SPECIFIC BIOMARKER SET FOR NON-INVASIVE DIAGNOSIS OF LIVER CANCER
20170168061 ยท 2017-06-15
Inventors
- Cornelia Wing Yin MAN (Hong Kong, HK)
- Norman Fung Man Wai (Vancouver, CA)
- Bing Lou Wong (Irvine, CA, US)
- Benjamin Chi Yin WAI (Burnaby, CA)
Cpc classification
G01N21/6428
PHYSICS
G01N33/564
PHYSICS
International classification
Abstract
Cells within liver tumour mass comprise a unique set of proteins/tumour antigens when compared to the normal liver tissues epithelial cells juxtaposed to the tumour. The presence of tumour antigens couples the production of auto-antibodies against these tumour antigens. The present invention relates to the identification and elucidation of a protein set that can act as a novel marker set for liver cancer diagnosis and prognosis. Specifically, it relates to a kit that enables diagnostic and prognostic measurement of auto-antibodies in serum of liver cancer patients. The present invention provides a non-invasive, specific, sensitive, and cost effective detection and quantification method by evaluating a set of validated liver cancer proteins/tumour antigens, which includes Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, LECT2, SOD1, STMN4, Midkine, IL-17A or IL26, to complement the conventional diagnostic methods.
Claims
1-9. (canceled)
10. A method for measuring the presence of hepatocellular carcinoma (HCC) biomarkers in a subject suspected of having HCC, the method comprising: a. obtaining a serum sample from the subject suspected of having HCC and measuring the serum for the presence of at least one primary biomarker auto-antibodies against a set of biomarkers, wherein the set of HCC biomarkers comprises Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, LECT2, SOD1, STMN4, Midkine, IL-17A and IL26; b. detecting the presence of at least one of the HCC biomarkers in the subject suspected of having HCC, the method comprising the steps of: i. mixing the serum sample with a set of biomarker conjugates to allow the primary biomarker auto antibodies, if present in the serum sample, to bind to the set of biomarker conjugates and washing away any unbound antibodies; wherein the set of biomarker conjugates comprises each of the biomarkers in the set of biomarkers conjugated via an amide bond to a unique fluorescent microsphere bead, wherein each unique fluorescent microsphere bead associated with a specific particular biomarker in the set of biomarkers has a different emission wavelength for each biomarker, wherein the biomarker conjugates are capable of being bound by a specific primary biomarker auto antibody present in the subject's serum sample, ii. adding to the mixture formed in step i. anti-human secondary antibodies conjugated with phycoerythrin (PE), which are capable of binding primary biomarker auto antibodies; and allowing the anti-human secondary antibodies conjugated with PE to bind to specific primary antibodies bound to biomarker conjugates to form a fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade, and washing away an unbound antibodies; and iii. measuring the mixture formed in step ii. for the presence fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade to determine whether the subject's serum contained at least one primary biomarker auto antibodies.
11. A method for measuring the presence of hepatocellular carcinoma (HCC) biomarkers in a plurality of subjects having HCC at different stages, the method comprising: a. obtaining a serum sample from a plurality of subjects having HCC at different stages and measuring the serum for the presence of at least one primary auto-antibodies (primary biomarker auto antibodies) against a set of biomarkers, wherein the set of biomarkers comprises Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, LECT2, SOD1, STMN4, Midkine, IL-17A and IL26; b. detecting the presence of the at least one of the HCC biomarkers in the plurality of subjects having HCC at different stages, the method comprising the steps of: i. mixing the serum sample with a set of biomarker conjugates to allow the primary biomarker auto antibodies, if present in the serum sample, to bind to the set of biomarker conjugates and washing away any unbound antibodies; wherein the set of biomarker conjugates comprises each of the biomarkers in the set of biomarkers conjugated via an amide bond to a unique fluorescent microsphere bead, wherein each unique fluorescent microsphere bead associated with a specific particular biomarker in the set of biomarkers has a different emission wavelength for each biomarker, wherein the biomarker conjugates are capable of being bound by a specific primary biomarker auto antibody present in the subject's serum sample, ii. adding to the mixture formed in step i. anti-human secondary antibodies conjugated with phycoerythrin (PE), which are capable of binding primary biomarker auto antibodies; and allowing the anti-human secondary antibodies conjugated with PE to bind to specific primary antibodies bound to biomarker conjugates to form a fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade, and washing away an unbound antibodies; and iii. measuring the mixture formed in step ii. for the presence fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade to determine whether the plurality of subjects' serum contained primary biomarker auto antibodies; and iii. measuring the mixture formed in step ii. for the presence fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade to determine whether the plurality of subjects' serum contained primary biomarker auto antibodies.
12. The method of claim 11, further comprising comparing the level of primary biomarker auto-antibodies measured in sera from the plurality of HCC patients who have different HCC cancer stages to generate a signature pattern of either the HCC biomarker expression levels or the primary biomarker auto-antibody levels in the patient's sera for each different stage of HCC cancer to generate a HCC biomarker or HCC primary biomarker auto-antibody profile for each stage of HCC cancer.
13. The method of claim 10 wherein the unique fluorescent signal from the microsphere beads serves to identify which biomarker in the set of biomarkers is present and wherein the signal from the PE indicates the presence of the biomarker conjugate.
14. The method of claim 10, wherein fluorescent intensity given by the PE-conjugated secondary antibodies in the fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade is measured to allow the detection and quantification of the primary biomarker auto antibodies.
15. The method of claim 10, wherein the set of biomarkers consists of Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, LECT2, SOD1, STMN4, Midkine, IL-17A and IL26.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011] Embodiments of the present invention are described in more detail hereinafter with reference to the drawings, in which:
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
DEFINITIONS
[0025] The term biomarker refers to the protein uniquely expressed or up-regulated in the tumor comparing to the normal epithelial cells.
[0026] The term biomarker set refers to the specific combination of the biomarkers identified from paired patients' biopsies (tumor biopsy versus juxtaposed normal tissue) and is the target of the measurement in the present invention.
[0027] The term auto-antibodies refers to the anti-bodies produced by the patient body coupling to the expression of the tumor biomarker and it is present in the circulation and can be collected in the peripheral serum.
[0028] Bmi1 (Polycomb Ring Finger) is a protein component of a Polycomb Group (PcG) multiprotein PRC1-like complex. It is responsible for maintaining the transcriptionally repressive state of many genes, including Hox genes, throughout development. The regulation is via monoubiquitination of histone H2A Lys-119, which modifies histone and remodels chromatin, rendering the expression.
[0029] VCC1 or CXCL17 (Chemokine (C-X-C Motif) Ligand 17) has an essential role in angiogenesis and possibly in the development of tumors. It is also suggested that it is a housekeeping chemokine regulating the recruitment of non-activated blood monocytes and immature dendritic cells into tissues. It may also play a role in the innate defense against infections. Malfunction of VCC1 is associated with duodenitis and cholera.
[0030] SUMO-4 (Small Ubiquitin-Like Modifier 4) belongs to the family of small ubiquitin-related modifiers and located in the cytoplasm. It covalently attaches to the target protein, IKBA, in order to control its subcellular localization, stability, or activity. This eventually leads to a negative regulation of NF-kappa-B-dependent transcription of the IL12B gene.
[0031] RhoA (Ras Homolog Family Member A) regulates the signaling pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It also involves in microtubule-dependent signaling essential during cell cycle cytokinesis, and other signaling pathways involved in stabilization of microtubules and cell migrations and adhesion.
[0032] TXN (Thioredoxin) forms homodimer and is involved in redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. It has been reported to be associated with breast mucinous carcinoma.
[0033] ET-1 (Endothelin 1) is a potent vasoconstrictor produced by vascular endothelial cells. It binds to endothelin receptors widely expressed in all tissues, including non-vascular structure like epithelial cells, glia, and neurons. Apart from the main role in maintenance of vascular tone, it is also suggested to have co-mitogenic activity and potentiate the effects of other growth factors.
[0034] UBE2C (Ubiquitin-Conjugating Enzyme E2C) belongs to the family of E2 ubiquitin-conjugating enzyme. This is one of the three enzymes involved in ubiquitination, which is an important cellular mechanism for targeting abnormal proteins for degradation. More specifically, UBE2C is required for the targeted degradation of mitotic cyclins and for cell cycle progression. Thus, it is believed that this protein may be also involved in cancer progression.
[0035] HDGF2 is called hepatoma-derived growth factor 2. This protein which is highly expressed in a variety of tumors has been reported to play a pivotal role in the development and progression of several tumors. Although the mechanism is yet to be identified, it is suggested that HDGF2 has mitogenic, angiogenic, neurotrophic and antiapoptotic activity.
[0036] FGF21 (Fibroblast Growth Factor 21) is a family member of the FGF family which is involved in vary biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. More specifically, FGF21 stimulates glucose update in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression. It has been found that FGF21 is associated with fatty liver disease.
[0037] LECT2 (Leukocyte Cell Derived Chemotaxin 1) is a secretory protein acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein is associated with acute liver failure.
[0038] SOD1 (Superoxide Dismutase 1) is a Cu/Zn-containing antioxidant enzyme responsible for destroying free superoxide radicals into molecular oxygen and hydrogen peroxide in the cytosol, the nucleus, and the intermembrane space of the mitochondria. It is important for maintaining low levels of superoxide in the cytosol, thus protecting the cell from oxidative stress and subsequent cell death.
[0039] STMN4 (Stathmin-Like 4) is a small regulatory protein which is believed to have a role in relaying integrating diverse intracellular signaling pathways, which in turn, controls cell proliferation, differentiation and functions. It is also shown that this protein contributes to the control of microtubule dynamics by inhibiting the polymerization of microtubules and/or favoring their depolymerization.
[0040] Midkine or NEGF2 (Neurite Growth-Promoting Factor 2) is a secretory growth factor that binds heparin and responsive to retinoic acid. Midkine promotes cell growth, migration and angiogenesis, in particular during tumorigenesis. It has already been demonstrated to be associated with breast adenocarcinoma and soft tissue sarcoma.
[0041] IL-17A (Interleukin 17A) is a proinflammatory cytokine produced by the activated T cells. It regulates the activity of NF-kappaB and mitogen-activated protein kinases, stimulates the expression of IL6 and cyclooxygenase-2, and enhances the production of nitric oxide. Several chronic inflammation and sclerosis are usually associated with IL-17A elevation.
[0042] IL-26 (Interleukin 26) belongs to the IL-10 cytokine family and is produced by the activated T cells and targets epithelial cells for signal transduction. It binds strongly to glycosaminoglycans such as heparin, heparan sulphate, and dermatan sulfate on cellular surfaces which act similarly to coreceptors in order to enrich IL-26 on the surface of producer and target cells.
DETAILED DESCRIPTION OF INVENTION
[0043] In the following description, the biomarker/biomarkers, the corresponding embodiments of the detection/validation/identification/quantification methods are set forth as preferred examples. It will be apparent to those skilled in the art that modifications, including additions and/or substitutions, may be made without departing from the scope and spirit of the invention. Specific details may be omitted so as not to obscure the invention; however, the disclosure is written to enable one skilled in the art to practice the teachings herein without undue experimentation.
[0044] In the present invention, the set of liver tumor biomarkers for detection and quantification of liver cancer is first identified by two-dimensional/mass spectrometry resolving the difference in the pattern of proteins expression between the paired patients' biopsies (tumor biopsy versus juxtaposed normal tissue) (
[0045] Based on the amino acid sequences of the targeted biomarkers, commercially synthesized cDNA clones are employed for the expression of the biomarker set (
[0046] To prove the significance of the biomarkers in the present invention, the cDNA clones are confirmed by restriction enzyme cut (
[0047] Sensitivity of the test is measured by spiking in a serial dilution of the antibodies. The lowest concentration of the antibody added that can give signal suggests the sensitivity of that particular biomarker. Meanwhile a standard curve is constructed showing the fluorescence intensity of the PE against the serial dilutions of the antibodies (
[0048] In the present invention, a multiplex of 15 different Bioplex beads individually giving unique fluorescence are conjugated with the biomarker set and preloaded in the wells of a plate (
[0049] In a standard randomized trial design, the mean of the relative level of auto-antibodies between the healthy group and patients diagnosed with liver cancer is compared. Student T test is used to analyze the variation significance. The significant difference indicates that the biomarker is specific for liver cancer. After the verification trials, ranges of the concentration of biomarker specific auto-antibodies will be obtained for the liver cancer positive and negative patients and serve as reference point for the future diagnosis. Meanwhile, expression pattern of the auto-antibodies is also compared between liver cancer patients of different stages. The signature patterns of the biomarker expressions will indicate the HCC staging.
[0050] Taken together, the measurement of the relative auto-antibodies level and the expression pattern of the biomarkers, the present invention represents a different avenue to complement conventional liver cancer diagnosis. The present invention further enables non-invasive detection of auto-antibodies against the validated targets in patients' sera of the present invention, identifying the extent and the characteristics of the disease. Apart from early detection for stage I liver cancers, the present invention also enables the generation of signature patterns for staging, and the detection of recurrences during a monitoring period of post-mastectomy or post-chemotherapeutic treatment.
EXAMPLES
[0051] The following examples are provided by way of describing specific embodiments of this invention without intending to limit the scope of this invention in any way.
Example 1a
Protein extraction From Patients' Biopsies
[0052] 500 mg of the paired patients' biopsies (tumor biopsy versus juxtaposed normal tissue) are collected and washed with PBS. The tissues are frozen by submerging into liquid nitrogen and immediately homogenized with pestle and mortar. To the homogenized samples, lysis solution (8M Urea, 4% CHAPS, 2% IPG Buffer, 0.2mg/m1 PMSF) is added, then vortex for at least 5 min until the tissues are completely dispersed. The lysates are then clarified by centrifugation at 14,000 rpm for 10 minutes at 4 C. The supernatants are further cleaned up by 2D Clean Up kit (Amersham) to remove the salt and impurities. The pellets are resuspended with minimum volume of Rehydration Solution (No DTT & IPG Buffer added). The protein concentrations are then measured by Bio-Rad protein assay and aliquots of 200 g/per tube are stored at 70 C.
Example 1b
Resolving Proteins by Two-Dimensional Electrophoresis
[0053] To 1 ml rehydration stock solution, 2.8 mg DTT, 5 1 pharmalyte or IPG Buffer, and 2 1 bromophenol blue are added. 50-100 g of protein sample is added to the 13 cm Immobiline DryStrip (IPG strip) containing 250 1 of rehydration solution. After removing the protective cover, the IPG strip is positioned in the strip holder with the gel side facing down, and overlaid with Cover Fluid to prevent dehydration during electrophoresis. The strip is then placed on to Ettan IPGphor (Amersham) for isoelectric focusing (first dimensional electrophoresis).
[0054] After the first-dimensional electrophoresis, the IPG strip is equilibrated with equilibrate solution (6 M Urea 2% SDS, 50 mM Tris HCl pH 6.8, 30% Glycerol, 0.002% Bromophenol blue, 100 mg DTT per 10 ml buffer and 250 mg IAA per 10 ml buffer), and then washed with lx SDS running Buffer for 4-5 times. The IPG strip is placed on top of the second-dimension gel and overlaid with sealing solution (0.5% Low Melting agarose, 0.002% Bromophenol Blue in 1SDS running Buffer). The second-dimensional electrophoresis is then carried out at 30 mA for first 15 min followed by 60 mA for 3-4 h.
[0055] Upon the completion of the second dimensional electrophoresis, the gel is removed from the cassette, fixed and stained with silver nitrate. 15 spots representing 15 up-regulated proteins are identified (
Example 2a (SEQ ID NO.1)
Amino Acid Sequence of Bmi1
[0056]
TABLE-US-00001 MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETS KYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAA HPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKD KEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE SDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP SGNHQSSFANRPRKSSVNGSSATSSG
Example 2b (SEQ ID NO.2)
Amino Acid Sequence of VCC1
[0057]
TABLE-US-00002 MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQEC ECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHS RACQQFLKQCQLRSFALPL
Example 2c (SEQ ID NO.3)
Amino Acid Sequence of SUMO-4
[0058]
TABLE-US-00003 MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEP RGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Example 2d (SEQ ID NO.4)
Amino Acid Sequence of RhoA
[0059]
TABLE-US-00004 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Example 2e (SEQ ID NO.5)
Amino Acid Sequence of TXN
[0060]
TABLE-US-00005 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYS NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT INELV
Example 2f (SEQ ID NO.6)
Amino Acid Sequence of ET-1
[0061]
TABLE-US-00006 MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRS KRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPT KATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSK LGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPS RERYVTHNRAHW
Example 2g (SEQ ID NO.7)
Amino Acid Sequence of UBE2C
[0062]
TABLE-US-00007 MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGI SAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT HAAELWKNPTAFKKYLQETYSKQVTSQEP
Example 2h (SEQ ID NO.8)
Amino Acid Sequence of HDGF2
[0063]
TABLE-US-00008 MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFG THETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQ AIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSY TSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTS EGT
Example 2i (SEQ ID NO.9)
Amino Acid Sequence of FGF21
[0064]
TABLE-US-00009 MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLY TDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSR FLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNK SPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPS QGRSPSYAS
Example 2j (SEQ ID NO.10)
Amino Acid Sequence of LECT2
[0065]
TABLE-US-00010 MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQ RPHQGVDVLCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCV KMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY L
Example 2k (SEQ ID NO.11)
Amino Acid Sequence of SOD1
[0066]
TABLE-US-00011 MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE FGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSI EDVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIG IAQ
Example 21 (SEQ ID NO.12)
Amino Acid Sequence of STMN4
[0067]
TABLE-US-00012 MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDM EVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEA AEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKME SNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEEASR
Example 2m (SEQ ID NO.13)
Amino Acid Sequence of Midkine
[0068]
TABLE-US-00013 MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSK DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGT KVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Example 2n (SEQ ID NO.14)
Amino Acid Sequence of IL-17A
[0069]
TABLE-US-00014 MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN IHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCI NADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPI VHHVA
Example 2o (SEQ ID NO.15)
Amino Acid Sequence of IL-26
[0070]
TABLE-US-00015 MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAA WLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQ GCKKIRFVEDFHSLRQKLSHCISCASSAREMKSITRMKRIFYRIGNKGIY KAISELDILLSWIKKLLESSQ
Example 3a
Expression of Biomarker Set
[0071] His tagged plasmids containing cDNA inserts encoding the biomarker set is transformed into DH5 competent cells (301,
[0072] Bacterial cultures with and without IPTG induction are mixed together in a 500 ml centrifuge bottle. Bacterial cells are collected by centrifugation at 9000 rpm for 20 min at 4 C. (304). 500 1 of supernatant is saved as another negative control and the remaining supernatant is discarded. The bacterial cultures and negative controls collected in different points are run on a SDS-PAGE to resolve the protein (305). The gel is then stained with Coomassie Blue overnight. After destaining the gel, the protein induction can be confirmed by checking the size and comparing with the negative controls.
Example 3b
Protein Purification for Biomarker Set
[0073] The bacterial cell pellets are resuspended in 10 ml solubilization buffer by vortex at room temperature. Keeping the resuspended cells in 50 ml centrifuge tube on ice, the cells are completely lysed by sonication at amplitude 70% 10 rounds of 30 s with interval of 30 s (401,
Example 4a
Protein Coupling with Bio-Plea Beads
[0074] The purified proteins of the biomarker set are coupled with Bio-Plex beads (Bio-Rad) (501) according to the manufacturer's manual. In brief, uncoupled bead is vortexed for 30 s and then sonicated for 15 s. 1,250,000 beads are collected in a reaction tube by centrifugation of 100 l bead at maximum speed for 4 min. After washing with 100 l bead wash buffer by centrifugation, the beads are resuspended in 80 l bead activation buffer. To the beads 10 l 50 mg/ml freshly prepared S-NHS and 10 l 50 mg/ml freshly prepared EDAC are added, followed by 20 min incubation in dark at room temperature (
[0075] To the washed beads, 10 gg proteins are added and the total volume is topped up with PBS to 500 l, and allowed to incubate for 2 h with shaking in dark. Supernatant is removed after centrifugation at maximum speed for 4 min. 250 l blocking buffer is added to the beads and shook in dark for 30 min, followed by centrifugation at maximum speed for 4 min and removal of supernatant. The beads are briefly washed and then resuspended in the storage buffer for storage at 4 C. The numbers of the beads are counted with a hemocytometer.
Example 4b
Validation of Protein-Bead Coupling
[0076] To a HTS 96 well plate, 50 1 of conjugated Bio-Plex beads (100 beads/1) is added to react with primary followed by secondary antibodies (502). A serial dilution of the commercially available primary anti-bodies against the biomarker set is prepared as 8,000, 4,000, 1,000, 250, 62.5, 15.625, 3.906, 0.977, 0.244 and 0.061 ng/ml. 50 1 of each dilution is added to each well. Two negative controls are performed by excluding the primary antibodies, and both primary and secondary antibodies in the wells. The plate is then sealed with a foil and kept on a shaker for 30 min at 350 rpm, avoiding exposure to light.
[0077] After incubation, the beads are washed three times with 150 1 PBS. 50 1 of PE-conjugated secondary antibody (8,000 ng/ml) is added into each well except negative controls. The plate is sealed again and incubated in dark for 30 min with shaking. Excess antibodies are then washed away by PBS. The Bio-Plex machine is calibrated with the calibration kit and validation kit. After the HTS plate is loaded to the machine, signals from both the Bio-Plex beads and the PE conjugated at the secondary antibodies (503) are measured (schematic diagram is shown in
Example 4c
Collection of Serum Samples and Measurement of Auto-Antibodies by BioPlex System
[0078] Whole-blood samples are clotted by standing at 37 C. for 1 h. Sera containing the auto-antibodies is collected at the supernatant after centrifugation at 1000 g room temperature for 10 min. The serum samples are diluted with PBS when necessary. To a HTS plate preloaded with Bioplex beads conjugated with biomarker set, the serum samples are loaded and incubated for 30 min with shaking (
[0079] The foregoing description of the present invention has been provided for the purposes of illustration and description. It is not intended to be exhaustive or to limit the invention to the precise forms disclosed. Many modifications and variations will be apparent to the practitioner skilled in the art.
[0080] The embodiments are chosen and described in order to best explain the principles of the invention and its practical application, thereby enabling others skilled in the art to understand the invention for various embodiments and with various modifications that are suited to the particular use contemplated. It is intended that the scope of the invention be defined by the following claims and their equivalence.
INDUSTRIAL APPLICABILITY
[0081] The presently claimed method and kit comprising the 15 identified biomarkers can not only be used to identify and quantify the presence of auto-antibodies in the patents' sera in order to detect and/or stage the liver cancer, but are also useful in drug development targeting these markers for specifically treating the liver cancer.