mir-92b hsa-mir-99b hsa-mir-96 hsa-mir-103-1 hsa-mir-99b hsa-mir-103-2 hsa-mir-107

(298) TABLE-US-00013 TABLE 4 MiRs involved in neonatal and hereditary diseases, respiratory diseases, urogenital diseases in men, urogenital diseases in women, disorders of the immune system and musculoskeletal disorders Urogenital Urogenital Neonatal and Respiratory diseases in diseases in Disorders of the Musculoskeletal hereditary diseases diseases men women immune system disorders hsa-let-7a-2 hsa-let-7a-2 hsa-let-7a-2 hsa-let-7a-2 hsa-let-7a-2 hsa-let-7b hsa-let-7a-3 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7a-3 hsa-let-7g hsa-let-7b hsa-let-7b hsa-let-7b hsa-let-7b hsa-let-7b hsa-mir-106a hsa-let-7d hsa-let-7d hsa-let-7d hsa-let-7d hsa-let-7d hsa-mir-10a hsa-let-7e hsa-let-7e hsa-let-7e hsa-let-7e hsa-let-7e hsa-mir-10b hsa-let-7g hsa-let-7g hsa-let-7g hsa-let-7g hsa-let-7g hsa-mir-1246 hsa-let-7i hsa-let-7i hsa-let-7i hsa-let-7i hsa-let-7i hsa-mir-132 hsa-mir-100 hsa-mir-106a hsa-mir-106a hsa-mir-106a hsa-mir-100 hsa-mir-134 hsa-mir-106a hsa-mir-10a hsa-mir-10b hsa-mir-10b hsa-mir-106a hsa-mir-142 hsa-mir-10a hsa-mir-10b hsa-mir-132 hsa-mir-132 hsa-mir-10a hsa-mir-145 hsa-mir-10b hsa-mir-1197 hsa-mir-142 hsa-mir-142 hsa-mir-10b hsa-mir-146a hsa-mir-122 hsa-mir-122 hsa-mir-143 hsa-mir-143 hsa-mir-122 hsa-mir-150 hsa-mir-1246 hsa-mir-1246 hsa-mir-145 hsa-mir-145 hsa-mir-1246 hsa-mir-155 hsa-mir-125a hsa-mir-125a hsa-mir-150 hsa-mir-150 hsa-mir-125a hsa-mir-181c hsa-mir-130b hsa-mir-130b hsa-mir-181c hsa-mir-181c hsa-mir-130b hsa-mir-182 hsa-mir-132 hsa-mir-132 hsa-mir-182 hsa-mir-182 hsa-mir-132 hsa-mir-183 hsa-mir-134 hsa-mir-134 hsa-mir-183 hsa-mir-183 hsa-mir-134 hsa-mir-184 hsa-mir-141 hsa-mir-135b hsa-mir-184 hsa-mir-184 hsa-mir-141 hsa-mir-18b hsa-mir-142 hsa-mir-141 hsa-mir-192 hsa-mir-192 hsa-mir-142 hsa-mir-192 hsa-mir-143 hsa-mir-142 hsa-mir-195 hsa-mir-195 hsa-mir-143 hsa-mir-195 hsa-mir-145 hsa-mir-143 hsa-mir-200a hsa-mir-200a hsa-mir-144 hsa-mir-200a hsa-mir-146a hsa-mir-144 hsa-mir-202 hsa-mir-202 hsa-mir-145 hsa-mir-202 hsa-mir-146b hsa-mir-145 hsa-mir-203 hsa-mir-203 hsa-mir-146a hsa-mir-203 hsa-mir-148a hsa-mir-146a hsa-mir-205 hsa-mir-205 hsa-mir-146b hsa-mir-205 hsa-mir-154 hsa-mir-146b hsa-mir-21 hsa-mir-21 hsa-mir-148a hsa-mir-206 hsa-mir-155 hsa-mir-148a hsa-mir-210 hsa-mir-210 hsa-mir-150 hsa-mir-20b hsa-mir-181a-2 hsa-mir-150 hsa-mir-212 hsa-mir-212 hsa-mir-154 hsa-mir-21 hsa-mir-181c hsa-mir-154 hsa-mir-29a hsa-mir-29a hsa-mir-155 hsa-mir-210 hsa-mir-181d hsa-mir-155 hsa-mir-29c hsa-mir-29c hsa-mir-181a-2 hsa-mir-27a hsa-mir-182 hsa-mir-181a-2 hsa-mir-30b hsa-mir-30b hsa-mir-181c hsa-mir-29a hsa-mir-183 hsa-mir-181c hsa-mir-30d hsa-mir-30d hsa-mir-181d hsa-mir-29c hsa-mir-18b hsa-mir-182 hsa-mir-331 hsa-mir-331 hsa-mir-182 hsa-mir-30b hsa-mir-192 hsa-mir-183 hsa-mir-34a hsa-mir-34a hsa-mir-183 hsa-mir-345 hsa-mir-193a hsa-mir-18b hsa-mir-377 hsa-mir-377 hsa-mir-184 hsa-mir-377 hsa-mir-193b hsa-mir-192 hsa-mir-409 hsa-mir-409 hsa-mir-187 hsa-mir-409 hsa-mir-195 hsa-mir-193a hsa-mir-495 hsa-mir-495 hsa-mir-18b hsa-mir-495 hsa-mir-202 hsa-mir-193b hsa-mir-520h hsa-mir-520h hsa-mir-192 hsa-mir-520h hsa-mir-203 hsa-mir-195 hsa-mir-542 hsa-mir-542 hsa-mir-193a hsa-mir-542 hsa-mir-206 hsa-mir-200a hsa-mir-572 hsa-mir-572 hsa-mir-193b hsa-mir-572 hsa-mir-20b hsa-mir-200b hsa-mir-648 hsa-mir-648 hsa-mir-195 hsa-mir-648 hsa-mir-21 hsa-mir-200c hsa-mir-96 hsa-mir-96 hsa-mir-200a hsa-mir-96 hsa-mir-210 hsa-mir-202 hsa-mir-99b hsa-mir-99b hsa-mir-200b hsa-mir-99b hsa-mir-212 hsa-mir-203 hsa-mir-202 hsa-mir-217 hsa-mir-205 hsa-mir-203 hsa-mir-221 hsa-mir-206 hsa-mir-205 hsa-mir-222 hsa-mir-20b hsa-mir-20b hsa-mir-23a hsa-mir-21 hsa-mir-21 hsa-mir-27a hsa-mir-210 hsa-mir-210 hsa-mir-29a hsa-mir-212 hsa-mir-212 hsa-mir-29c hsa-mir-221 hsa-mir-216a hsa-mir-30a hsa-mir-222 hsa-mir-217 hsa-mir-30b hsa-mir-23a hsa-mir-221 hsa-mir-30c-2 hsa-mir-24-2 hsa-mir-222 hsa-mir-30d hsa-mir-27a hsa-mir-23a hsa-mir-3178 hsa-mir-298 hsa-mir-27a hsa-mir-331 hsa-mir-29a hsa-mir-298 hsa-mir-345 hsa-mir-29c hsa-mir-29a hsa-mir-34a hsa-mir-30a hsa-mir-29c hsa-mir-363 hsa-mir-30b hsa-mir-301b hsa-mir-369 hsa-mir-30d hsa-mir-30a hsa-mir-371 hsa-mir-320 hsa-mir-30b hsa-mir-372 hsa-mir-331 hsa-mir-30c-2 hsa-mir-373 hsa-mir-337 hsa-mir-30d hsa-mir-374a hsa-mir-345 hsa-mir-3178 hsa-mir-377 hsa-mir-34a hsa-mir-331 hsa-mir-379 hsa-mir-369 hsa-mir-345 hsa-mir-409 hsa-mir-374a hsa-mir-34a hsa-mir-422a hsa-mir-374b hsa-mir-363 hsa-mir-494 hsa-mir-377 hsa-mir-369 hsa-mir-495 hsa-mir-379 hsa-mir-371 hsa-mir-497 hsa-mir-382 hsa-mir-372 hsa-mir-505 hsa-mir-409 hsa-mir-373 hsa-mir-518c hsa-mir-411 hsa-mir-374a hsa-mir-519e hsa-mir-422a hsa-mir-377 hsa-mir-520a hsa-mir-429 hsa-mir-379 hsa-mir-520g hsa-mir-450b hsa-mir-409 hsa-mir-522 hsa-mir-487a hsa-mir-422a hsa-mir-523 hsa-mir-493 hsa-mir-485 hsa-mir-542 hsa-mir-494 hsa-mir-493 hsa-mir-572 hsa-mir-495 hsa-mir-494 hsa-mir-648 hsa-mir-505 hsa-mir-495 hsa-mir-654 hsa-mir-518d hsa-mir-496 hsa-mir-665 hsa-mir-518e hsa-mir-497 hsa-mir-769 hsa-mir-518f hsa-mir-505 hsa-mir-92b hsa-mir-520a hsa-mir-518c hsa-mir-96 hsa-mir-520d hsa-mir-519e hsa-mir-99b hsa-mir-520e hsa-mir-520a hsa-mir-523 hsa-mir-520g hsa-mir-542 hsa-mir-520h hsa-mir-543 hsa-mir-522 hsa-mir-570 hsa-mir-523 hsa-mir-572 hsa-mir-525 hsa-mir-648 hsa-mir-542 hsa-mir-656 hsa-mir-568 hsa-mir-668 hsa-mir-570 hsa-mir-758 hsa-mir-572 hsa-mir-769 hsa-mir-633 hsa-mir-96 hsa-mir-648 hsa-mir-99b hsa-mir-654 hsa-mir-665 hsa-mir-769 hsa-mir-92b hsa-mir-96 hsa-mir-99b

(299) TABLE-US-00014 TABLE 5 The top 10 miRs involved in cancers, bacterial and fungal infections, immune system disorders, cardiovascular diseases, hereditary congenital diseases, skin diseases, musculoskeletal disorders, eye diseases and diseases of the digestive system. bacterial Immune Hereditary Diseases of infections - system Cardiovascular congenital Skin Musculoskeletal Eye the digestive Cancer Mycosis disorders diseases diseases diseases disorders diseases system hsa-mir-21 hsa-mir-155 hsa-mir-192 hsa-mir-192 hsa-mir-192 hsa-mir- hsa-mir-192 hsa-mir- hsa-mir-122 182 192 hsa-mir-145 hsa-mir-21 hsa-mir-221 hsa-mir-21 hsa-mir-221 hsa-mir- hsa-mir-210 hsa-mir- hsa-mir-192 221 145 hsa-mir-192 hsa-mir-203 hsa-mir-141 hsa-mir-122 hsa-let-7i hsa-mir- hsa-mir-182 hsa-let-7g hsa-mir-21 203 hsa-mir-205 hsa-mir-195 hsa-mir-145 hsa-mir-145 hsa-mir-122 hsa-mir- hsa-mir-183 hsa-mir- hsa-mir-210 106a 331 hsa-mir-143 hsa-let-7b hsa-mir-182 hsa-mir-210 hsa-mir-141 hsa-mir- hsa-mir-96 hsa-mir- hsa-mir-99b 155 99b hsa-mir-10a hsa-let-7d hsa-mir-21 hsa-mir-29c hsa-mir-182 hsa-mir-29a hsa-mir-106a hsa-mir- hsa-let-7b 182 hsa-mir-106a hsa-mir-145 hsa-mir-203 hsa-mir-497 hsa-mir-155 hsa-mir- hsa-mir-10b hsa-mir- hsa-let-7d 210 183 hsa-mir-146a hsa-mir- hsa-let-7i hsa-mir-96 hsa-mir-145 hsa-mir- hsa-mir-1246 hsa-mir- hsa-mir-10a 1246 148a 195 hsa-mir-182 hsa-mir-192 hsa-mir-106a hsa-mir-132 hsa-mir-222 hsa-mir- hsa-mir-132 hsa-mir- hsa-let-7g 141 106a hsa-mir-221 hsa-let-7g hsa-mir-122 hsa-mir-141 hsa-mir-20b hsa-let-7i hsa-mir-134 hsa-mir-10a hsa-let-7i

(300) TABLE-US-00015 TABLE 6 The top 10 miRs involved in diseases of the endocrine system, diseases of the nervous system, diseases related to viruses, diseases related to nutrition and metabolism, lymphatic diseases and hemopathies, neonatal and hereditary diseases, respiratory diseases, urogenital diseases in men, urogenital diseases in women. Diseases diseases of related to Neonatal the diseases of Diseases nutrition Lymphatic and Urogenital Urogenital endocrine the nervous related to and diseases and hereditary Respiratory diseases in diseases in system system viruses metabolism hemopathies diseases diseases men women hsa-mir-145 hsa-mir-192 hsa-mir-122 hsa-mir-192 hsa-mir-106a hsa-mir-192 hsa-mir-21 hsa-mir-21 hsa-mir-21 hsa-mir-21 hsa-mir-122 hsa-mir-192 hsa-mir-122 hsa-mir-205 hsa-mir-221 hsa-mir-145 hsa-let-7b hsa-let-7b hsa-mir-192 hsa-mir-145 hsa-mir-195 hsa-mir-21 hsa-mir-145 hsa-mir-182 hsa-mir-143 hsa-mir-145 hsa-mir-145 hsa-mir-181c hsa-mir-141 hsa-mir- hsa-mir-141 hsa-mir-125a hsa-let-7i hsa-mir-144 hsa-mir- hsa-mir-181c 18b 106a hsa-mir-182 hsa-mir-142 hsa-mir-21 hsa-mir-145 hsa-mir-141 hsa-mir-122 hsa-mir-182 hsa-let-7d hsa-let-7d hsa-mir-183 hsa-mir-143 hsa-mir- hsa-mir-142 hsa-mir-143 hsa-mir-141 hsa-mir-195 hsa-mir- hsa-mir-106a 1246 181c hsa-mir-96 hsa-mir-146a hsa-mir-212 hsa-mir-143 hsa-let-7d hsa-mir-145 hsa-mir-192 hsa-mir-192 hsa-mir-192 hsa-mir-210 hsa-mir-100 hsa-mir-34a hsa-mir-155 hsa-let-7i hsa-mir-155 hsa-mir-221 hsa-mir-195 hsa-mir-195 hsa-mir-212 hsa-mir-155 hsa-mir- hsa-mir-182 hsa-mir-331 hsa-mir-222 hsa-mir-222 hsa-mir- hsa-mir-200a 106a 200a hsa-mir-132 hsa-mir-182 hsa-mir-10a hsa-mir-183 hsa-mir-192 hsa-mir-20b hsa-mir-27a hsa-mir-202 hsa-mir-202

(301) The following examples will better illustrate the invention without limiting its scope.

EXAMPLES

Example 1: miPEP 125a-1 and miPEP 145-2

(302) A transcriptomic analysis carried out by the inventors has revealed that the miR 125a-1 and miR 145-2 are overexpressed during the differentiation of the cells into osteoblasts (unpublished results).

(303) The miPEPs 125a-1 and 145-2 sequences were identified from the primary transcripts of miRs 125a-1 and 145-2.

(304) The respective effects of miPEP 125a-1 and miPEP 145-2 on differentiation of mesenchymal stem cells were analyzed by measuring the expression of the iBSP, PTHR1, STMN2 and OSTERIX genes that correspond to markers of osteogenesis and of osteoblast differentiation (Chiellini et al., Biochem Biophys Res Commun, 374(1):64-8, 2008; Cordonnier et al., Tissue Eng, 17(3): 249-259, 2011).

(305) The experiments were carried out with two fragments of 10 amino acids respectively corresponding to the N-terminal part of the miPEP 125a-1 (=miPEP//125a-1 fragment) and to the N-terminal part of the miPEP 145-2 (=fragment miPEP//145-2).

(306) Mesenschymal stem cells from 4 different donors were cultured for 24 hours in PROLIF medium (αMEM+10% FCS) with or without miPEP//then for 3 days in DIF+BMP4 medium (αMEM+2% FCS+b-Glycerophosphate+Ascorbic acid+BMP4), DIF ΔBMP4 medium (αMEM+2% FCS+b-Glycerophosphate+Ascorbic acid) or PROLIF medium (αMEM+10% FCS), with or without miPEP//.

(307) The expression of the iBSP, PTHR1, STMN2 and OSTERIX genes was then measured in mesenchymal stem cells cultured in the presence or absence of a miPEP*.

(308) 1.1—Results

(309) In DIF+BMP4 Medium

(310) The miPEP//125a-1 increases the expression of the iBSP, PTHR1, STMN2 and OSTERIX genes (FIGS. 2, 3, 4 and 5).

(311) The miPEP//145-2 increases the expression of the STMN2 gene (FIG. 6).

(312) In DIF ΔBMP4 Medium

(313) The miPEP//125a-1 increases the expression of the STMN2 and OSTERIX genes (FIGS. 7 and 8).

(314) The miPEP//145-2 increases the expression of the STMN2 and OSTERIX genes (FIGS. 9 and 10).

(315) In PROLIF Medium

(316) The miPEP//145-2 increases the expression STMN2 gene (FIG. 11).

(317) The above results show that miPEP//125a-1 and miPEP//145-2 increase the expression of osteoblast marker genes, indicating that these miPEPs promote osteoblast differentiation of mesenchymal stem cells.

(318) 1.2—Materials MEMα GIBCO (reference 22561-021).Math.“αMEM”, Fetal bovine serum (FBS), Penicillin/streptomycin GIBCO (reference 15140-122) “P/S”, Dulbecco's PBS GIBCO (reference 14190-169).Math.“PBS”, 12-well plate, βglycerophosphate SIGMA (reference G9422), Ascorbic acid SIGMA (reference A8960), BMP4 PEPROTECH (reference 120-05ET).Math.“BMP4”,

(319) TABLE-US-00016 miPEP//125a-1  (MSLCLSPSLT, SEQ ID NO: 11 752),  miPEP//145-2  (MVGLNPPLWQ, SEQ ID NO: 11 751),  “scramble” control peptide ScmiPEP//125a   (IQVGHEDETD, SEQ ID NO: 11 758).

(320) 1.3—Methods

(321) a. Composition of Culture Media Proliferation medium (PROLIF): αMEM+10% FBS+1% P/S Differentiation medium+BMP4 (DIF+BMP4): αMEM+2% FBS+1% P/S+βglycerophosphate (10 mM)+Ascorbic acid (50 μM)+BMP4 (50 ng/mL) Differentiation medium without BMP4 (DIF ΔBMP4): αMEM+2% FBS+1% P/S+βglycerophosphate (10 mM)+Ascorbic acid (50 μM)

(322) b. Resuspension of Micropeptides

(323) The miPEP//145-2 was synthesized by Smartbioscience and dissolved at 2 mM in water. The miPEP//125a-1 was synthesized by Smartbioscience and dissolved in water+0.1% ammonium.

(324) c. Seeding of the Cells

(325) The mesenchymal stem cells were seeded in 12-well plates at 70,000 cells/well in 1 mL of PROLIF medium. The cells were then incubated for 72 h at 37° C. in a humid atmosphere with 5% CO.sub.2.

(326) d. Cell Treatment with miPEPs

(327) After 72 hours of incubation, the cells were pre-treated with 100 μM of miPEP or “scramble” peptide diluted in PROLIF medium, and then incubated at 37° C. for 24 hours. In parallel, cells treated with PROLIF±water or water+0.1% ammonium medium were used as a negative control.

(328) For 3 days, the cells were treated every 24 h with 100 μM of diluted miPEP either in DIF+BMP4 medium, or in DIF ΔBMP4 medium, or in PROLIF medium. Cells untreated or treated with water or water+0.1% ammonium were used as controls. The cells are incubated at 37° C.

(329) After 3 days of treatment, the culture supernatants were removed, the cell mats were washed once with PBS, and then the plates were frozen at −80° C. until the total RNAs were extracted.

(330) e. Extraction of Total RNA

(331) Total RNAs were extracted according to the supplier's recommendations with the miRNeasy microkit kit (Qiagen).

(332) f. Reverse Transcription Reaction

(333) The RNAs were reverse transcribed with the High Capacity cDNA reverse transcription kit (Applied Biosystem). 600 ng of RNA were added to 2 μL of RT buffer (10×), 2 μL of Random primer (10×), 0.8 μL of dNTPs (25×), 0.5 μL of RNAse OUT (40 U/μL) and 1 μL of multiscribe reverse transcriptase (50 U/μL) in a total volume of 20 μL. The reverse transcription reaction was carried out at 25° C. for 10 min and then 42° C. for 2 h. The activity of the enzyme was stopped by incubating the mixture at 85° C. for 5 min.

(334) g. Evaluation of Gene Expression by Quantitative RT-PCR

(335) The expression of osteoblastic transcription factors iBSP, PTHR1, STMN2 and OSTERIX was evaluated by quantitative RT-PCR with the SsoFast EvagGreen kit. For the RT-PCR reaction, 3 μL of reverse transcriptase diluted 1/8 were added to 1× of SsoFast EvaGreen, 10 μM of each primer and RNase free water in a final volume of 10 μL. The reaction was subjected to the following temperatures: 3 min pre-amplification at 95° C., 40 cycles of 10 sec at 95° C. and sec at 60° C. in a thermal cycler (CFX96 Real-time PCR detection system, Biorad). PPIA was used as a reference gene to normalize quantitative RT-PCR.

(336) For all PCR reactions, two replicates were used for each biological sample.

(337) TABLE-US-00017 TABLE 7  Sequences of the primers. Forward primer (5′-3′) Reverse primer (5′-3′) Reference PPIA TCT TTG GGA CCT TGT CTG GCC GAG GAA AAC CGT gene CAA (SEQ ID NO: 11 759) GTA CTA T (SEQ ID NO: 11 760) Osteo- iBSP GGG CAG TAG TGA CTC ATC CTC CAT AGC CCA GTG blastic CGA AG (SEQ ID NO: 11 761) TTG TAG CAG marker  (SEQ ID NO: 11762) genes OSX CTC CTG CGA CTG CCC TAA GCC TTG CCA TAC ACC T (SEQ ID NO: 11 763) TTG C (SEQ ID NO: 11 764) PTHR1 ACA TCT GCG TCC ACA TCA CCG TTC ACG AGT CTC GG (SEQ ID NO: 11 765) ATT GGT G (SEQ ID NO: 11766) STMN2 GCG GAG GAA AAG CTG TCC GCA GCA TGC CTC ATC CTG A TCC TT (SEQ ID NO: 11 768) (SEQ ID NO: 11 767)

Example 2: Cell Penetration of miPEPs

(338) The entry of miPEPs into mesenchymal stem cells (MSCs) was analyzed by fluorescence microscopy using fluorescein (FAM)-labeled miPEP//15a-16-1, fused or not to a peptide promoting cell penetration (TAT peptide).

(339) 2.1—Results

(340) In a first experiment, undifferentiated MSCs were incubated for 7 h with 5 μM, 10 μM, 50 μM or 100 μM of miPEP//15a-16-1-FAM (FIG. 12).

(341) In a second experiment, undifferentiated MSCs were incubated with 100 μM of miPEP//15a-16-1-FAM for 2 h, 4 h, 6 h, 8 h or 24 h (FIG. 13).

(342) In a third experiment, undifferentiated MSCs were incubated for 7 h with 5 μM, 10 μM, 20 μM, 50 μM or 100 μM of miPEP//15a-16-1-FAM-TAT (FIG. 14).

(343) In a fourth experiment, undifferentiated MSCs were incubated for 2 h, with 10 μM of miPEP//15a-16-1-FAM-TAT (FIG. 15).

(344) The above results indicate, on the one hand, that the miPEP//15a-16-1-FAM homogeneously penetrates the MSCs when the MSCs are treated with at least 50 μM of miPEP, and on the other hand, that the miPEP is captured in the core of the MSCs.

(345) The strongest fluorescence is observed from 4 h to 8 h after the treatment with the miPEP.

(346) These results also indicate that the addition of the TAT peptide to the miPEP promotes cell penetration by a factor of 10 relative to the cellular penetration of the miPEP without the TAT peptide.

(347) 2.2—Materials MEMα GIBCO (reference 22561-021).Math.“αMEM”, Fetal bovine serum (FBS), Penicillin/streptomycin GIBCO (reference 15140-122).Math.“P/S”, Dulbecco's PBS GIBCO (reference 14190-169).Math.“PBS”, 8-well IBIDI blade (15μ slide 8 well IBIDi; Biovalley), DRAQ5 (5 mM) Biostatus, Formaldehyde solution 37%,

(348) TABLE-US-00018 miPEP//15a-16-1  (MFKHRFFYMH, SEQ ID NO: 11 753),  miPEP//15a-16-1-TAT  (MFKHRFFYMH-YGRKKRRQRRR, SEQ ID NO: 11 757).

(349) 2.3—Methods

(350) Undifferentiated MSCs are incubated in ° MEM+10% FBS+1% P/S medium in the presence of fluorescein (FAM) labeled miPEP. After incubation from 2 h to 10 h, the wells are washed 3 times with PBS and then the cells are fixed for 5 min with 3.8% formaldehyde. The nuclei are marked with the Draq5 diluted 1/1 000. The cells are then observed under a confocal microscope in fluorescence.

Example 3: miPEP 15a-16-1

(351) A transcriptomic analysis carried out by the inventors has revealed that the miR 15a and miR 16-1 are overexpressed during the differentiation of the cells into osteoblasts (unpublished results).

(352) The miPEP 15a-16-1 sequence was identified from the primary transcript of 15a-16-1.

(353) The effect of miPEP 15a-16-1 on miR16-1 accumulation was analyzed in mesenchymal stem cells (MSCs). The experiments were carried out with a fragment of 10 amino acids respectively corresponding to the N-terminal portion of the miPEP 15a-16-1 (=fragment miPEP//15 a-16-1).

(354) MSCs from three different patients were treated with 10 μM of miPEP//15a-16-1 fused to TAT peptide (miPEP//15a-16-1-TAT) for 3 h, then the amount of miR16-1 was measured by RT-qPCR.

(355) 3.1—Results

(356) Treatment with miPEP//15a-16-1-TAT results in an increase in the amount of miR 16-1 (FIG. 16).

(357) 3.2—Materials MEMα GIBCO (reference 22561-021).Math.“αMEM”, Fetal bovine serum (FBS), Penicillin/streptomycin GIBCO (reference 15140-122).Math.“P/S”, Dulbecco's PBS GIBCO (reference 14190-169).Math.“PBS”,

(358) TABLE-US-00019 miPEP//15a-16-1-TAT  (MFKHRFFYMH-YGRKKRRQRRR, SEQ ID NO: 11 757), ScmiPEP//21  (RPHLRMELPV). 

(359) 3.3—Methods

(360) a. Resuspension of Micropeptides

(361) Peptides were synthesized by Smartbioscience and dissolved at 2 mM in water.

(362) b. Seeding of the Cells

(363) The MSCs were seeded in wells of 12-well plates at 72,900 cells per well under 1 mL of PROLIF medium. The cells were then incubated for 72 h at 37° C. in a humid atmosphere with 5% CO.sub.2.

(364) c. Cell Treatment with miPEPs

(365) After 24 h of incubation, the cells were treated with 10 μM of miPEP//15a-16-1-TAT or 100 μM of ScmiPEP21 diluted in PROLIF medium and then incubated at 37° C. for 1 h, 2 h, 3 h, 4 h and 6 h. In parallel, cells treated with PROLIF±water medium were used as a negative control.

(366) After treatment from 1 h to 6 h, the culture supernatants were removed and then the cell mats were washed twice with PBS, and then the plates were frozen at −80° C. until miRNA extraction.

(367) d. Total RNA Extraction

(368) The miRNAs were extracted according to the supplier's recommendations with the miRNeasy microkit kit (Qiagen).

(369) e. Reverse Transcription Reaction

(370) The RNAs were reverse transcribed with the High Capacity cDNA reverse transcription kit (Applied Biosystem). 400 ng of RNA were added to 2 μL of RT buffer (10×), 2 μL of Random primer (10×), 0.8 μL of dNTPs (25×), 0.5 μL of RNAse OUT (40 U/μL) and 1 μL of multiscribe reverse transcriptase (50 U/μL) in a total volume of 20 μL. The reverse transcription reaction was carried out at 25° C. for 10 min and then 42° C. for 2 h. The activity of the enzyme was stopped by incubating the mixture at 85° C. for 5 min.

(371) f. Quantification of miRNAs Precursors by Quantitative RT-PCR

(372) The amount of miRNAs precursors in cells treated or not treated with miPEP was evaluated by quantitative RT-PCR with the SsoFast EvagGreen kit. For the RT-PCR reaction, 3 μL of reverse transcriptase diluted 1/5 were added to 1× of SsoFast EvaGreen, 10 μM of each primer and RNase free water in a final volume of 10 μL. The reaction was subjected to the following temperatures: 3 min pre-amplification at 95° C., 40 cycles of 10 sec at 95° C. and 30 sec at 60° C. in a thermal cycler (CFX96 Real-time PCR detection system, Biorad). PPIA was used as a reference gene to normalize quantitative RT-PCR.

(373) For all PCR reactions, two replicates were used for each biological sample.

(374) TABLE-US-00020 TABLE 8  Sequences of the primers. Forward primer  Reverse primer  (5′-3′) (5′-3′) Reference PPIA TCT TTG GGA CCT  GCC GAG GAA AAC  gene TGT CTG CAA (SEQ CGT GTA CTA T ID NO: 11 759) (SEQ ID NO:  11 760) miRNA miR15a ATAAAAACCTTGGAGT GCACAATATGGCCTGC AAAGTAGCAG (SEQ ACC (SEQ ID NO:  ID NO: 11 769) 11 770) miR16 CAGCACGTAAATATTG TCAACCTTACTTCAGC GCGTTA (SEQ AGCAC (SEQ ID  ID NO: 11 771) NO: 11 772)

Example 4: miPEPs Immunolabeling

(375) The production of polyclonal antibodies specifically recognizing miPEP 125a, miPEP145 and miPEP15a-16-1 is made in mice or rabbits. The animals are treated by repeated injections of miPEP triggering the production of anti-miPEP antibodies.

(376) Mesenchymal stem cells from 6 different donors are cultured for 7 days either in proliferation medium (αMEM+10% FCS), or in differentiation medium (αMEM+2% FCS+β-Glycerophosphate+Ascorbic acid+BMP4). The presence of miPEP is then looked for in the cells by immunolabelings with the polyclonal antibodies anti-miPEP125a, anti-miPEP145 and anti-miPEP 15a-16-1. The cells are incubated for 1 h to 12 h with the primary antibodies. They are then washed 3 times with 0.1% PBS BSA and then treated by adding anti-species secondary antibodies (anti-mouse or anti-rabbit) conjugated to a fluorescent probe. The reading is done under an epifluorescence microscope.

Example 5: In Vivo Bone Formation by Subcutaneous Implantation in Nude Mice

(377) All experiments are done on animals in accordance with the directive 2010/63/EU and after validation of the protocols by the animal ethics committee (Toulouse). A total of 6-8 mice was used per group. The cultured cells are osteo-induced using miPEPs, and then suspended for 1 to 2 hours in the culture medium also containing biomaterial granules in the ratio of 2×10.sup.6 cells/50 mg of biomaterial. This biomaterial is biphasic inorganic calcium phosphate (BCP) composed of hydroxyapatite (HA) and beta-tricalcium phosphate (β-TCP) in a ratio of 20/80, ranging in size from 0.5 to 1 mm (sold by Biomatlante, Vigneux de Bretagne, France). The porosity of this biomaterial (% vol) was 75±5% of pores of which 70% from 0 to 10 μm, 20% from 10 to 100 μm and 10% from 100 to 300 μm. The biomaterial is sterilized by autoclaving.

(378) Female Nude mice (RjOrl: NMRI-Foxnnul/Foxnlnu) (Laboratoires Janvier, Saint-Berthevin, France) are generally anesthetized by inhalationn of isoflurane. The biomaterial alone is implanted as a negative control. Two implants (cells+biomaterials) are subcutaneously placed in the back of the mice on each side of the spine (a mouse may contain different types of implants). After 8 weeks, the treated animals are sacrificed. The implants are then removed and fixed in a buffered 4% formalin solution.

Example 6: Pulmonary Fibrosis

(379) miR-29 as Therapeutic Target

(380) The therapeutic benefit of increasing the level of miR-29 has been demonstrated for fibrosis in the heart, kidney, liver, lung and in a context of systemic sclerosis. The ability of a miR-29b analog to directly target the expression of Collagen1a1 (Col1a1), whose deregulation is implicated in the mechanism of fibrosis, has been demonstrated. Thus, an increasing amount of this analog results in a dose-dependent decrease in Col1a1 expression in a cell model (Montgomery et al., MicroRNA mimicry blocks pulmonary fibrosis, EMBO Mol. Med. (2014), 6(10); 1347-1356).

(381) Demonstration of the Therapeutic Effect of a miPEP Encoded by the Primary Transcript of miR-29

(382) NIH 3T3 cells (mouse fibroblast cell line) are cultured on DMEM medium, supplemented with 1-Glutamine (4 mM), Sodium Pyruvate (1 mM) and a 10% BCS of BCS solution. The cells are transfected with Dharmafect I according to the reseller's recommendations and then with increasing amounts of a miPEP encoded by the primary miR-29 transcript. The cells are collected 48 hours after transfection and Col1a1 expression is measured by qPCR.

Example 7: Lung Cancer (Non-Small Cell Lung Cancer)

(383) miR let-7 as a Therapeutic Target

(384) miR letR-7 is known to act as a tumor suppressor gene in a variety of human tissues, particularly in the lung, by downregulating the post-transcriptional expression of multiple oncogenes, including RAS, MYC and HMGA2, as well as other genes for cell cycle progression. Increasing amounts of miR let-7 in overexpressing KRAS mutant cells showed a dose-dependent reduction in kras expression (Esquela-Kerscher et al., The let-7 microRNA reduces tumor growth in mouse models of lung cancer, Cell Cycle (2008), 7(6), 759-764).

(385) Demonstration of the Therapeutic Effect of a miPEP Encoded by the Primary Transcript of miR let-7

(386) A549 cells (KRAS overexpressing mutant cell line) were cultured on DMEM medium (90%) supplemented with fetal calf serum (10%) and 1× penicillin/streptomycin solution, then transfected with increasing amount of miPEP encoded by the primary transcript of miR let-7. The next day, the cells are rinsed and incubated for 48 hours with a conventional culture medium. The proliferation tests are carried out with the AlamarBlue kit according to the distributor's recommendations.

Example 8: Ischemia—Reperfusion

(387) miR-7 as Therapeutic Target

(388) miR-7 is implicated in the deleterious effects of ischemia-reperfusion syndrome (I/R) and is overexpressed in simulated I/R cardiomyocites. In addition, miR-7 has been shown to protect myocardial cells against apoptosis by reducing the expression of poly(ADP-ribose) polymerase (PARP). An increase in miR-7 induces a dose-dependent reduction in PARP expression (Li et al., MicroRNA-7a/b Protects against Cardiac Myocyte Injury in Ischemia/Reperfusion by Targeting Poly(ADP-Ribose) Polymerase, PLoS One (2014), 9(3); e90096).

(389) Demonstration of the Therapeutic Effect of a miPEP Encoded by the Primary Transcript of miR-7

(390) H9c2 cells (rat ventricular cell line) are cultured at 37° C. under 5% CO.sub.2 on DMEM medium (90%) supplemented with fetal calf serum (10%) and 100 μg/mL penicillin/streptomycin solution. 48 hours after transfection of a miPEP encoded by the primary miR-7 transcript, the cells are subjected to a simulated I/R episode: the medium is replaced by glucose- and serum-deficient DMEM, and the cells are placed in a hypoxic chamber at 37° C. for 10 h and then reoxygenated for 2 h on DMEM medium containing 10% of fetal calf serum. Quantification of PARP expression is conducted in Western Blot with anti-PARP antibodies.

Example 9: Hepatitis C Virus Infection (HCV)

(391) miR-181c as Therapeutic Target

(392) The expression of Homeobox A1 (HOXA1) is increased in hepatocytes infected with HCV. Exogenous expression of a miR-181c analog inhibits HOXA1 and other cascading agents, including STATS and STATS, involved in the regulation of cell growth. The analog also suppresses HCV replication (Mukherjee et al., Transcriptional Suppression of miR-181c by Hepatitis C Virus Enhances Homeobox A1 Expression, J. Virol. (2014), 88(14); 7929-7940).

(393) Demonstration of the Therapeutic Effect of a miPEP Encoded by the Primary Transcript of miR-181c

(394) The human hepatoma cells (Huh7.5) are maintained on DMEM medium (90%) supplemented with fetal calf serum (10%) and antibiotics (100 U penicillin G/mL and 100 μg streptomycin/mL). HCV genotype 2a (clone JFH1) is grown in Huh7.5 cells. The supernatant is filtered on a cellulose acetate membrane. For infection, Huh7.5 cells are incubated with the viral solution for 72 h. The cells reflecting the presence of HCV genotype 2a are cultured on DMEM medium (90%) supplemented with fetal calf serum (10%) and 1% penicillin/streptomycin solution. All cells are maintained at 37° C. under 5% CO.sub.2 and transfected with increasing doses of a miPEP encoded by the primary miR-181c transcript. The quantification of HOXA1 is carried out by Western Blot using dedicated antibodies.

Example 10: Evaluation of the Effects of miPEP125a on In Vivo Bone Formation by Subcutaneous Implantation in Nude Mice

(395) 10.1—Methods

(396) All experiments on animals were done in accordance with directive 2010/63/EU and after validation of protocols by the Animal Ethics Committee (Toulouse, N: 86/809 EEC). A total of 6-8 mice was used per group. The cells cultured osteo-induced or not according to the methods described elsewhere (see Example 1), were then suspended for 1 to 2 h in the culture medium also containing granules of biomaterials in the ratio of 2×10.sup.6 cells/50 mg of biomaterial. These biomaterials were biphasic inorganic calcium phosphate (BCP), composed of hydroxyapatite (HA) and beta-tricalcium phosphate (β-TCP) in a ratio of 20/80, ranging in size from 0.5 to 1 mm (sold by Biomatlante, Vigneux de Bretagne, France). The porosity of these biomaterials (% vol) was 75±5% of pores of which 70% (0 to 10 μm), 20% (10 to 100 μm) and 10% (100 to 300 μm). They were sterilized by autoclaving.

(397) The biomaterial alone has been implanted as a negative control. Female Nude mice (RjOrl: NMRI-Foxnnul/Foxnlnu) (Laboratoires Janvier, Saint-Berthevin, France) are generally anesthetized by inhalationn of isoflurane. Two implants (cells+biomaterials) are subcutaneously placed in the back of the mice on each side of the spine. After 4 weeks, the treated animals are sacrificed. The implants are then removed and fixed in a buffered 4% formalin solution. Some groups of mice will also receive regular injections (once a week) during the study either of the miPEP//125a-1 (SEQ ID NO: 11 752) or the control miPEP (scramble ScmiPEP//125a, SEQ ID NO: 11 758).

(398) These implants were then decalcified in a solution of 4.13% EDTA/0.2% PFA in PBS for 96 hours at 50° C. using an automatic microwave for demineralization (KOS Histostation, Milestone Med. Corp. USA). The samples were dehydrated in ethanol and then butanol baths in an automatic dehydration apparatus (MicromMicrotech, Lyon, France). The samples were then immersed in paraphine (Histowax, Histolab, Gottenburg, Sweden). Fine sections (3 mm thick) were made using a microtome (Leica RM2255, Leica Biosystems, Nanterre, France). The sections were stained by the Masson trichrome technique and the collagen in light green.

(399) The photos were obtained by a scan of each cut (NanoZoomer, Hamamatsu, Photonics, Hamamatsu City, Shizuoka, Japan) and observed virtually (NDP view, Hamamatsu). The histomorphometry of the images was done using the ImageJ software and the neoformed bone percentage was calculated by explant area. 3 to 4 sections per explant were analyzed and quantified.

(400) 10.2—Materials Female Nude mice (RjOrl: NMRI-Foxnnul/Foxnlnu), from the approved supplier Janvier (Laboratoires Janvier, Saint-Berthevin, France), Biomaterials: Biphasic inorganic calcium phosphate (BCP), composed of hydroxyapatite (HA) and beta-tricalcium phosphate (β-TCP) in a ratio of 20/80, ranging in size from 0.5 to 1 mm (sold by Biomatlante, Vigneux de Bretagne, France), 1.5 mL Eppendorf tubes, Anesthesia table with Isoflurane, Syringes 19 G, An automatic microwave for demineralization (KOS Histostation, Milestone Med. Corp. USA), Demineralization solution of 4.13% EDTA/0.2% PFA in PBS, Ethanol, Butanol, Automatic dehydration device (MicromMicrotech, Lyon, France), Microtome (Leica RM2255, Leica Biosystems, Nanterre, France), Paraphine (Histowax, Histolab, Gottenburg, Sweden), NanoZoomer (Hamamatsu, Photonics, Hamamatsu City, Shizuoka, Japon), NDPview software (NDP view, Hamamatsu).

(401) 10.3—Results

(402) The images in FIG. 17 show that there is no bone formation in the biomaterial control alone (FIG. 17A). In contrast, the addition of MSCs to the biomaterial generated bone formation in all cases (FIG. 17B-F). However, qualitatively it appears that this bone formation is greater when the MSCs have been pre-treated with miPEP125a-1 (FIG. 17C-D) than with the scramble miPEP (FIG. 17E-F).

(403) Quantification of neoformed bone confirms this assessment (FIG. 17G). Indeed, there is significantly more bone formation when the MSCs were pre-treated with miPEP//125a in culture (C) than in the associated control (E: MSC pre-treated with the scramble miPEP, p=0.0499). This quantification also shows that the injection of the miPEP//125a-1 in vivo (D) is without consequence, or even decreases (in a non-significant manner) the induction effect compared to its control (C: MSCs only pre-treated). On the other hand, it is clear that the bone formation of MSCs only pre-treated in vitro (C) or MSCs pre-treated in vitro and then in vivo (D) is significantly higher than the untreated MSCs (B) (p=0.0241 and p=0.0203 respectively).

(404) The treatment of human MSCs with miPEP//125a-1 has therefore increased their ability to form bone in vivo when previously treated in vitro.

(405) The listing of sequences of the present invention is identical to that of the priority document, which corresponds to the French application No. FR16/63245 filed on Dec. 22, 2016.