Analyte sensors, methods for preparing and using such sensors, and methods of detecting analyte activity

09599617 ยท 2017-03-21

Assignee

Inventors

Cpc classification

International classification

Abstract

Analyte sensors, methods for producing and using analyte sensors, methods of detecting and/or measuring analyte activity, detecting pH change, and/or, controlling the concentration of an analyte in a system, are disclosed. Embodiments of the analyte sensors according to the disclosure can provide an accurate and convenient method for characterizing analyte activity, detecting pH change, controlling the concentration of an analyte in a system, and the like, in both in vivo and in vitro environments, in particular in living cell imaging.

Claims

1. An analyte sensor comprising an engineered fluorescent protein having at least 90% similarity to the sequence SEQ ID NO: 104 and having a metal ion binding site comprising at least two of the negatively charged residues E147, D202, E204, E223, and E225, as numbered according to the sequence SEQ ID NO: 104, wherein the negatively charged residues comprise a plurality of carboxyl oxygens orientated in a pentagonal bipyrimdal geometry, wherein said geometry provides a metallic ion binding site operatively interacting with a chromophore region of the engineered fluorescent host polypeptide, such that binding of a metal ion analyte to the molecular recognition motif modulates the emission of a fluorescent signal emitted by the fluorescent host polypeptide, and optionally, the absorbance spectrum of the engineered fluorescent host polypeptide.

2. The analyte sensor of claim 1, wherein the amino acid sequence of the analyte sensor has at least 90% similarity to a sequence selected from the group consisting of SEQ ID Nos.: 105 and 113-139.

3. The analyte sensor of claim 2, wherein the amino acid sequence of the analyte sensor has at least 95% similarity to a sequence selected from the group consisting of SEQ ID Nos.: 104-105 and 113-139.

4. The analyte sensor of claim 3, wherein the amino acid sequence of the analyte sensor is according to a sequence selected from the group consisting of SEQ ID Nos.: 104-105 and 113-139.

5. The analyte sensor of claim 1, wherein the amino acid sequence of the analyte sensor has at least 90% similarity to SEQ ID No.: 105.

6. The analyte sensor of claim 2, wherein the amino acid sequence of the analyte sensor has at least 95% similarity to a sequence selected from the group consisting of SEQ ID No.: 105.

7. The analyte sensor of claim 1, wherein the amino acid sequence of the analyte sensor is according to SEQ ID No.: 105.

8. The analyte sensor of claim 1, wherein the analyte sensor binds to a metal ion selected from the group consisting of: calcium, lead, gadolinium, lanthanum, terbium, antimony, strontium, mercury, and cadmium.

9. The analyte sensor of claim 1, wherein the analyte sensor binds to a metal ion selected from the group consisting of: calcium.

10. The analyte sensor of claim 1, further comprising a targeting motif for selectively targeting the endoplasmic reticulum of a cell.

11. The analyte sensor of claim 1, wherein the analyte sensor in the presence of an analyte bound thereto emits a fluorescent signal, the fluorescent signal indicating binding of the analyte to the analyte sensor.

12. The analyte sensor of claim 1, wherein the analyte sensor in the absence of an analyte emits a first fluorescent signal and in the presence of an analyte bound to the analyte sensor emits a second fluorescent signal, wherein the first and the second fluorescent signals are distinguishably detectable.

13. The analyte sensor of claim 1, wherein the sensor is solubilized.

14. The analyte sensor of claim 1, wherein the sensor is attached to a solid surface.

15. The analyte sensor of claim 1, wherein the negatively charged residues are on the surface of three anti-parallel beta-sheets.

16. The analyte sensor of claim 1, wherein the negatively charged residues are spread on three strands of the protein with beta-can structure.

17. A composition comprising an analyte sensor according to claim 1, wherein the composition is formulated for the detection of an analyte in a test sample.

18. The composition of claim 17, further comprising a pharmaceutically acceptable carrier.

19. A kit comprising an analyte sensor according to any of claim 1 and packaging, wherein the packing comprises instructions for the use of the analyte sensor for the detection of an analyte by the analyte sensor.

20. A method of detecting an analyte, comprising: (i) providing an analyte sensor according to claim 1; (ii) providing a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iii) detecting a first fluorescent signal emitted by the analyte sensor in the absence of a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iv) contacting the analyte sensor with the test sample; (v) detecting a second fluorescent signal emitted by the analyte sensor in contact with the test sample; and (vi) comparing the first fluorescent signal and the second fluorescent signal, wherein a ratiometric change in the signal indicates an analyte in the test sample is interacting with the analyte sensor.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) Further aspects of the present disclosure will be more readily appreciated upon review of the detailed description of its various embodiments, described below, when taken in conjunction with the accompanying drawings.

(2) FIGS. 1A and 1B illustrate a model structure of EGFP-based Ca.sup.2+ sensors based on 1ema.pdb. All Ca.sup.2+ sensors were composed of a Ca.sup.2+ binding motif integrated into an enhanced green fluorescent protein (EGFP).

(3) FIG. 1A illustrates the domain structures of various GFP variants. CRsig: the calreticulin signal peptide MLLSVPLLLGLLGLAAAD (SEQ ID No.: 112); KDEL: ER retention signal; kz: Kozak consensus sequence for optimal translational initiation in mammalian cells. Constructs Ca-G1 and Ca-G2 contain the flanking sequences. Ca-G1, Ca-G2 and Ca-G3 do not contain flanking sequences.

(4) FIG. 1B schematically illustrates the topology of Glu172-Asp173 (position 1), Gln157-Lys158 (position 2), and Asn144-Tyr145 (position 3) in EGFP.

(5) FIG. 2A illustrates the visible absorbances of EGFP-wt and variants thereof. Protein concentrations were 20 M.

(6) FIG. 2B illustrates the fluorescence spectra of EGFP-wt and variants thereof. Protein concentrations were 10 M; slit width of 1 nm for both excitation and emission. .sub.ex=398 nm.

(7) FIGS. 3A-3D illustrate the spectroscopic characterizations of the Ca.sup.2+ sensor Ca-G1-37.

(8) FIG. 3A illustrates the visible absorption spectra for sensor Ca-G1-37 at 17 M at various Ca.sup.2+ concentrations. Arrows indicate the direction of signal change resulting from an increase in the Ca.sup.2+ concentration.

(9) FIG. 3B illustrates the Ca.sup.2+ dependence of fluorescence emission spectra with excitation of .sub.ex=398 nm at 1.7 M at various Ca.sup.2+ concentrations. Slit width of excitation and emission was 1 and 2 nm, respectively. Arrows indicate the direction of signal change resulting from an increase in the Ca.sup.2+ concentration.

(10) FIG. 3C illustrates the Ca.sup.2+ dependence of fluorescence emission spectra with excitation of .sub.ex=490 nm at 1.7 M at various Ca.sup.2+ concentrations. Slit width of excitation and emission was 1 and 2 nm, respectively. Arrows indicate the direction of signal change resulting from an increase in the Ca.sup.2+ concentration.

(11) FIG. 3D is a graph showing normalized F.sub.(398nm)/F.sub.(490nm) ratio curve-fitting of Ca.sup.2+ titration data.

(12) FIG. 4A illustrates Ca.sup.2+ responses of Ca-G1-37 in the presence of: Cu.sup.2+ (0.1 M), Zn.sup.2+ (0.1 mM), Mg.sup.2+ (10.0 mM), Tb.sup.3+ (5.0 M) and La.sup.3+ (5.0 M). The ratio of fluorescence emission of Ca-G1-37 with 398 nm and 490 nm excitation in the presence of 1.0 mM Ca.sup.2+ was used to normalize the values using Eq. (5).

(13) FIG. 4B illustrates Ca.sup.2+ responses of Ca-G1-37 in the presence of: the intracellular molecules: ATP (0.2 mM), ADP (0.2 mM), GTP (0.1 mM), GDP (0.1 mM), and GSH (1.0 mM). The ratio of fluorescence emission of Ca-G1-37 with 398 nm and 490 nm excitation in the presence of 1.0 mM Ca.sup.2+ was used to normalize the values using Eq. (5).

(14) FIGS. 5A-5D illustrate a kinetic analysis of Ca.sup.2+ association to Ca-G1. FIG. 5A: Stopped-flow traces of fluorescence increase (.sub.ex=398 nm) upon rapid mixing of Ca-G1 (final concentration of 20 M) and Ca.sup.2+ at concentrations indicated. FIG. 5B: Observed rates of fluorescence increases as a function of Ca.sup.2+ concentration. FIG. 5C: Maximal changes in the amplitude of the fluorescence intensities observed in FIG. 5A as a function of Ca.sup.2+ concentration. FIG. 5D: Stopped-flow trace of fluorescence decrease (.sub.ex=398 nm) upon rapid mixing of 40 M Ca-G1 preloaded with 0.8 mM Ca.sup.2+. A 455 nm long pass filter was used to collect the emission with a main peak at 510 nm. Data were fit to Eq. 6 (FIGS. 5A and 5D), Eq. 8 (FIG. 5B) and Eq. 2 (FIG. 5C), respectively.

(15) FIGS. 6A-6D is a series of digital images illustrating the localization of sensor Ca-G1-ER in HeLa and BHK-21 cells. FIG. 6A: Localization of Ca-G1-ER; FIG. 6B: Localization of DsRed2-ER; FIG. 6C: overlay of Ca-G1-ER and DsRed2-ER in HeLa cells; FIG. 6D: Localization of Ca-G1-ER in BHK-21 cell. Confocal images of Ca-G1-ER and DsRed2-ER localization were with an argon laser 488 nm line for the green channel, and a HeNe laser 543 nm line for the red channel. The scale bar indicates 10 m.

(16) FIGS. 6E and 6F illustrate the calcium response of the sensor Ca-G1-ER in BHK-21 cells. FIG. 6E: Time course of Ca.sup.2+ responses in response to different treatments. FIG. 6F: pseudo calibration of Ca.sup.2+ concentrations in the ER. The time course expressed as the fluorescence emission ratio at 510 nm for excitation at 385 and 480 nm. The left-hand ordinate represents the 510 nm fluorescence emission ratio (excitation 385 and 480 nm) in both FIGS. 6E and 6F; right-hand ordinate represents the calibrated Ca.sup.2+ concentration in the ER in FIG. 6F.

(17) FIG. 7 illustrates CD spectra of EGFP-wt and variants thereof in 10 mM Tris and 1 mM DTT (pH 7.4). The protein concentrations were 10 M for CD experiments.

(18) FIG. 8A illustrates visible absorbance spectra of Ca-G1 at various pHs. Measurements were performed in 1 mM DTT and 10 mM MES (pH 5.0, 5.5, 6.0), 10 mM PIPES (pH 6.5, 7.0), and 10 mM Tris (pH 7.4, 8.0, 9.0).

(19) FIG. 8B illustrates the curve fitting of Ca-G1 at various pHs.

(20) FIG. 9A illustrates a model structure of calcium binding fluorescent protein with the addition of the EGFP.D2 (site 1) by computational design or EGFP-G1 (172EF) by inserting the EF-hand motif III from calmodulin into position 172-173. Residues involved in the formation of the chromophore are highlighted. The structure of EGFP around the chromophore based on 1EMA.pdb.

(21) FIG. 9B illustrates a model structure of modified grafting EGFP sensor. One EF-hand was inserted in the fluorescent sensitive location of EGFP, generating EGFP-G1. A site-directed mutagenesis on the beta-sheet surface introducing a negatively charged residue to form a Ca.sup.2+ binding site with three existed negatively charged residues.

(22) FIG. 10 is a graph illustrating expression of EGFP and variants thereof in E. coli BL21-DE3 22 hrs after 200 mM IPTG induction and at 30 C. (open bars) and 37 C. (closed bars), respectively. ex=488 nm.

(23) FIG. 11 is a series of digital images illustrating fluorescence microscope imaging of HeLa cells. The imaging was performed two days (48 hrs) after HeLa cells were transfected with EGFP-G1, EGFP-G1-C2, and EGFP-G1-C3. The exposure time was 200 ms.

(24) FIG. 12A is a graph illustrating EGFP-D2 series expression in HeLa cells at 30 C. and 37 C., respectively. Fluorescence intensity at 510 nm of different cell pellets was obtained for 2 days after transfection of the proteins. .sub.ex=488 nm.

(25) FIG. 12B is a graph illustrating EGFP-G1 series expression in HeLa cells at 30 C. and 37 C., respectively. Fluorescence intensity at 510 nm of different cell pellets was obtained for 2 days after transfection of the proteins. .sub.ex=488 nm.

(26) FIG. 13A illustrates the visible absorbance spectra of EGFP, EF-172, and Site 1. The protein concentrations were 2 mM.

(27) FIG. 13B illustrates the fluorescence spectra of EGFP, EF-172, and Site 1. The protein concentrations were 2 mM. Slit width of 1 nm for both excitation and emission; .sub.ex=488 nm.

(28) FIG. 14 schematically illustrates a calcium-binding protein based on GFP (pdb 1b9c). The binding geometry of GFP.D1 is shown in ball-and-stick. D2 is shown as a circle. The locations of GFP.D3 with the wild type residues are also indicted.

(29) FIG. 15A is a graph illustrating the absorbance spectra of EGFP, GFP.D1, GFP.D2, GFP.D2 and GFP.D2 expressed in E. coli, indicate that the chromophore of GFP.D1 did not form.

(30) FIG. 15B illustrates the far UV CD spectra of EGFP, GFP.D1, GFP.D2, GFP.D2 and GFP.D2 indicating the formation of n-sheet secondary structures with a negative maximum at 216 nm.

(31) FIG. 16 is a series of digital images illustrating the inverted epifluorescence image of HeLa cells expressing: (a) wild-type EGFP; (b) GFP.D1; and (c) GFP.D2.

(32) FIG. 17A illustrates the calcium-induced chromophore emission change for GFP.D2 expressed in E. coli with excitation at 482 nm. The fit of the data using the 1:1 binding equation (Eq. 2.3) gives a K.sub.d of 107 M.

(33) FIG. 17B illustrates the rhodamine-5N competition with GFP.D2 for calcium binding fluorescence emission with excitation at 552 nm. The inset shows the spectra of the Rhodamine-5N with the concentration change of Ca.sup.2+.

(34) FIG. 17C illustrates the fluorescence change of 3 M GFP.D1 in 20 mM PIPES, 10 mM KCl, 1 mM DTT, 1% glycerol, pH 6.8 at increasing terbium concentrations assuming a 1:1 binding. The inset shows the spectra peaks increase at 545 nm.

(35) FIG. 17D illustrates the metal competition of GFP.D1.

(36) FIG. 18 illustrates competitive titration of Pb.sup.2+ and Ca.sup.2+-loaded EGFP variants C2 and C4.

(37) FIG. 19A illustrates titration of excess Pb.sup.2+ with Ca.sup.2+-loaded EGFP variant C2. Signal intensity decreases as Pb displaces Ca.

(38) FIG. 19B illustrates the curve-fitting of C2-Pb complex to quantify K.sub.d. The K.sub.d for C2-Pb.sup.2+ was 2 M, and Ca.sup.2+ was 440 M.

(39) FIG. 19C illustrates curve fitting of EGFP/Pb.sup.2+ complex to quantify K.sub.d. The K.sub.d was 3.5 M.

(40) FIG. 19D illustrates curve-fitting of C2-Gd complex to quantify K.sub.d. The K.sub.d for Gd.sup.3+ was 2.0 M.

(41) FIGS. 20A-20L illustrate the structure and in vitro optical properties of Ca.sup.2+ biosensor variants.

(42) FIG. 20A schematically illustrates a truncated structure (left image) of the wild-type EGFP (1EMA) with the chromophore (CRO) shown as spheres. Residues 147, 202, 204, 223, and 225 sidechain protruding from the surface in close proximity to the chromophore were mutated to form the Ca.sup.2+ binding ligands. Key residues H147, T203, and E222, involved in proton interaction with the chromophore are located near the designed Ca.sup.2+ binding site.

(43) FIG. 20B illustrates the spatial distribution of the five residues that are responsible for Ca.sup.2+ chelation.

(44) FIG. 20C illustrates the spatial organization of the five residues indicated in FIG. 20B and their relationship with the chromophore in the EGFP molecule, which shows nonacidic residues.

(45) FIGS. 20D-20H, respectively illustrate constructs D8, D9, D10, CatchER, and D12 and show replacement at residues S147, S202, Q204, F223, and T225, respectively.

(46) FIG. 20I illustrates the absorbance spectra of wild-type EGFP and the Ca.sup.2+ sensors D8 to D12, with a normalized absorbance peak at 280 nm. The Ca.sup.2+ sensors D8 to D12 exhibited a major absorbance peak at 398 nm and a lower peak at 490 nm.

(47) FIG. 20J illustrates the absorbance intensity ratio at 395 nm and 488 nm for the Ca.sup.2+ sensors D8 to D12 and wild-type EGFP. The ratio increased with the number of negatively charged residues introduced.

(48) FIG. 20K illustrates the change in fluorescence intensity of EGFP variants in response to Ca.sup.2+ recorded at 510 nm emission and 488/395 nm excitation with either 10 M EGTA (black/grey bars) or 5 mM Ca.sup.2+ (red/blue bars). EGFP emission maxima at 510 nm, excited at 488 nm, in the presence of 10 M EGTA were normalized to 1.0.

(49) FIG. 20L illustrates the correlation between the number of negatively charged residues and apparent Ca.sup.2+ dissociation constants (K.sub.d) for D9, D10, and CatchER, measured by fluorescence titration in the presence (square) and absence (circle) of 100 mM KCl.

(50) FIGS. 21A-21E illustrate the optical characterizations of CatchER in vitro.

(51) FIG. 21A shows emission spectra in response to increased Ca.sup.2+ concentrations.

(52) FIG. 21B shows the CatchER apparent K.sub.d determined by fluorescence response in the presence or absence of 100 mM KCl, or by a main chain chemical shift change of residue Y143 in heteronuclear single quantum coherence (HSQC) spectra in the presence of 10 mM KCl (black). Titration results were fitted to a 1:1 binding mode.

(53) FIG. 21C shows the fluorescence responses of various physiological molecules: 20 mM Na.sup.+, 100 mM K.sup.+, 2 M Cu.sup.2+, 2 M Zn.sup.2+, 1 mM Mg.sup.2+, 0.2 mM ATP, 0.1 mM GTP, and 0.1 mM GDP in the presence of 1 mM Ca.sup.2+. Values were normalized to 1 mM Ca.sup.2+ in the absence of other metals. Emission maxima at 510 nm; excitation at 488 nm.

(54) FIG. 21D shows the stopped-flow fluorescence using 10 M CatchER at various Ca.sup.2+ concentrations recorded at 395 nm excitation. CatchER's fluorescence response in 0 mM Ca.sup.2+ was measured as the baseline.

(55) FIG. 21E shows the stopped-flow traces showing decreased fluorescence upon rapid mixture of Ca.sup.2+-loaded CatchER with 200 M EGTA. Emission at 510 nm.

(56) FIG. 22A shows a representative chemical shift of cross-peak Y143 at [Ca.sup.2+]=0, 0.5, 1, 2, 4, and 6 mM, overlaid with 2D [.sup.1H-.sup.15N] HSQC spectra of 0.3 mM CatchER in response to Ca.sup.2+.

(57) FIG. 22B shows a Q69 chemical shift perturbation induced by Ca.sup.2+ titration. A minor peak was separated from the original single peak after adding 2 mM Ca.sup.2+, and the ratio of integration of peak b to peak a increased from 0 to 2.27 as Ca.sup.2+ concentration increased from 1 mM to 6 mM.

(58) FIG. 22C shows combined chemical shift changes in combining a backbone amide proton and nitrogen between the Ca.sup.2+-saturated and Ca.sup.2+-free form. Ca.sup.2+ influences the residues interacting with the chromophore or close to the designed Ca.sup.2+ binding site. Y182, highly accessible to solvents, and G228 in the flexible C-terminal also exhibited more than a 0.2-ppm change in chemical shift. The secondary structure of CatchER, according to EGFP, was labeled on the top. All data were recorded at 37 C. using a 600 MHz NMR spectrometer with 300 M .sup.15N-labeled samples in 10 mM Tris, 10 mM KCl, pH 7.4.

(59) FIG. 23A illustrates C2C12 myoblast endoplasmic reticulum Ca.sup.2+ dynamics monitored with CatchER. Two representative fluorescence responses to intact myoblasts without extracellular Ca.sup.2+ or EGTA were evoked by 100 M ATP (pH 7.0) twice separated by a Ringer buffer washout.

(60) FIG. 23B illustrates the same batch of cells as in FIG. 23A when permeabilized with 25 M digitonin in intracellular buffer for 3 mins and sequentially treated with IP.sub.3, intracellular buffer washout, thapsigargin, IP.sub.3 (arrow), washout (triangle), and ionomycin (arrow).

(61) FIG. 23C illustrates representative fluorescent imaging of C2C12 co-expressing CatchER and mCherry-ER.

(62) FIG. 23D illustrates CatchER (top) and mCherry-ER (bottom) fluorescence responses to 4-Chloro-m-Cresol (4-CmC) application. Time points of corresponding imaging in FIG. 23C are indicated.

(63) FIG. 23E illustrates 4-CmC evoked Ca.sup.2+ release in the absence and presence of thapsigargin.

(64) FIG. 24 illustrates 4-CmC evoked cytosolic Ca.sup.2+ changes detected by Fura-2.

(65) FIGS. 25A-25N illustrate the fluorescence and UV-absorbance changes of purified bacterially expressed EGFP-based sensors in response to Ca.sup.2+ demonstrating adjustments of the sensor dynamic ranges.

(66) FIG. 25A illustrates overlaid absorbance spectra from 220 nm to 600 nm of EGFP in the presence of 10 M EGTA (solid line) or 5 mM Ca.sup.2+ (dashed line).

(67) FIGS. 25B-25F illustrate absorbance spectra from 220 nm to 600 nm of EGFP-based sensors D8, D9, D10, CatchER, and D12 in the presence of 10 M EGTA (solid lines) or 5 mM Ca.sup.2+ (dashed lines). The absorbance maxima at 488 nm increased and 395 nm decreased for D9, D10, and CatchER (C-E) in response to Ca.sup.2+.

(68) FIG. 25G illustrates overlaid fluorescence emission spectra from 500 nm to 600 nm of EGFP measured by a fluorometer in the presence of 10 M EGTA (solid line) or 5 mM Ca.sup.2+ (dashed line). The two overlaid emission spectra on the top were excited at 488 nm and the two or at 395 nm (bottom).

(69) FIGS. 25H-25L illustrate the fluorescent emission spectra of the EGFP-based sensors D8, D9, D10, CatchER and D12, respectively.

(70) FIG. 25M is a graph showing the comparison of the amplitudes of fluorescence emission change at 510 nm excited at 488 nm (black bar) and 395 nm (gray bar) of EGFP and designed variants in response to Ca.sup.2+. The amplitude change is in the term of (F.sub.Holo/F.sub.Apo-1), and F.sub.Holo and F.sub.Apo represent the absorbance intensity in the presence of 5 mM Ca.sup.2+ and 10 M EGTA, respectively. The non-ratiometric fluorescence change at 510 nm excited at either 488 nm and 395 nm of D9, D10, CatchER and D12 is presented in the positive values of the bars.

(71) FIG. 25N is a graph showing the comparison of the amplitudes of absorbance change at 488 nm (black bar) and 395 nm (gray bar) of EGFP and variants thereof in response to Ca.sup.2+. The amplitude change is in the term of (A.sub.Holo/A.sub.Apo1), and A.sub.Holo and A.sub.Apo represent the absorbance intensity in the presence of 5 mM Ca.sup.2+ and 10 M EGTA, respectively. The ratiometric absorbance change at 488 nm and 395 nm of D9, D10 and CatchER in response to Ca.sup.2+ is presented in the positive and negative values of the bars, respectively. Absorbance at 280 nm of all the variants was normalized to 1.

(72) FIGS. 26A-26G illustrate the pH stability of CatchER before and after binding Ca.sup.2+ as determined by measuring the apparent pKa values based on pH-dependence of the fluorescence intensity, and the stoichiometric interaction between CatchER and Ca.sup.2+ is determined by Job's Plot.

(73) FIG. 26A shows the fluorescence emission intensities at 510 nm were recorded in the presence of 10 M EGTA (circle) or 4 mM Ca.sup.2+ (square) with excitation at 488 nm at corresponding pH values. The apparent pKa was 7.590.03 (EGTA) and 6.910.03 (Ca.sup.2+).

(74) FIG. 26B shows the pH-dependence of the fluorescence emission intensities at 510 nm excited at 395 nm. The apparent pKa was 7.140.02 (EGTA) and 6.950.06 (Ca.sup.2+).

(75) FIG. 26C shows a Job's Plot of the relative amount of Ca.sup.2+-bound CatchER as determined by fluorescence (F.sub.488, F.sub.395) and absorbance (A.sub.488) as a function of the concentration of CatchER.

(76) FIG. 26D shows the numerical results of the Job Plot of FIG. 26C.

(77) FIG. 26E shows fluorescent spectra with the concentration of CatchER in M 28.7, 23.3, 19.4, 15.1, and 11.6 (solid line) in response to [Ca.sup.2+] (in M)=11.3, 16.7, 20.6, 24.9, 28.4 (dashed line), excited at 488 nm.

(78) FIG. 26F shows fluorescent spectra with the concentration of CatchER in M 28.7, 23.3, 19.4, 15.1, and 11.6 (solid line) in response to [Ca.sup.2+] (in M)=11.3, 16.7, 20.6, 24.9, 28.4 (dashed line), excited at 395 nm.

(79) FIG. 26G shows the corresponding absorbance change in the absence (solid line) or presence (dashed line) of Ca.sup.2+.

(80) FIGS. 27A and 27B illustrate Ca.sup.2+ binding by CatchER by equilibrium dialysis and an Inductively Coupled Plasma Optical Emission Spectrometer (ICP-OES).

(81) FIG. 27A shows representative spectra of ICP-OES (Inductively Coupled Plasma Optical Emission Spectrometry) to determine the total Ca.sup.2+ concentration (bound and unbound) outside a dialysis tube (buffer) and inside the dialysis tube with the samples of myoglobin, EGFP, CatchER and -lactalbumin, respectively, with maximal intensity at 370.602 nm. Each spectrum is the average of three-time repeats with the error bars, and the amplitude of peak intensity of each sample represents the concentration of Ca.sup.2+.

(82) FIG. 27B shows the comparison of Ca.sup.2+ concentration of each sample determined by ICP-OES. The peak intensities recorded at 396.847, 373.690, 219.779, 370.602, 317.933, 643.907 and 220.861 nm were converted to Ca.sup.2+ concentration calibrated by the pre-determined Ca.sup.2+ standard linear curve at each wavelength, respectively. The Ca.sup.2+ concentration of the buffer outside the dialysis tube was 60.40.7 M (unbound), and inside (both bound and unbound), containing myoglobin, EGFP, CatchER and -lactalbumin was 61.51.2, 64.51.1, 74.61.5 and 79.11.7 M (both bound and unbound), respectively.

(83) FIGS. 28A-28C illustrate the monomerization of CatchER by measured rotational correlation time .sub.C with high-field nuclear magnetic resonance spectroscopy.

(84) FIG. 28A shows .sub.C directly determined by the SCT-CCR experiment performed on an 800 MHz NMR spectrometer (gray square) or calculated using Eq. (16) and (17) with relaxation times T.sub.1, T.sub.2 determined on a 600 MHz NMR spectrometer (black circle). The secondary structures of corresponding residues are marked above.

(85) FIG. 28B shows representative fitting of peaks integrations collected at 0, 30, 60, 100, 240, 480, 720, 1000, and 1500 ms T.sub.1 delays.

(86) FIG. 28C shows overlay of T1 delay spectra from selected region: 0 ms and 1500 ms.

(87) FIGS. 29A-29H illustrate CatchER NMR assignment and Ca.sup.2+ influence on residues interacting with the chromophore on the opposite side of the designed Ca.sup.2+ binding site.

(88) FIG. 29A shows selected CatchER 3D HNCA spectra from 114 to E17, with sequential and intraresidual C-C connections indicated by red lines.

(89) FIG. 29B shows a CatchER 2D {.sup.1H-.sup.15N} HSQC spectrum.

(90) FIG. 29C shows C chemical shifts. Most labeled residues exhibiting more than a 1.5 p.p.m. chemical shift difference were sequentially close to the chromophore or the designed Ca.sup.2+ binding site. Nos. 1-5 represent E147, D202, E204, E223, and E225, respectively. All the data were recorded at 37 C. using an 800 MHz NMR spectrometer with a cryogenic probe and a 300 mM .sup.13C-.sup.15N double-labeled sample in 10 mM Tris, pH 7.4.

(91) FIGS. 29D-29G show CatchER 2D {.sup.1H-.sup.15N} HSQC spectrum recorded at 0 mM Ca.sup.2+ (black) and 6 mM Ca.sup.2+ (red). A chemical shift change was observed for Q94 at 6 mM Ca.sup.2+ but no change for R96, F165, or V61.

(92) FIG. 29H shows sidechains of R96, Q94, F165, and V61 protruding toward the chromophore on the opposite side of the designed Ca.sup.2+ binding site. Data were recorded at 37 C. using a 600 MHz NMR spectrometer with a 300 M .sup.15N labeled sample in 10 mM Tris and 10 mM KCl, pH 7.4.

(93) FIGS. 30A-30B illustrate the localization of CatchER expressed in the ER of HEK-293 and C2C12 cells and SR of FDB fibers.

(94) FIG. 30A shows colocalization of CatchER and DsRed2-ER in HEK-293 cells. CatchER and DsRed2-ER (were transiently co-transfected and expressed in two cell lines for confocal microscopy imaging. The overlay imaging shows the colocalization of CatchER corresponding to ER-tracker DsRed2-ER.

(95) FIG. 30B shows co-localization of CatchER and DsRed2-ER in C2C12 cells. CatchER and DsRed2-ER (were transiently co-transfected and expressed in two cell lines for confocal microscopy imaging. The overlay imaging shows the co-localization of CatchER corresponding to ER-tracker DsRed2-ER.

(96) FIGS. 31A-31I illustrate the in situ determination of K.sub.d and endoplasmic reticulum Ca.sup.2+ dynamics of HeLa and HEK293 cells.

(97) FIG. 31A shows in situ determination of K.sub.d in ER of C2C12 myoblast cells. 1-5 correspond to 1, 3, 10, and 20 mM Ca.sup.2+ and 3 mM EGTA, respectively.

(98) FIG. 31B shows a K.sub.d determination in BHK cells. 1-7 represent 0.05, 0.1, 0.5, 1, 5, and 10 mM Ca.sup.2+ and 200 M EGTA. CatchER fluorescent signals of transfected permeabilized cells after equilibration with various extracellular Ca.sup.2+ concentrations excited at 488 nm.

(99) FIG. 31C shows a K.sub.d calculation with a 1:1 binding mode.

(100) FIG. 31D shows a representative ER Ca.sup.2+ signaling detected by CatchER in HeLa cells triggered by ATP.

(101) FIG. 31E shows a representative ER Ca.sup.2+ signaling detected by CatchER in HeLa cells triggered by histamine.

(102) FIG. 31F shows a representative ER Ca.sup.2+ signaling detected by CatchER in HeLa cells triggered by CPA.

(103) FIG. 31G shows a representative ER Ca.sup.2+ signaling detected by CatchER in HeLa cells triggered by ATP.

(104) FIG. 31H reversible Ca.sup.2+ release triggered by 50 M histamine in HEK293 cells.

(105) FIG. 31I shows quantification of irreversible ER Ca.sup.2+ release in HEK293 cells induced by 2 M thapsigargin in the presence of 1 mM extracellular Ca.sup.2+. F.sub.min and F.sub.max were determined by adding 5 mM EGTA and 50 mM Ca.sup.2+, respectively, to the intact cells in the presence of 5 M ionomycin (n=6).

(106) FIG. 32 shows the temperature dependent NMR HSQC spectra changes of CatchER.

(107) FIG. 33 shows a 1D NMR spectra of chemical shift changes of CatchER triggered by Ca.sup.2+.

(108) FIG. 34 illustrates X-ray crystal structures of chromophore conformation change of Apo-CatchER and Ca.sup.2+-loaded CatchER, and correlated absorption spectra. (red is light grey, blue is dark grey, green is medium grey, cyan is light grey)

(109) FIG. 35 illustrates X-ray crystal structures of chromophore conformation change of Apo-CatchER, Ca.sup.2+-loaded CatchER, and Gd.sup.3+_loaded CatchER. (cyan is light grey, purple is dark grey, green is medium grey)

(110) The drawings are described in greater detail in the description and examples below.

(111) The details of some exemplary embodiments of the methods and systems of the present disclosure are set forth in the description below. Other features, objects, and advantages of the disclosure will be apparent to one of skill in the art upon examination of the following description, drawings, examples and claims. It is intended that all such additional systems, methods, features, and advantages be included within this description, be within the scope of the present disclosure, and be protected by the accompanying claims.

DETAILED DESCRIPTION

(112) Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.

(113) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.

(114) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.

(115) All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.

(116) As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.

(117) Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of medicine, organic chemistry, biochemistry, molecular biology, pharmacology, and the like, which are within the skill of the art. Such techniques are explained fully in the literature.

(118) It must be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a support includes a plurality of supports. In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings unless a contrary intention is apparent.

(119) As used herein, the following terms have the meanings ascribed to them unless specified otherwise. In this disclosure, comprises, comprising, containing and having and the like can have the meaning ascribed to them in U.S. Patent law and can mean includes, including, and the like; consisting essentially of or consists essentially or the like, when applied to methods and compositions encompassed by the present disclosure refers to compositions like those disclosed herein, but which may contain additional structural groups, composition components or method steps (or analogs or derivatives thereof as discussed above). Such additional structural groups, composition components or method steps, etc., however, do not materially affect the basic and novel characteristic(s) of the compositions or methods, compared to those of the corresponding compositions or methods disclosed herein. Consisting essentially of or consists essentially or the like, when applied to methods and compositions encompassed by the present disclosure have the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.

DEFINITIONS

(120) In describing and claiming the disclosed subject matter, the following terminology will be used in accordance with the definitions set forth below.

(121) Further definitions are provided in context below. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art of molecular biology. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described herein.

(122) Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this disclosure pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodology by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 3rd. edition (2001) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. and Current Protocols in Molecular Biology (Ausbel et al., eds., John Wiley & Sons, Inc. 2001). As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.

(123) The term polypeptide as used herein refers to proteins and fragments thereof. Polypeptides are disclosed herein as amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus. In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).

(124) The term variant as used herein refers to a polypeptide or polynucleotide that differs from a reference polypeptide or polynucleotide, but retains essential properties. A typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall (homologous) and, in many regions, identical. A variant and reference polypeptide may differ in amino acid sequence by one or more modifications (e.g., substitutions, additions, and/or deletions). A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polypeptide may be naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally.

(125) Modifications and changes can be made in the structure of the polypeptides of this disclosure and still result in a molecule having similar characteristics as the polypeptide (e.g., a conservative amino acid substitution). For example, certain amino acids can be substituted for other amino acids in a sequence without appreciable loss of activity. Because it is the interactive capacity and nature of a polypeptide that defines that polypeptide's biological functional activity, certain amino acid sequence substitutions can be made in a polypeptide sequence and nevertheless obtain a polypeptide with like properties.

(126) In making such changes, the hydropathic index of amino acids can be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is known that certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. Those indices are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (0.4); threonine (0.7); serine (0.8); tryptophan (0.9); tyrosine (1.3); proline (1.6); histidine (3.2); glutamate (3.5); glutamine (3.5); aspartate (3.5); asparagine (3.5); lysine (3.9); and arginine (4.5).

(127) It is believed that the relative hydropathic character of the amino acid determines the secondary structure of the resultant polypeptide, which in turn defines the interaction of the polypeptide with other molecules, such as enzymes, substrates, receptors, antibodies, antigens, and the like. It is known in the art that an amino acid can be substituted by another amino acid having a similar hydropathic index and still obtain a functionally equivalent polypeptide. In such changes, the substitution of amino acids whose hydropathic indices are within 2 is preferred, those within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.

(128) Substitution of like amino acids can also be made on the basis of hydrophilicity, particularly where the biologically functional equivalent polypeptide or peptide thereby created is intended for use in immunological embodiments. The following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.01); glutamate (+3.01); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); proline (0.51); threonine (0.4); alanine (0.5); histidine (0.5); cysteine (1.0); methionine (1.3); valine (1.5); leucine (1.8); isoleucine (1.8); tyrosine (2.3); phenylalanine (2.5); tryptophan (3.4). It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an immunologically equivalent polypeptide. In such changes, the substitution of amino acids whose hydrophilicity values are within 2 is preferred, those within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.

(129) As outlined above, amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take one or more of the foregoing characteristics into consideration are well known to those of skill in the art and include, but are not limited to (original residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys), (Asn: Gin, His), (Asp: Glu, Cys, Ser), (Gin: Asn), (Glu: Asp), (Gly: Ala), (His: Asn, Gin), (Ile: Leu, Val), (Leu: Ile, Val), (Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr), (Tyr: Trp, Phe), and (Val: Ile, Leu). Embodiments of this disclosure thus contemplate functional or biological equivalents of a polypeptide as set forth above. In particular, embodiments of the polypeptides can include variants having about 50%, 60%, 70%, 80%, 90%, and 95% sequence identity to the polypeptide of interest.

(130) The term identity, as used herein refers to a relationship between two or more polypeptide sequences, as determined by comparing the sequences. In the art, identity also refers to the degree of sequence relatedness between polypeptide as determined by the match between strings of such sequences. Identity and similarity can be readily calculated by known methods, including, but not limited to, those described in Computational Molecular Biology, Lesk, A. M., Ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., Ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., Eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., Eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J Applied Math., 48: 1073, (1988).

(131) Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. The percent identity between two sequences can be determined by using analysis software (i.e., Sequence Analysis Software Package of the Genetics Computer Group, Madison Wis.) that incorporates the Needelman and Wunsch, (J. Mol. Biol., 48: 443-453, 1970) algorithm (e.g., NBLAST, and XBLAST). The default parameters are used to determine the identity for the polypeptides of the present invention.

(132) By way of example, a polypeptide sequence may be identical to the reference sequence, that is be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the % identity is less than 100%. Such alterations are selected from: at least one amino acid deletion, substitution (including conservative and non-conservative substitution), or insertion, and wherein said alterations may occur at the amino- or carboxy-terminus positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence, or in one or more contiguous groups within the reference sequence. The number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in the reference polypeptide by the numerical percent of the respective percent identity (divided by 100) and then subtracting that product from said total number of amino acids in the reference polypeptide.

(133) Conservative amino acid variants can also comprise non-naturally occurring amino acid residues. Non-naturally occurring amino acids include, without limitation, trans-3-methylproline, 2,4-methanoproline, cis-4-hydroxyproline, trans-4-hydroxyproline, N-methyl-glycine, allo-threonine, methylthreonine, hydroxy-ethylcysteine, hydroxyethylhomocysteine, nitro-glutamine, homoglutamine, pipecolic acid, thiazolidine carboxylic acid, dehydroproline, 3- and 4-methylproline, 3,3-dimethylproline, tert-leucine, norvaline, 2-azaphenyl-alanine, 3-azaphenylalanine, 4-azaphenylalanine, and 4-fluorophenylalanine. Several methods are known in the art for incorporating non-naturally occurring amino acid residues into proteins. For example, an in vitro system can be employed wherein nonsense mutations are suppressed using chemically aminoacylated suppressor tRNAs. Methods for synthesizing amino acids and aminoacylating tRNA are known in the art. Transcription and translation of plasmids containing nonsense mutations is carried out in a cell-free system comprising an E. coli S30 extract and commercially-available enzymes and other reagents. Proteins are purified by chromatography. (Robertson et al., (1991) J. Am. Chem. Soc. 113: 2722; Ellman et al., (1991) Methods Enzymol. 202: 301; Chung et al., Science (1993) 259: 806-809; and Chung et al., (1993) Proc. Natl. Acad. Sci. USA, 90: 10145-10149). In a second method, translation is carried out in Xenopus oocytes by microinjection of mutated mRNA and chemically aminoacylated suppressor tRNAs (Turcatti et al., (1996) J. Biol. Chem. 271: 19991-19998). Within a third method, E. coli cells are cultured in the absence of a natural amino acid that is to be replaced (e.g., phenylalanine) and in the presence of the desired non-naturally occurring amino acid(s) (e.g., 2-azaphenylalanine, 3-azaphenylalanine, 4-azaphenylalanine, or 4-fluorophenylalanine). The non-naturally occurring amino acid is incorporated into the protein in place of its natural counterpart. (Koide et al., (1994) Biochem. 33: 7470-7476). Naturally occurring amino acid residues can be converted to non-naturally occurring species by in vitro chemical modification. Chemical modification can be combined with site-directed mutagenesis to further expand the range of substitutions (Wynn et al., (1993) Protein Sci. 2: 395-403).

(134) The term polynucleotide as used herein refers to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. Thus, for instance, polynucleotides as used herein refers to, among others, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. The terms nucleic acid, nucleic acid sequence, or oligonucleotide also encompass a polynucleotide as defined above.

(135) As used herein, the term polynucleotide includes DNAs or RNAs as described above that contain one or more modified bases. Thus, DNAs or RNAs with backbones modified for stability or for other reasons are polynucleotides as that term is intended herein. Moreover, DNAs or RNAs comprising unusual bases, such as inosine, or modified bases, such as tritylated bases, to name just two examples, are polynucleotides as the term is used herein.

(136) It will be appreciated that a great variety of modifications have been made to DNA and RNA that serve many useful purposes known to those of skill in the art. The term polynucleotide as it is employed herein embraces such chemically, enzymatically, or metabolically modified forms of polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including simple and complex cells, inter alia.

(137) By way of example, a polynucleotide sequence of the present disclosure may be identical to the reference sequence, that is be 100% identical, or it may include up to a certain integer number of nucleotide alterations as compared to the reference sequence. Such alterations are selected from the group including at least one nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5 or 3 terminus positions of the reference nucleotide sequence or anywhere between those terminus positions, interspersed either individually among the nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence. The number of nucleotide alterations is determined by multiplying the total number of nucleotides in the reference nucleotide by the numerical percent of the respective percent identity (divided by 100) and subtracting that product from said total number of nucleotides in the reference nucleotide. Alterations of a polynucleotide sequence encoding the polypeptide may alter the polypeptide encoded by the polynucleotide following such alterations.

(138) As used herein, DNA may obtained by any method. For example, the DNA includes complementary DNA (cDNA) prepared from mRNA, DNA prepared from genomic DNA, DNA prepared by chemical synthesis, DNA obtained by PCR amplification with RNA or DNA as a template, and DNA constructed by appropriately combining these methods.

(139) cDNA can be cloned from mRNA encoding the protein by, for example, the method described below:

(140) First, the mRNA encoding the protein is prepared from the above-mentioned tissues or cells expressing and producing the protein. mRNA can be prepared by isolating total RNA by a known method such as guanidine-thiocyanate method (Chirgwin et al., Biochemistry, 18:5294, 1979), hot phenol method, or AGPC method, and subjecting it to affinity chromatography using oligo-dT cellulose or poly-U Sepharose.

(141) Then, with the mRNA obtained as a template, cDNA is synthesized, for example, by a well-known method using reverse transcriptase, such as the method of Okayama et al (Mol. Cell. Biol. 2:161 (1982); Mol. Cell. Biol. 3:280 (1983)) or the method of Hoffman et al. (Gene 25:263 (1983)), and converted into double-stranded cDNA. A cDNA library is prepared by transforming E. coli with plasmid vectors, phage vectors, or cosmid vectors having this cDNA or by transfecting E. coli after in vitro packaging.

(142) As used herein, an isolated nucleic acid is a nucleic acid, the structure of which is not identical to that of any naturally occurring nucleic acid or to that of any fragment of a naturally occurring genomic nucleic acid spanning more than three genes. The term therefore covers, for example, (a) a DNA which has the sequence of part of a naturally occurring genomic DNA molecule but is not flanked by both of the coding sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of a prokaryote or eukaryote in a manner such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion protein. Specifically excluded from this definition are nucleic acids present in random, uncharacterized mixtures of different DNA molecules, transfected cells, or cell clones, e.g., as these occur in a DNA library such as a cDNA or genomic DNA library.

(143) The term substantially pure as used herein in reference to a given polypeptide means that the polypeptide is substantially free from other biological macromolecules. For example, the substantially pure polypeptide is at least 75%, 80, 85, 95, or 99% pure by dry weight. Purity can be measured by any appropriate standard method known in the art, for example, by column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis.

(144) The plasmid vectors used herein are not limited as long as they are replicated and maintained in hosts. Any phage vector that can be replicated in hosts can also be used. Examples of commonly used cloning vectors are pUC19, gt10, gt11, and so on. When the vector is applied to immunological screening as mentioned below, a vector having a promoter that can express a gene encoding the desired protein in a host is preferably used.

(145) cDNA can be inserted into a plasmid by, for example, the method of Maniatis et al. (Molecular Cloning, A Laboratory Manual, second edition, Cold Spring Harbor Laboratory, p. 1.53, 1989). cDNA can be inserted into a phage vector by, for example, the method of Hyunh et al. (DNA cloning, a practical approach, 1, p. 49 (1985)). These methods can be simply performed by using a commercially available cloning kit (for example, a product from Takara Shuzo). The recombinant plasmid or phage vector thus obtained is introduced into an appropriate host cell such as a prokaryote (for example, E. coli strains HB101, DH5a, MC1061/P3, etc).

(146) Examples of a method for introducing a plasmid into a host are, calcium chloride method, calcium chloride/rubidium chloride method, lipidsome method, and electroporation method, described in Molecular Cloning, A Laboratory Manual (second edition, Cold Spring Harbor Laboratory, p. 1.74 (1989)). Phage vectors can be introduced into host cells by, for example, a method in which the phage DNAs are introduced into grown hosts after in vitro packaging. In vitro packaging can be easily performed with a commercially available in vitro packaging kit (for example, a product from Stratagene or Amersham).

(147) The identification of cDNA encoding protein, its expression being augmented depending on the stimulation of cytokines like AID protein disclosed herein, can be carried out by for example suppression subtract hybridization (SSH)((1996) Proc. Natl. Acad. Sci. USA. 93: 6025-6030; Anal. Biochem. (1996) 240: 90-97) taking advantage of suppressive PCR effect ((1995) Nucleic Acids Res. 23:1087-1088) using two cDNA libraries, namely, cDNA library constructed from mRNA derived from stimulated cells (tester cDNA library) and that constructed from mRNA derived from unstimulated cells (driver cDNA library).

(148) Embodiments of the present disclosure relate to a recombinant vector comprising the DNA encoding the protein used herein. As a recombinant vector disclosed herein, any vector can be used as long as it is capable of retaining replication or self-multiplication in each host cell of prokaryotic and/or eukaryotic cells, including plasmid vectors and phage vectors. The recombinant vector can easily be prepared by ligating the DNA encoding protein with a vector for recombination available in the art (plasmid DNA and bacteriophage DNA) by the usual method.

(149) Specific examples of the vectors for recombination used are E. coli-derived plasmids such as pBR322, pBR325, pUC12, pUC13, and pUC19, yeast-derived plasmids such as pSH19 and pSH15, and Bacillus subtilis-derived plasmids such as pUB110, pTP5, and pC194. Examples of phages are a bacteriophage such as lambda phage, and an animal or insect virus (pVL1393, Invitrogen) such as a retrovirus, vaccinia virus, and nuclear polyhedrosis virus.

(150) An expression vector is useful for expressing the DNA encoding the protein used herein and for producing the protein. The expression vector is not limited as long as it expresses the gene encoding the protein in various prokaryotic and/or eukaryotic host cells and produces this protein. Examples thereof are MAL C2, pEF-BOS ((1990) Nucleic Acids Res. 18:5322, and so on), ME18S pCDNA (Experimental Medicine: SUPPLEMENT, Handbook of Genetic Engineering (1992)), etc.

(151) When bacteria, particularly E. coli, are used as host cells an expression vector generally comprises, at least, a promoter/operator region, an initiation codon, the DNA encoding the protein termination codon, terminator region, and replicon.

(152) When yeast, animal cells, or insect cells are used as hosts, an expression vector is preferably comprised of, at least; a promoter, an initiation codon, the DNA encoding the protein and a termination codon. It may also comprise the DNA encoding a signal peptide, enhancer sequence, 5- and 3-untranslated region of the gene encoding the protein, splicing junctions, polyadenylation site, selectable marker region, and replicon. The expression vector may also contain, if required, a gene for gene amplification (marker) that is usually used. DNA plasmids can also be directly introduced to the mammalian cells of animals to express proteins.

(153) A promoter/operator region to express the protein in bacteria comprises a promoter, an operator, and a Shine-Dalgarno (SD) sequence (for example, AAGG). For example, when the host is Escherichia, it preferably comprises Trp promoter, lac promoter, recA promoter, APL promoter, tac promoter, or the like. Examples of a promoter to express the protein in yeast are PHO5 promoter, PGK promoter, GAP promoter, ADH promoter, and so on. When the host is Bacillus, examples thereof are SL01 promoter, SP02 promoter, penP promoter, and so on. When the host is a eukaryotic cell such as a mammalian cell, examples thereof are SV40-derived promoter, retrovirus promoter, heat shock promoter, and so on, and preferably SV-40 and retrovirus-derived one. As a matter of course, the promoter is not limited to the above examples. In addition, using an enhancer is effective for expression.

(154) A preferable initiation codon is, for example, a methionine codon (ATG).

(155) A commonly used termination codon (for example, TAG, TAA, TGA) is exemplified as a termination codon. Usually, used natural or synthetic terminators are used as a terminator region.

(156) A replicon means a DNA capable of replicating the whole DNA sequence in host cells, and includes a natural plasmid, an artificially modified plasmid (DNA fragment prepared from a natural plasmid), a synthetic plasmid, and so on. Examples of preferable plasmids are pBR322 or its artificial derivatives (DNA fragment obtained by treating pBR322 or pRSET with appropriate restriction enzymes) for E. coli, yeast 2 plasmid or yeast chromosomal DNA for yeast, and pRSVneo ATCC 37198, pSV2dhfr ATCC 37145, pdBPV-MMTneo ATCC 37224, pSV2neo ATCC 37149, and such for mammalian cells.

(157) An enhancer sequence, polyadenylation site, and splicing junction that are usually used in the art, such as those derived from SV40 can also be used.

(158) A selectable marker usually employed can be used according to the usual method. Examples thereof are resistance genes for antibiotics, such as tetracycline, ampicillin, or kanamycin.

(159) Examples of genes for gene amplification are dihydrofolate reductase (DHFR) gene, thymidine kinase gene, neomycin resistance gene, glutamate synthase gene, adenosine deaminase gene, ornithine decarboxylase gene, hygromycin-B-phophotransferase gene, aspartate transcarbamylase gene, etc.

(160) The expression vector used herein can be prepared by continuously and circularly linking at least the above-mentioned promoter, initiation codon, DNA encoding the protein, termination codon, and terminator region, to an appropriate replicon. If desired, appropriate DNA fragments (for example, linkers, restriction sites, and so on), can be used by the usual method such as digestion with a restriction enzyme or ligation using T4 DNA ligase.

(161) Affinity tags such His-tag and GST can be added at the sequence end to facilitate protein purification and recognition by Western blot and pulldown assay. Examples of other tags such as HA and FLAG can also be added to allow further manipulation of the constructs.

(162) As used herein, transformants can be prepared by introducing the expression vector mentioned above into host cells.

(163) As used herein, host cells are not limited as long as they are compatible with an expression vector mentioned above and can be transformed. Examples thereof are various cells such as wild-type cells or artificially established recombinant cells usually used in technical field (for example, bacteria (Escherichia and Bacillus), yeast (Saccharomyces, Pichia, and such), animal cells, or insect cells).

(164) E. coli or animal cells are preferably used. Specific examples are E. coli strains DH5 alpha, TB1, HB101, and the like, mouse-derived cells (COP, L, C127, Sp2/0, NS-1, NIH 3T3, and such), rat-derived cells (PC12, PC12h), hamster-derived cells (BHK, CHO, and such), monkey-derived cells (COS1, COS3, COS7, CV1, Velo, and such), and human-derived cells (Hela, diploid fibroblast-derived cells, myeloma cells, and HepG2, and such).

(165) An expression vector can be introduced (transformed (transfected)) into host cells by known methods. Transformation can be performed, for example, according to the method of Cohen et al. ((1972) Proc. Natl. Acad. Sci. USA. 69: 2110), protoplast method ((1979) Mol. Gen. Genet. 168: 111), or competent method ((1971) J. Mol. Biol. 56: 209) when the hosts are bacteria (E. coli, Bacillus subtilis, and the like), the method of Hinnen et al. ((1978) Proc. Natl. Acad. Sci. USA. 75: 1927), or lithium method ((1983) J. Bacteriol. 153: 163) when the host is Saccharomyces cerevisiae, the method of Graham ((1973) Virology 52: 456) when the hosts are animal cells, and the method of Summers et al. ((1983) Mol. Cell. Biol. 3: 2156-2165) when the hosts are insect cells.

(166) The protein disclosed herein, can be produced by cultivating transformants (in the following, this term includes transfectants) comprising an expression vector prepared as mentioned above in nutrient media.

(167) The nutrient media preferably comprise a carbon source, an inorganic or organic nitrogen source necessary for the growth of host cells (transformants). Examples of the carbon source are glucose, dextran, soluble starch, and sucrose, and examples of the inorganic or organic nitrogen source are ammonium salts, nitrates, amino acids, corn steep liquor, peptone, casein, meat extract, soy bean cake, and potato extract. If desired, they may comprise other nutrients (for example, an inorganic salt (for example, calcium chloride, sodium dihydrogenphosphate, and magnesium chloride), vitamins, antibiotics (for example, tetracycline, neomycin, ampicillin, kanamycin, and so on).

(168) Cultivation of cell lines is performed by a method known in the art. Cultivation conditions such as temperature, pH of the media, and cultivation time are selected appropriately so that the protein is produced in large quantities.

(169) It will be appreciated that a great variety of modifications have been made to DNA and RNA that serve many useful purposes known to those of skill in the art. The term polynucleotide as it is employed herein embraces such chemically, enzymatically, or metabolically modified forms of polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including simple and complex cells, inter alia.

(170) By way of example, a polynucleotide sequence of the present disclosure may be identical to the reference sequence, that is be 100% identical, or it may include up to a certain integer number of nucleotide alterations as compared to the reference sequence. Such alterations are selected from the group including at least one nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5 or 3 terminus positions of the reference nucleotide sequence or anywhere between those terminus positions, interspersed either individually among the nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence. The number of nucleotide alterations is determined by multiplying the total number of nucleotides in the reference nucleotide by the numerical percent of the respective percent identity (divided by 100) and subtracting that product from said total number of nucleotides in the reference nucleotide. Alterations of a polynucleotide sequence encoding the polypeptide may alter the polypeptide encoded by the polynucleotide following such alterations.

(171) The term codon means a specific triplet of mononucleotides in the DNA chain or mRNA that make up an amino acid or termination signal.

(172) The term degenerate nucleotide sequence denotes a sequence of nucleotides that includes one or more degenerate codons (as compared to a reference polynucleotide molecule that encodes a polypeptide). Degenerate codons contain different triplets of nucleotides, but encode the same amino acid residue (e.g., GAU and GAC triplets each encode Asp).

(173) As used herein, the term exogenous DNA or exogenous nucleic acid sequence or exogenous polynucleotide refers to a nucleic acid sequence that was introduced into a cell or organelle from an external source. Typically the introduced exogenous sequence is a recombinant sequence.

(174) As used herein, the term transfection refers to the introduction of a nucleic acid sequence into the interior of a membrane enclosed space of a living cell, including introduction of the nucleic acid sequence into the cytosol of a cell as well as the interior space of a mitochondria, nucleus or chloroplast. The nucleic acid may be in the form of naked DNA or RNA, associated with various proteins, or the nucleic acid may be incorporated into a vector.

(175) DNA regulatory sequences, as used herein, are transcriptional and translational control sequences, such as promoters, enhancers, polyadenylation signals, termination signals, and the like, that provide for and/or regulate expression of a coding sequence in a host cell.

(176) A promoter sequence is a DNA regulatory region in an operon capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3 direction) coding sequence. The promoter sequence is bound at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter sequence will be found a transcription initiation site, as well as protein binding domains responsible for the binding of RNA polymerase. Eukaryotic promoters will often, but not always, contain TATA boxes and CAT boxes. Various promoters, including inducible promoters, may be used to drive the various vectors of the present disclosure.

(177) The terms chimeric, fusion and composite are used to denote a protein, peptide domain or nucleotide sequence or molecule containing at least two component portions that are mutually heterologous in the sense that they are not, otherwise, found directly (covalently) linked in nature. More specifically, the component portions are not found in the same continuous polypeptide or gene in nature, at least not in the same order or orientation or with the same spacing present in the chimeric protein or composite domain. Such materials contain components derived from at least two different proteins or genes or from at least two non-adjacent portions of the same protein or gene. Composite proteins, and DNA sequences that encode them, are recombinant in the sense that they contain at least two constituent portions that are not otherwise found directly linked (covalently) together in nature.

(178) The term domain in this context is not intended to be limited to a single discrete folding domain.

(179) A reporter polynucleotide includes any gene that expresses a detectable gene product, which may be RNA or a reporter polypeptide. Reporter genes include coding sequences for which the transcriptional and/or translational products are readily detectable or selectable.

(180) An insertion or addition, as used herein, refers to a change in an amino acid or nucleotide sequence resulting in the addition or insertion of one or more amino acid or nucleotide residues, respectively, as compared to the corresponding naturally occurring molecule.

(181) A deletion or subtraction, as used herein, refers to a change in an amino acid or nucleotide sequence resulting in the deletion or subtraction of one or more amino acid or nucleotide residues, respectively, as compared to the corresponding naturally occurring molecule.

(182) A substitution, as used herein, refers to the replacement of one or more amino acids or nucleotides by different amino acids or nucleotides, respectively.

(183) A mutation is an inheritable change in a DNA sequence relative to a reference wild-type DNA sequence. Mutations can occur as a result of a single base change, multiple base changes, or the addition or deletion of more than one nucleotide to a DNA sequence.

(184) The term mutant is employed broadly to refer to a protein that differs in some way from a reference wild-type protein, where the protein may retain biological properties of the reference wild-type (e.g., naturally occurring) protein, or may have biological properties that differ from the reference wild-type protein. The term biological property of the subject proteins includes, but is not limited to, spectral properties, such as emission maximum, quantum yield, and brightness, and the like; in vivo and/or in vitro stability (e.g., half-life); and the like. Mutants can include single amino acid changes (point mutations), deletions of one or more amino acids (point-deletions), N-terminal truncations, C-terminal truncations, insertions, and the like. Mutants can be generated using standard techniques of molecular biology.

(185) A gene mutation refers to a mutation that occurs entirely within one gene, or its upstream regulatory sequences and can comprise either a point mutation or other disruption of normal chromosomal structure that occurs entirely within one gene.

(186) A wild-type strain is capable of a full range of metabolic activities. For example, wild-type strains of Salmonella can synthesize all 20 amino acids from a single carbon source.

(187) A mutant strain is not capable of all of the activities of the wild-type strain from which it is derived. For example, a mutant bacterial strain that is defective in its ability to synthesize the amino acid histidine (his strain) requires the presence of exogenous histidine in order to grow.

(188) A point mutation is a change in one, or a small number of base pairs, in a DNA sequence. Point mutations may result from base pair substitutions or from small insertions or deletions.

(189) A transition is a point mutation in which a purine is replaced with a purine or a pyrimidine is replaced with a pyrimidine.

(190) A transversion is a point mutation in which a purine is replaced with a pyrimidine or a pyrimidine with a purine. Generally speaking, transitions are more common than tranversions because the former are not detected by the proofreading enzymes.

(191) Alternatively, point mutation can also cause a nonsense mutation resulting from the insertion of a stop codon (amber, ochre, opal). Base pair mutations that generate a translation stop codon causes premature termination of translation of the coded protein.

(192) A frameshift mutation results from the insertion or deletion of one or more nucleotides within a gene. The reading frame of a gene refers to the order of the bases with respect to the starting point for translation of the mRNA. Deletion of a single base pair results in moving ahead one base in all of the codons, and is often referred to as a positive frameshift. Addition of one base pair (or loss of two base pairs) shifts the reading frame behind by one base, and is often referred to as a negative frameshift.

(193) As used herein, the term hybridization refers to the process of association of two nucleic acid strands to form an antiparallel duplex stabilized by means of hydrogen bonding between residues of the opposite nucleic acid strands.

(194) Hybridizing and binding, with respect to polynucleotides, are used interchangeably. The terms hybridizing specifically to and specific hybridization and selectively hybridize to, as used herein refer to the binding, duplexing, or hybridizing of a nucleic acid molecule preferentially to a particular nucleotide sequence under stringent conditions.

(195) The term stringent assay conditions as used herein refers to conditions that are compatible to produce binding pairs of nucleic acids, e.g., surface bound and solution phase nucleic acids, of sufficient complementarity to provide for the desired level of specificity in the assay while being less compatible to the formation of binding pairs between binding members of insufficient complementarity to provide for the desired specificity. Stringent assay conditions are the summation or combination (totality) of both hybridization and wash conditions.

(196) In accordance with the present disclosure, a detectably effective amount of the sensor of the present disclosure is defined as an amount sufficient to yield an acceptable image using equipment that is available for clinical use. A detectably effective amount of the sensor of the present disclosure may be administered in more than one injection. The detectably effective amount of the sensor of the present disclosure can vary according to factors such as the degree of susceptibility of the individual, the age, sex, and weight of the individual, idiosyncratic responses of the individual, the dosimetry, and the like. Detectably effective amounts of the sensor of the present disclosure can also vary according to instrument and film-related factors. Optimization of such factors is well within the level of skill in the art.

(197) By administration is meant introducing a sensor of the present disclosure into a subject. The preferred route of administration of the sensor is intravenous. However, any route of administration, such as oral, topical, subcutaneous, peritoneal, intraarterial, inhalation, vaginal, rectal, nasal, introduction into the cerebrospinal fluid, or instillation into body compartments can be used.

(198) As used herein the term isolated is meant to describe a polynucleotide, a polypeptide, an antibody, or a host cell that is in an environment different from that in which the polynucleotide, the polypeptide, the antibody, or the host cell naturally occurs.

(199) As used herein the phrase beta-can structure of proteins refers to a protein featured as a compact cylinder is formed with antiparallel beta strands.

(200) Fluorescent protein refers to any protein capable of emitting light when excited with appropriate electromagnetic radiation. Fluorescent proteins include proteins having amino acid sequences that are either natural or engineered, such as the fluorescent proteins derived from Aequorea-related fluorescent proteins. A fluorescent protein as used herein is an Aequorea victoria green fluorescent protein (GFP), structural variants of GFP (i.e., circular permutants, monomeric versions), folding variants of GFP (i.e., more soluble versions, superfolder versions), spectral variants of GFP (i.e., YFP, CFP), and GFP-like fluorescent proteins (i.e., DsRed and mcherry). Fluorescent proteins can be from different resources. For class Hydrozoa, GFP can be from Aequorea victoria, Mitrocoma (synonym Halistaura), Obelia, Phialidium etc. For class Anthozoa, GFP can be from Acanthopilum, Cavernularia, Renilla, Ptilosarcus and Pennatula, Stylatula, etc. We also have GFP-like proteins from Anemonia majna, FP595 from Anemonia sulcata, FPs from Zoanthus, etc. The term GFP-like fluorescent protein is used to refer to members of the Anthozoa fluorescent proteins sharing the 11-beta strand barrel structure of GFP, as well as structural, folding and spectral variants thereof. The terms GFP-like non-fluorescent protein and GFP-like chromophoric protein (or, simply, chromophoric protein or chromoprotein) are used to refer to the Anthozoa and Hydrozoa chromophoric proteins sharing the 11-beta strand barrel structure of GFP, as well as structural, folding and spectral variants thereof. GFP-like proteins all share common structural and functional characteristics, including without limitation, the capacity to form internal chromophores without requiring accessory co-factors, external enzymatic catalysis or substrates, other than molecular oxygen.

(201) A variety of fluorescent proteins may be used in the present disclosure, including proteins that fluoresce due to intramolecular rearrangements or the addition of cofactors that promote fluorescence. For example, green fluorescent proteins of cnidarians, which act as their energy-transfer acceptors in bioluminescence, are suitable fluorescent proteins for use in the fluorescent indicators. A green fluorescent protein (GFP) is a protein that emits green light, and a blue fluorescent protein (BFP) is a protein that emits blue light. GFPs have been isolated from the Pacific Northwest jellyfish Aequorea victoria; the sea pansy Renilla reniformis; and Phialidium gregarium (see Ward et al., (1982) Photochem. Photobiol. 35: 803-808 and Levine et al., (1982) Comp. Biochem. Physiol., 72B: 77-85). Red fluorescent protein mCherry with the excitation wavelength at 587 nm and emission maxima at 610 nm. (Shaner, N. C. et. al., (2004) Nat. Biotech.)

(202) A variety of Aequorea-related GFPs having useful excitation and emission spectra have been engineered by modifying the amino acid sequence of a naturally occurring GFP from Aequorea victoria. See Prasher et. al., (1992) Gene 111: 229-233; Heim et al., (1994) Proc. Natl. Acad. Sci., USA 91: 12501-12504; U.S. Ser. No. 08/337,915, filed Nov. 10, 1994; International application PCT/US95/14692, filed Nov. 10, 1995; and U.S. Ser. No. 08/706,408, filed Aug. 30, 1996. The cDNA of GFP can be concatenated with those encoding many other proteins; the resulting fusions often are fluorescent and retain the biochemical features of the partner proteins. See, Cubitt et al., (1995) Trends Biochem. Sci. 20: 448-455. Mutagenesis studies have produced GFP mutants with shifted wavelengths of excitation or emission. See, Heim & Tsien (1996) Current Biol. 6: 178-182. Suitable pairs, for example a blue-shifted GFP mutant P4-3 (Y66H/Y145F) and an improved green mutant S65T can respectively serve as a donor and an acceptor for fluorescence resonance energy transfer (FRET). See, Tsien et al., (1993) Trends Cell Biol. 3: 242-245. A fluorescent protein is an Aequorea-related fluorescent protein if any contiguous sequence of 150 amino acids of the fluorescent protein has at least 85% sequence identity with an amino acid sequence, either contiguous or non-contiguous, from the wild type Aequorea green fluorescent protein. More preferably, a fluorescent protein is an Aequorea-related fluorescent protein if any contiguous sequence of 200 amino acids of the fluorescent protein has at least 95% sequence identity with an amino acid sequence, either contiguous or non-contiguous, from the wild type Aequorea green fluorescent protein. Similarly, the fluorescent protein can be related to Renilla or Phialidium wild-type fluorescent proteins using the same standards.

(203) A variant of GFP with two mutations at F64L and S65 used in embodiments of the present disclosure includes enhanced green fluorescent protein (EGFP). Its chromophore has an excitation maximum at 488 nm and emission maxima at 510 nm. Its flourescent signal is significantly greater than that of wildtype GFP without these two mutations.

(204) Another variant of GFP is called Cycle 3 (See, Patterson et al., (1997) Biophys. J. 73: 2782-2790, which is included herein by reference). This GFP variant with mutations at F99S, M153T and V163A at w.t. GFP has improved folding and chromophore formation at 37 C. or above.

(205) Other fluorescent proteins can be used in the fluorescent indicators, such as, for example, yellow fluorescent protein from Vibrio fischeri strain Y-1, Peridinin-chlorophyll a binding protein from the dinoflagellate Symbiodinium sp., phycobiliproteins from marine cyanobacteria such as Synechococcus, e.g., phycoerythrin and phycocyanin, or oat phytochromes from oat reconstructed with phycoerythrobilin. These fluorescent proteins have been described in Baldwin et al., (1990) Biochemistry 29: 5509-5515, Morris et al., (1994) Plant Mol. Biol., 24: 673-677, and Wilbanks et al., (1993) J. Biol. Chem. 268: 1226-1235, and Li et al., (1995) Biochemistry 34: 7923-7930.

(206) The term link as used herein refers to a physical linkage as well as linkage that occurs by virtue of co-existence within a biological particle, e.g., phage, bacteria, yeast or other eukaryotic cell.

(207) Nucleic acids used to transfect cells with sequences coding for expression of the polypeptide of interest generally will be in the form of an expression vector including expression control sequences operatively linked to a nucleotide sequence coding for expression of the polypeptide. As used, the term nucleotide sequence coding for expression of a polypeptide refers to a sequence that, upon transcription and translation of mRNA, produces the polypeptide. This can include sequences containing, e.g., introns. As used herein, the term expression control sequences refers to nucleic acid sequences that regulate the expression of a nucleic acid sequence to which it is operatively linked. Expression control sequences are operatively linked to a nucleic acid sequence when the expression control sequences control and regulate the transcription and, as appropriate, translation of the nucleic acid sequence. Thus, expression control sequences can include appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signals for introns, maintenance of the correct reading frame of that gene to permit proper translation of the mRNA, and stop codons.

(208) Methods that are well known to those skilled in the art can be used to construct expression vectors containing the fluorescent indicator coding sequence and appropriate transcriptional/translational control signals. These methods include in vitro recombinant DNA techniques, synthetic techniques and in vivo recombination/genetic recombination. (See, for example, the techniques described in Maniatis, et al., Molecular Cloning A Laboratory Manual, Cold Spring Harbor Laboratory, N.Y., 1989).

(209) A variety of host-expression vector systems may be utilized to express the bioluminescent indicator coding sequence. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing the calcium sensing system sequences; yeast transformed with recombinant yeast expression vectors containing the calcium sensing system sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid vectors containing the calcium sensing system sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) vectors containing the calcium sensing system sequences; or animal cell systems infected with recombinant virus expression vectors (e.g., retroviruses, adenovirus, vaccinia virus vectors containing the calcium sensing system sequences, or transformed animal cell systems engineered for stable expression.

(210) Depending on the host/vector system utilized, any of a number of suitable transcription and translation elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. may be used in the expression vector (See, e.g., Bitter, et al., Methods in Enzymology 153:516-544, 1987). For example, when cloning in bacterial systems, inducible promoters such as pL of bacteriophage lamda, plac, ptrp, ptac (ptrp-lac hybrid promoter) and the like may be used. When cloning in mammalian cell systems, promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the retrovirus long terminal repeat; the adenovirus late promoter; the vaccinia virus 7.5K promoter) may be used. Promoters produced by recombinant DNA or synthetic techniques may also be used to provide for transcription of the inserted fluorescent indicator coding sequence.

(211) In bacterial systems a number of expression vectors may be advantageously selected depending upon the use intended for calcium sensing system.

(212) In yeast, a number of vectors containing constitutive or inducible promoters may be used. For a review see, Current Protocols in Molecular Biology, Vol. 2, Ed. Ausubel, et al., Greene Publish. Assoc. & Wiley Interscience, Ch. 13, 1988; Grant, et al., Expression and Secretion Vectors for Yeast, in Methods in Enzymology, Eds. Wu & Grossman, 31987, Acad. Press, N.Y., Vol. 153, pp. 516-544, 1987; Glover, DNA Cloning, Vol. II, IRL Press, Wash., D.C., Ch. 3, 1986; and Bitter, Heterologous Gene Expression in Yeast, Methods in Enzymology, Eds. Berger & Kimmel, Acad. Press, N.Y., Vol. 152, pp. 673-684, 1987; and The Molecular Biology of the Yeast Saccharomyces, Eds. Strathern et al., Cold Spring Harbor Press, Vols. I and II, 1982. A constitutive yeast promoter such as ADH or LEU2 or an inducible promoter such as GAL may be used (Cloning in Yeast, Ch. 3, R. Rothstein In: DNA Cloning Vol. 11, A Practical Approach, Ed. DM Glover, IRL Press, Wash., D.C., 1986). Alternatively, vectors may be used which promote integration of foreign DNA sequences into the yeast chromosome.

(213) An alternative expression system, which could be used to express mutation assay system, is an insect system. In one such system, Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes. The virus grows in Spodoptera frugiperda cells. The calcium sensing system sequences may be cloned into non-essential regions (for example, the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter). Successful insertion of the calcium sensing system sequences will result in inactivation of the polyhedrin gene and production of non-occluded recombinant virus (i.e., virus lacking the proteinaceous coat coded for by the polyhedrin gene). These recombinant viruses are then used to infect Spodoptera frugiperda cells in which the inserted gene is expressed, see Smith, et al., J. Viol. 46:584, 1983; Smith, U.S. Pat. No. 4,215,051.

(214) DNA sequences encoding the mutation assay system of the present disclosure can be expressed in vitro by DNA transfer into a suitable host cell. Host cells are cells in which a vector can be propagated and its DNA expressed. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term host cell is used. Methods of stable transfer, in other words when the foreign DNA is continuously maintained in the host, are known in the art.

(215) Physical linkage refers to any method known in the art for functionally connecting two molecules (which are termed physically linked), including without limitation, recombinant fusion with or without intervening domains, intein-mediated fusion, non-covalent association, covalent bonding (e.g., disulfide bonding and other covalent bonding), hydrogen bonding; electrostatic bonding; and conformational bonding, e.g., antibody-antigen, and biotin-avidin associations.

(216) Fused refers to linkage by covalent bonding.

(217) As used herein, the term organelle refers to cellular membrane-bound structures such as the chloroplast, mitochondrion, and nucleus. The term organelle includes natural and synthetic organelles.

(218) As used herein, the term non-nuclear organelle refers to any cellular membrane bound structure present in a cell, except the nucleus.

(219) As used herein, the term host or organism includes humans, mammals (e.g., cats, dogs, horses, etc.), living cells, and other living organisms. A living organism can be as simple as, for example, a single eukaryotic cell or as complex as a mammal. Typical hosts to which embodiments of the present disclosure may be administered will be mammals, particularly primates, especially humans. For veterinary applications, a wide variety of subjects will be suitable, e.g., livestock such as cattle, sheep, goats, cows, swine, and the like; poultry such as chickens, ducks, geese, turkeys, and the like; and domesticated animals particularly pets such as dogs and cats. For diagnostic or research applications, a wide variety of mammals will be suitable subjects, including rodents (e.g., mice, rats, hamsters), rabbits, primates, and swine such as inbred pigs and the like. Additionally, for in vitro applications, such as in vitro diagnostic and research applications, body fluids and cell samples of the above subjects will be suitable for use, such as mammalian (particularly primate such as human) blood, urine, or tissue samples, or blood, urine, or tissue samples of the animals mentioned for veterinary applications.

(220) Analytes are atoms, molecules or ions that can bind to proteins or peptides. An analyte may bind reversibly or irreversibly and such a bond may be covalent or non-covalent. While Ca.sup.2+, Ln.sup.3+ and Pb.sup.2+ are used in preferred embodiments of this disclosure as an exemplary analyte, it is understood that analytes suitable with this disclosure include, but are not limited to, metal ions including Group IIA metal ions, transition metal ions, and Lanthanide Series ions.

(221) Analytes can also be H.sup.+ or OH.sup. that can bind to the proteins to change the optical properties of the sensors. Binding site refers to any section of a peptide or protein involved in forming bonds with an analyte.

(222) Binding motif is part of a binding site, often in a larger protein. The term binding site may be used interchangeably with the term binding motif and vice versa.

(223) Chemical reactions can include the formation or dissociation of ionic, covalent, or noncovalent structures through known means. Chemical reactions can include changes in environmental conditions such as pH, ionic strength, and temperature.

(224) Conformation is the three-dimensional arrangement of the primary, secondary, and tertiary structures of a molecule, and in some instances the quaternary structure of a molecule, including side groups in the molecule; a change in conformation occurs when the three-dimensional structure of a molecule changes. A conformational change may be a shift from an alpha-helix to a beta-sheet or a shift from a beta-sheet to an alpha-helix.

(225) Detectable changes or responsiveness means any response of a protein to its microenvironment. Such detectable changes or responsiveness may be a small change or shift in the orientation of an amino acid or peptide fragment of the sensor polypeptide as well as, for example, a change in the primary, secondary, or tertiary structure of a polypeptide, and in some instances the quaternary structure of a polypeptide, including changes in protonation, electrical and chemical potential and or conformation.

(226) A measurable difference in any fluorescent properties between the active and inactive states suffices for the utility of the fluorescent protein substrates of the disclosure in assays for activity. A measurable difference can be determined by measuring the amount of any quantitative fluorescent property, e.g., the fluorescence signal at a particular wavelength or the integral of fluorescence over the emission spectrum.

(227) Operatively inserted or linked refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manners. A control sequence operatively linked to a coding sequence is ligated such that expression of the coding sequence is achieved under conditions compatible with the control sequences.

(228) Responsive is intended to encompass any response of a polypeptide or protein to an interaction with an analyte.

(229) Fluorescence lifetime: refers to the lifetime of the fluorophore signal, rather than its intensity. The fluorescence lifetime can be measured using fluorescence-lifetime imaging microscopy (FLIM), which is an imaging technique for producing an image based on the differences in the exponential decay rate of the fluorescence from a fluorescent sample. It can be used as an imaging technique in confocal microscopy, two-photon excitation microscopy, and multiphoton tomography. Measuring fluorescence lifetime has the advantage of minimizing the effect of photon scattering in thick layers of sample.

DESCRIPTION

(230) Analyte sensors, methods for producing and using analyte sensors, methods of detecting and/or measuring analyte activity, detecting pH change, and/or, controlling the concentration of an analyte in a system, are disclosed. Embodiments of the analyte sensors according to the disclosure can provide an accurate and convenient method for characterizing analyte activity, detecting pH change, controlling the concentration of an analyte in a system, and the like, in both in vivo and in vitro environments, in particular in living cell imaging.

(231) Ca.sup.2+ regulates numerous biological processes through spatio-temporal changes in the cytosolic Ca.sup.2+ concentration and subsequent interactions with Ca.sup.2+ binding proteins. The endoplasmic reticulum (ER) serves as an intracellular Ca.sup.2+ store and plays an essential role in cytosolic Ca.sup.2+ homeostasis. There is a strong need to develop Ca.sup.2+ sensors capable of real-time quantitative Ca.sup.2+ measurements in specific subcellular environments without using natural Ca.sup.2+ binding proteins such as calmodulin, which themselves participate as signaling molecules in cells. Strategies are disclosed for creating such sensors by integrating a Ca.sup.2+-binding motif into chromophore sensitive locations in green fluorescence protein. The engineered Ca.sup.2+ sensors exhibit large ratiometric fluorescence and absorbance changes upon Ca.sup.2+ binding with affinities corresponding to the Ca.sup.2+ concentrations found in the ER (K.sub.d values range from 0.4-2 mM). In addition to characterizing the optical and metal binding properties of the newly developed Ca.sup.2+ sensors with various spectroscopic methods, the kinetic properties were also examined using stopped-flow spectrofluorimetry to ensure accurate monitoring of dynamic Ca.sup.2+ changes. The developed Ca.sup.2+ sensor was targeted to the ER of mammalian cell lines to monitor Ca.sup.2+ changes occurring in this compartment in response to stimulation with agonists. It is contemplated that this class of Ca.sup.2+ sensors can be modified further to measure Ca.sup.2+ in other cellular compartments, providing tools to study the contribution of these compartments to cellular Ca.sup.2+ signaling.

(232) An EGFP-based Ca.sup.2+ sensor was successfully created by grafting an EF-hand motif with a continuous Ca.sup.2+ binding site into wild type EGFP as scaffold protein [35]. The generated Ca.sup.2+ sensor (G1) exhibits a dual 510 nm fluorescence intensity ratiometric change accordingly when excited at 398 and 490 nm was monitored to decide the concentration of Ca.sup.2+. Although the dynamic range is relative small (only 10-15% change) in mammalian cell imaging, this work strongly supports the hypothesis that GFP chromophore can be altered by introducing a Ca.sup.2+ induced conformational change. The advantages of Ca.sup.2+ sensors by site-directed mutagenesis are listed as follows: 1) Direct design of a Ca.sup.2+ binding site on the surface of EGFP is supposed to create a bigger dynamic range of the signal change if its distance to chromophore is shorter than the grafting approach. This is because the shortest distance between the surface of GFP to the chromophore is only around 10 while Ca.sup.2+ bound to the grafted EF-hand should crosstalk to the chromophore at more than 30 far away. This new strategy may have a more direct influence on the chromophore. 2) We chose EGFP (S65T mutant of wt.GFP) as the scaffold protein, as it is stable, non-toxic, and exhibits robust optical fluorescence under physiological conditions [36]. The cycle 2 mutations (M153G, V163A) [37] were created in scaffold protein to improve the protein folding efficiency at high temperature, as poor folding will cause not only unqualification of the cell imaging due to low fluorescent intensity, but also the dysfunction of the Ca.sup.2+-binding site. The physiological temperature of mammalian cell is unfavorably high, due to the wtGFP encoded by Aequor Jellyfish inhabitance in the deep cold ocean. 3) Protein with different Ca.sup.2+ binding affinities can be easily developed by alternating the electrostatic potential of the binding sites originated from the local negatively charged coordination ligands, according to the success of CD2-based Ca.sup.2+ binding protein design [38]. 4) The designed GFP-based Ca.sup.2+ sensor can specifically target various cellular organelles or tissues by fusing different signal peptides. 5) It can overcome the limitation of currently reported Ca.sup.2+ sensors based on natural Ca.sup.2+ binding proteins due to the perturbation of Ca.sup.2+ signaling [39]. Furthermore, we propose to conduct nuclear magnetic resonance analysis to explore the mechanism of particular molecules influencing the chromophore environment and the chromophore conformational change. This will provide solid theoretical evidences for the development of GFP-based biosensors detecting diverse molecules.

(233) Rationale of design Ca.sup.2+ binding site on the surface of GFP by site-direct mutagenesis: FIG. 1 shows the designed Ca.sup.2+ sensor in EGFP (7E15.EGFP) based on following considerations: First, this Ca.sup.2+ binding site was designed to mimic that of 7E15 in CD2, formed by five negatively charged residues with their sidechain carboxyl oxygen orientated in a pentagonal bipyrimidal geometry to enabling similar Ca.sup.2+ binding affinity. Second, tolerance of mutation for protein folding was considered to avoid the perturbation of fluorescence intensity. We chose this site according to the published paper, where three bulky aromatic residues were mutated to be positively charged ones around this area to prevent the formation of dimerization. [40] Third, fluorescence sensitivity spots were determined by the chromophore solvent accessibility in particular location, as fluorescence tends to be quenched by exposing the chromophore to solvent. Richmond has reported the Cu.sup.2+ indicator with more than 40% fluorescent quench in response to 10-100 M Cu.sup.2+ by site-directed mutagenesis of residue 204 and 147 [41], which demonstrated the high water accessibility around this area. We applied all five negatively charged residues around this area, in order to weaken the hydrogen bonds between antiparallel beta sheets by sidechain charge repulsion. Fourth, the geological distance between chromophore and calcium binding site are minimized for biggest interaction of Ca.sup.2+ with chromophore. Several residues such as 222 and 203 involved in hydrogen network with chromophore were reported with shortest distance compacted in this region.

(234) Embodiments of the analyte sensors according to the disclosure comprise a fluorescent host polypeptide and a molecular recognition motif that interacts with an analyte (e.g., calcium (or other metal as noted herein) or a flux of calcium in its microenvironment). Upon interaction of an analyte with the molecular recognition motif, the analyte sensor generates an optically-detectable signal (or the optically-detectable signal is altered or the lifetime of the signal is changed) which is produced during exposure to an analyte. The molecular recognition motif is integrated or operatively linked into (within the amino acid sequence) a fluorescent host polypeptide. The interaction of the analyte with the molecular recognition motif produces a detectable change in fluorescence properties (e.g., change of the intensity, or maxima wavelength or the imaging of the absorption, transmitted light, fluorescent excitation or emission change, light scattering, lifetime of the signal, and/or energy transfer of the chromophore and the protein) of the analyte sensor based on the quantity of the analyte.

(235) Using relevant molecular recognition motifs, the analyte sensor can be used to investigate the mechanisms of diseases, track the process of diseases and diagnose some diseases related to analyte activity in vitro, in living cells and in vivo. In addition, a specific signal peptide can also be useful for investigating mechanisms such as their activation or inhibition of diseases related to calcium (or other metals as noted herein) activities in various cellular compartments in real time and in situ, which is useful in biotechnology, cell biology and medicinal chemistry, disease diagnosis and prognosis, calcium inhibitor screening and drug development.

(236) Embodiments of the analyte sensors include an engineered fluorescent host polypeptide having a metal ion binding site comprising a plurality of negatively charged residues, wherein the negatively charged residues comprise a plurality of carboxyl oxygens orientated in a pentagonal bipyrimdal geometry wherein said geometry provides a metallic ion binding site operatively interacting with a chromophore region of the engineered fluorescent host polypeptide such that binding of a metal ion analyte to the molecular recognition motif modulates the emission of a fluorescent signal emitted by the fluorescent host polypeptide, and optionally, the absorbance spectrum of the engineered fluorescent host polypeptide.

(237) Upon interaction of the analyte (e.g., calcium, lead, a lanthanide, and the like) with the analyte binding site, the analyte sensor produces an altered signal relative to the analyte sensor prior to interaction. In this regard, the relative three dimensional position of the chromophore within the fluorescent host polypeptide is altered upon interaction of the analyte with the analyte binding site, where such alteration generates the altered signal.

(238) In other words, the analyte sensors have a folding arrangement in a three-dimensional space that produces a specific signal. The analyte sensor can undergo a local conformational change into another folding arrangement with an alteration of the chromophore microenvironment under the inducement of an analyte (e.g., calcium, lead, or a lanthanide) with the analyte binding site. The conformational change can be detected and measured and compared to the signal generated by the calcium sensor prior to interaction with the analyte.

(239) The advantages of embodiments of the present disclosure can include one or more of the following: (i) embodiments of the present disclosure are capable of monitoring numerous cellular events in living cells or organisms via live cell imaging. Embodiments of the present disclosure can provide continuous and dynamic movies of the cellular event and their responses by the stimuli or drugs. Embodiments of the present disclosure largely overcome the limitations of currently commercial available small molecule dyes, peptide/mimics probes with one snap shot of the analyte action; (ii) embodiments of the present disclosure include single fluorescent proteins that are more easily and better translocated under cellular environment to probe analyte reaction in situ than FRET pairs that used two fluorescent proteins. With the addition of signal peptides, these analyte sensors can be specifically expressed/placed at the cellular environments such as ER, mitochondrial, Golgi or nuclei to monitor cellular event with spatial resolution in addition to temporal resolution. Currently available dye detection methods simply rely on passive diffusion of the probe through the membrane, and permits only short snapshots of calcium actions without the capability of detecting reactions at targeted cellular locations. These probes do not provide continuous dynamic imaging of calcium actions due to limited cellular lifetime and specificity; (iii) embodiments of the present disclosure do not use existing/natural calcium binding proteins to sense metal ions (e.g., calcium, lead, or a lanthanide), thus they have minimized perturbation of cellular network; (iv) embodiments of the present disclosure include single fluorescent protein units that overcome the limitations observed with FRET-based sensors that are prone to fluorescence photobleaching, poor orientation and translocation in the cellular compartments due to their large size; (v) the ratiometric signal change of embodiments of the present disclosure with absorption or excitations at 398 and 490 nm permits quantitative and accurate measurement of the calcium (or other metal as noted herein) action by normalizing the concentration change of the sensors and cellular and instrumental interference of the fluorescence signal; (vi) creating different sensors with different analyte affinities allows for monitoring of cellular response with high accuracy and sensitivity; (vii) the structural motifs used in embodiments of the present disclosure allow the maximal optical responses as well the optimal molecular recognition required for chemical reactions; and (viii) the developed analyte sensors can be expressed in bacterial, mammalian cells, and animals such as mice with good optical properties such as those described herein. The changes in the fluorescent and absorbance properties of the engineered polypeptides of the disclosure inducible by metal ion binding may also be used to detect the removal of the metal ion resulting in a reverse change.

(240) Thus, the systems, sensors, and methods of the present disclosure can be used to detect, measure, quantitate, and image interactions between the analytes with the analyte binding site, in vitro and in vivo. In particular, embodiments of the present disclosure can be used to detect (and visualize) and/or quantitate calcium interactions or events in vitro as well as in cells, tissues, and in vivo. In addition, the systems, sensors, and methods of the present disclosure can be used to detect, measure, quantitate pH change with the analyte binding site, in vitro and in vivo. Furthermore, the systems, sensors, and methods of the present disclosure can be used to control the concentration of an analyte in a system.

(241) The analyte sensors according to the disclosure can include an engineered fluorescent host polypeptide having a metal ion binding site comprising a plurality of negatively charged residues, wherein the negatively charged residues comprise a plurality of carboxyl oxygens orientated in a pentagonal bipyrimdal geometry wherein said geometry provides a metallic ion binding site operatively interacting with a chromophore region of the engineered fluorescent host polypeptide such that binding of a metal ion analyte to the molecular recognition motif modulates the emission of a fluorescent signal emitted by the fluorescent host polypeptide, and optionally, the absorbance spectrum of the engineered fluorescent host polypeptide. In an embodiment, the negatively charged residues are on the surface of three anti-parallel beta-sheets. In an embodiment, the negatively charged residues are spread on three strands of the protein with beta-can structure.

(242) The native signal of the fluorescent protein is altered by the inclusion of the analyte binding site within the amino acid sequence of the fluorescent host polypeptide and the structural motif. In particular, embodiments of the present disclosure provide for insertion positions of the analyte binding site so that the analyte sensor produces emissions at two or more wavelengths. In this regard, the relative three dimensional position of the chromophore within the fluorescent host polypeptide is altered by the inclusion of the analyte binding site and the structural motif, where such alteration generates the altered signal.

(243) Upon interaction of the analyte (e.g., calcium, lead, and/or lanthanide) with the analyte binding site, the analyte sensor produces an altered signal relative to the analyte sensor prior to interaction. In this regard, the relative three dimensional position of the chromophore within the fluorescent host polypeptide is altered upon interaction of the analyte with the analyte binding site, where such alteration generates the altered signal. The ratiometric change of the signal (chromophore signal) after the interaction allows an accurate measurement of the analyte activity (e.g., in vitro and in vivo with normalized sensor concentration). The inclusion of the structure motif allows optimal molecular recognition by incorporating essential structural and chemical properties required for a specific type of analyte. For example, inclusion of the structure motif allows for: solvent accessibility for the easy access of calcium, flexibility required for the recognition, a special geometric pocket for the interaction, a hydrophilic surface or charged environments to facilitate the binding process and a required environment for the fast kinetic rates such as good off rate required for real time measurements.

(244) Design of calcium-binding GFP: The design of calcium binding proteins in green fluorescent protein was carried out using the established design program and the given parameters based on the pentagonal bipyramidal geometry (Biochemistry 44: 8267-8273; J. Am. Chem. Soc. 127: 2085-2093; J. Am. Chem. Soc. 125: 6165-6171). More than 3000 potential calcium binding sites were computationally constructed.

(245) Several criteria were applied to rank and to choose sites: (i) any sites that contained mutations in the central helix (i.e. amino acids 56 to 71) were removed; (ii) sites that replaced buried hydrophobic residues with charged residues were removed to avoid folding disruptions; (iii) sites involving solvent-inaccessible residues, such as Phe8, were eliminated since solvent accessibility is observed for many calcium binding sites. The solvent accessibility was evaluated with the program GetArea; (iv) the mutations in the loop regions with higher flexibility were considered safe without disrupting the protein folding, while sites involving the mutations on the -strands were considered more aggressive; (v) since fewer mutations are less likely to perturb the native protein conformation, predicted sites with more existing residues as ligands are preferred; (vi) the distance from the chromophore was also evaluated for the potential development of calcium sensors. The over packing of protein was examined, and the clash with close residues was avoided. In addition, the sites with three to four negatively charged ligand residues were preferred based on the statistical results for calcium binding proteins; and (vii) to have a potential calcium-induced fluorescence change, chromophore sensitive locations were analyzed based on the dynamic and conformational properties of the fluorescent proteins.

(246) FIG. 14 shows five calcium binding sites (termed GFP.D1, GFP.D2, GFP.D2, GFP.D2, and GFP.D3) located in three different positions in GFP chosen based on the criteria (Table 1). GFP.D1 is located at the end of the barrel in the loop regions. It is expected to have less effect on the EGFP folding and structure due to the flexibility of the loop region. GFP.D2, GFP.D2, and GFP.D2 are located in the loop region on the opposite end of the barrel from GFP.D1. They contain four identical ligand residues and differ by one residue. GFP.D2 has ligands L194E, S86D, S2D, D82, and E5. L194 was mutated to be N in both GFP.D2 and GFP.D2. GFP.D2 contains K85D mutation whereas GFP.D2 and GFP.D2 contains S86D. This alters the sidechain packing and electrostatic interactions in the local environment due to the different size and charge natures of Lys, Glu, Asn, and Ser. GFP.D3 is located in the middle of the barrel, 14 to the chromophore. All ligand residues, including two natural ones and three mutations, are located on the -strands.

(247) Chromophore and conformational properties of designed proteins: Four calcium binding sites were engineered into EGFP, and they exhibit different optical properties. Among all of the bacterial-expressed proteins in E. coli, GFP.D2 is the only one that retains green fluorescence color. As shown in FIGS. 15A and 15B, the bacterial-expressed and purified GFP.D2 and its series and wildtype EGFP exhibit absorption maxima at 490 nm. The excitation at 490 nm results in an emission maximum at 510 nm. In contrast, the rest of the bacterial-expressed proteins GFP.D1 and GFP.D3 are colorless, indicating no chromophore formation in the bacterial-expression system. FIG. 15B shows that the far UV CD spectra of these designed proteins have a negative maximum at 216 nm similar to EGFP, indicating that a dominant 0-sheet structure was not altered after introducing calcium binding ligand residues although the chromophore formation was perturbed.

(248) GFP is originally from jellyfish and it was reported that a eukaryotic expression system can facilitate chromophore formation since eukaryote cells contain machinery to aid in protein folding (J. Mol. Biol. 353: 397-409). FIG. 16 shows that both GFP.D1 and GFP.D2 exhibit fluorescence when expressed in Hela cell. In contrast, GFP.D3 remains colorless when expressed in the mammalian cells, similar to its expression in bacterial system. These results suggest that introducing several charged residues for calcium binding does not affect the folding and structure of the protein but does affect the synthesis and formation of the chromophore, which has less tolerance for environmental modifications.

(249) Metal binding affinities and selectivity of designed GFP variants: Metal binding capabilities for calcium and its analog lanthanide ions of designed GFP variants were examined using four different methods using bacterial expressed and purified proteins. For GFP.D2 with a correct formed chromophore, metal binding affinity was directly determined by monitoring fluorescence signal change as a function of metal concentration. As shown in FIG. 17A, the addition of calcium from 0 to 10 mM results in a gradually decrease of fluorescent signal at 510 nm when excited at 398 nm. The fractional change at 510 nm can be well fitted with the equation forming 1:1 calcium: protein complex. The dissociate constants for calcium is 10713. On the other hand, wildtype EGFP does not have any significantly fluorescence signal change upon addition of the metal ions.

(250) Rhodamine-5N (Molecular Probes), a commercially available calcium binding dye to was used obtain calcium and lanthanide affinity by a dye competition assay. As shown in FIG. 17B, Rodmine-5N shows a large fluorescence signal increase when calcium is bound in GFP.D1. In the dye competition assay, the solutions with constant dye and protein concentration were titrated with calcium until saturation was observed (FIG. 17B insertion). The binding affinities for the designed proteins were obtained by globally fitting the spectra with the metal-and-two-ligand model. As shown in Table 1, the calcium binding affinities of GFP.D2 obtained by directly measurement of fluorescence signal change are in agreement with that obtained by dye the competition method.

(251) TABLE-US-00001 TABLE 1 Design sites engineered into Green Fluorescent Protein. Aver- Average Charge age distance of a.a. distance Calcium- to Chro- in binding Tb(III) Ca(II) Design binding mophore binding site- K.sub.d K.sub.d Site Ligands () site Trp(A) (M) (M) GFP.DI Q177N, 22 3 17 1.9 60 1171D, 0.4 5 D173, S1750, N135 GFP.D2 E5, D82, 15 5 29 N/A 107 S2D, S86D, 13 L194E GFP.D2 E5, D82, 15 4 29 32 96 K79D, 13 7 L194N, K85D GFP.D2 E5, 082, 15 4 30 2.9 38 K79D, 0.3 5 L194N, S86D GFPD3 E115, 14 4 15 4.9 57 V120N, 0.2 2 R122D, K113D

(252) For 120, 177, and 194 the terbium affinities were measured in a 20 mM PIPES, 10 mM KCl, 1 mM DTT, 1% glycerol, pH 6.8. For 194, the terbium affinity was measured in 10 mM Tris, 1 mM DTT, 1% glycerol, pH 7.4. The calcium affinities for all four sites were measured in 10 mM Tris, 1 mM DTT, 1% glycerol, pH 7.4.

(253) Calcium binding dye competition was then used to obtain calcium binding affinities for these bacteria expressed proteins GFP.D1, GFP. D2, GFP.D2 and GFP.D2 and GFP.D3. Their calcium-binding affinities are 605, 572, 967 and 385 M, respectively.

(254) To further characterize the metal binding of the designed proteins, terbium sensitized fluorescence resonance energy transfer was used. Terbium, a calcium analog with similar ionic size and binding geometry, is intrinsically fluorescent at 545 nm and able to accept energy transferred from aromatic residues. EGFP contains 1 Trp and 10 Tyr, and the Trp is within 30 of GFP.D1 and GFP.D2 and 17 of GFP.D3 and GFP.D4 (Table 1). As shown in FIG. 17C, the addition of terbium into the protein results in a large increase in terbium-FRET signal at 545 nm with excitation at 280 nm. The enhancement as a function of terbium concentration with the assumption of a 1:1 metal:protein complex provided the binding affinities (Table 1). Of the three proteins tested at pH 7.4, GFP.D1 has the strongest terbium affinity (1.90.4 M). GFP.D2 has a slightly weaker affinity of 4.90.2 M while GFP.Ca2 exhibits a 15-foldweaker affinity of 3213 M. At pH 6.8, GFP.D2 exhibits a binding affinity for terbium of 2.90.3 M. The addition of calcium and lanthanum into the terbium-protein complex significantly reduced the fluorescence enhancement of terbium due to competition.

(255) As shown in FIG. 17D, addition of 1 mM calcium resulted in a large decrease in terbium fluorescence for GFP.D1, suggesting that calcium binds to the protein and competes for terbium binding. Addition of 100 M lanthanum resulted in a fluorescence decrease to half, suggesting an estimated 5-fold lower metal binding affinity (about 10 M). On the other hand, addition of higher concentrations of magnesium (10 mM) resulted in a relatively smaller decrease, indicating a relatively weaker binding affinity. Similarly, GFP.D2 exhibits a half maximal decrease in fluorescence with 1 mM calcium or 100 M lanthanum, which is also more effective than magnesium. Taken together, calcium and lanthanides bind to the protein in the same pocket and have a greater than 20-fold selectivity over magnesium. The calcium binding sites of the present disclosure have calcium binding affinities with K.sub.d in the range of 38-96 M. The metal selectivity is also sufficient for the proteins to bind calcium without interference from magnesium in the extracellular environment or in the ER where calcium concentration is much higher than in the cytosol.

(256) Embodiments of the present disclosure provide for analyte sensors including a molecular recognition motif that binds an analyte (e.g., calcium, lead, and/or lanthanide) and a fluorescent host polypeptide in which the molecular recognition motif is operatively linked to or integrated therein. Interaction of the analyte with the molecular recognition motif produces a detectable change. Table 2 lists some embodiments of the analyte sensors, the corresponding SEQ ID NO, and characteristics of the particular analyte sensor, while other analyte sensors are described in SEQ ID. Nos. 115-159. Although SEQ ID NOS. 1-99, and 104-105 and 115-159 includes specific order of amino acids, each of the groups (e.g., molecular recognition motif, fluorescent host polypeptide, and the like) could be positioned differently as long as the analyte sensor produces results consistent with the embodiments disclosed herein.

(257) TABLE-US-00002 TABLE 2 SEQ Amino acid ID Designator positions of Amino acid No. (Alternatives) EGFP positions Correspond to 1 EGFP-III-172 1-173, 186-256 174-185 III. (Ca-G1) 2 EGFP-E-III-172 1-173, 197-262 174-196 E-III. 3 EGFP-III-F-172 1-173, 194-259 174-193 III-F. 4 EGFP-E-III-F-172 1-173, 205-270 174-204 E-III-F (Ca-G1, EGFP-G1) 5 EGFP-E-III-F-172-ER 25-197, 229-294 198-228 E-III-F (Ca-G1-ER) 6 EGFP-E-III-F-172-mito 36-213, 245-310 214-244 E-III-F 7 EGFP-E-III-F-172-SKEAA 1-173, 206-271 174-205 E-III-F 8 EGFP-E-III-F-172-D/N 1-173, 205-270 174-204 E-III-F 9 EGFP-E-III-F-172-DD/NN 1-173, 205-270 174-204 E-III-F 10 EGFP-E-III-F-172-L194N 1-173, 205-270 174-204 E-III-F 11 EGFP-I-172 1-173, 186-251 174-185 I 12 EGFP--Lac1-172 1-173, 206-271 174-205 -Lac1 13 EGFP--Lac2-172 1-173, 206-271 174-205 -Lac2 14 EGFP--Lac3-172 1-173, 206-271 174-205 -Lac3 15 EGFP--Lac4-172 1-173, 206-271 174-205 -Lac4 16 EGFP-III-172-C2 1-173, 186-256 174-185 III 17 EGFP-E-III-172-C2 1-173, 197-262 174-196 E-III 18 EGFP-III-F-172-C2 1-173, 194-259 174-193 III-F 19 EGFP-E-III-F-172-C2 1-173, 205-270 174-204 E-III-F (Ca-G1-37, EGFP-G1-C2) 20 EGFP-E-III-F-172-ER-C2 25-197, 229-294 198-228 E-III-F 21 EGFP-E-III-F-172-mito-C2 36-213, 245-310 214-244 E-III-F 22 EGFP-E-III-F-172-SKEAA-C2 1-173, 206-271 174-205 E-III-F 23 EGFP-E-III-F-172-D/N-C2 1-173, 205-270 174-204 E-III-F 24 EGFP-E-III-F-172-DD/NN-C2 1-173, 205-270 174-204 E-III-F 25 EGFP-E-III-F-172-L194N-C2 1-173, 205-270 174-204 E-III-F 26 EGFP-I-172-C2 1-173, 186-251 174-185 I 27 EGFP--Lac1-172-C2 1-173, 206-271 174-205 -Lac1 28 EGFP--Lac2-172-C2 1-173, 206-271 174-205 -Lac2 29 EGFP--Lac3-172-C2 1-173, 206-271 174-205 -Lac3 30 EGFP--Lac4-172-C2 1-173, 206-271 174-205 -Lac4 31 EGFP-III-172-C3 1-173, 186-256 174-185 III 32 EGFP-E-III-172-C3 1-173, 197-262 174-196 E-III 33 EGFP-III-F-172-C3 1-173, 194-259 174-193 III-F 34 EGFP-E-III-F-172-C3 1-173, 205-270 174-204 E-III-F (EGFP-G1-C3) 35 EGFP-E-III-F-172-ER-C3 25-197, 229-294 198-228 E-III-F 36 EGFP-E-III-F-172-mito-C3 36-213, 245-310 214-244 E-III-F 37 EGFP-E-III-F-172-SKEAA-C3 1-173, 206-271 174-205 E-III-F 38 EGFP-E-III-F-172-D/N-C3 1-173, 205-270 174-204 E-III-F 39 EGFP-E-III-F-172-DD/NN-C3 1-173, 205-270 174-204 E-III-F 40 EGFP-E-III-F-172-L194N-C3 1-173, 205-270 174-204 E-III-F 41 EGFP-I-172-C3 1-173, 186-251 174-185 I 42 EGFP--Lac1-172-C3 1-173, 206-271 174-205 -Lac1 43 EGFP--Lac2-172-C3 1-173, 206-271 174-205 -Lac2 44 EGFP--Lac3-172-C3 1-173, 206-271 174-205 -Lac3 45 EGFP--Lac4-172-C3 1-173, 206-271 174-205 -Lac4 46 EGFP-III-157 1-158, 171-251 159-170 III (Ca-G2) 47 EGFP-E-III-F-157 1-158, 190-270 159-189 E-III-F (Ca-G2) 48 EGFP-III-157-C2 1-158, 171-251 159-170 III 49 EGFP-E-III-F-157-C2 1-158, 190-270 159-189 E-III-F 50 EGFP-III-157-C3 1-158, 171-251 159-170 III 51 EGFP-E-III-F-157-C3 1-158, 190-270 159-189 E-III-F 52 EGFP-E-III-F-170 1-171, 203-270 172-202 E-III-F 53 EGFP-E-I-F-170 1-171, 206-273 172-205 E-I-F 54 EGFP-E-III-F-170-C2 1-171, 203-270 172-202 E-III-F 55 EGFP-E-I-F-170-C2 1-171, 206-273 172-205 E-I-F 56 EGFP-E-III-F-170-C3 1-171, 203-270 172-202 E-III-F 57 EGFP-E-I-F-170-C3 1-171, 206-273 172-205 E-I-F 58 EGFP-120 1-239 16, 114, 116, Ca.sup.2+ binding site (GFP-D3) 121, 123 59 EGFP-120b 1-239 16, 112, 116, Ca.sup.2+ binding site 121, 123 60 EGFP-177 1-239 136, 172, 174, Ca.sup.2+ binding site (GFP-D1) 176, 178 61 EGFP-194a 1-239 6, 80, 83, 86, Ca.sup.2+ binding site (GFP-D2) 195 62 EGFP-194b 1-239 6, 80, 83, 87, Ca.sup.2+ binding site (GFP-D2) 195 63 EGFP-229 1-239 79, 82, 198, 200, Ca.sup.2+ binding site 230 64 EGFP-site1 1-239 3, 6, 83, 87, 195 Ca.sup.2+ binding site (GFP-D2) 65 EGFP-site1-ER 25-263 27, 30, 107, 111, Ca.sup.2+ binding site 219 66 EGFP-site1-mito 36-274 38, 41, 118, 122, Ca.sup.2+ binding site 230 67 EGFP-site2 1-239 16, 18, 116, 121, Ca.sup.2+ binding site 123 68 EGFP-site3 1-239 84, 153, 155, Ca.sup.2+ binding site 162, 195 69 EGFP-site4 1-239 60, 101, 137, Ca.sup.2+ binding site 142, 178 70 EGFP-site5 1-239 8, 13, 89, 115, Ca.sup.2+ binding site 120 71 EGFP-site6 1-239 8, 13, 89, 115, Ca.sup.2+ binding site 120 72 EGFP-120-C2 1-239 16, 114, 116, Ca.sup.2+ binding site 121, 123 73 EGFP-120b-C2 1-239 16, 112, 116, Ca.sup.2+ binding site 121, 123 74 EGFP-177-C2 1-239 136, 172, 174, Ca.sup.2+ binding site 176, 178 75 EGFP-194a-C2 1-239 6, 80, 83, 86, Ca.sup.2+ binding site 195 76 EGFP-194b-C2 1-239 6, 80, 83, 87, Ca.sup.2+ binding site 195 77 EGFP-229-C2 1-239 79, 82, 198, 200, Ca.sup.2+ binding site 230 78 EGFP-site1-C2 1-239 3, 6, 83, 87, 195 Ca.sup.2+ binding site 79 EGFP-site1-ER-C2 25-263 27, 30, 107, 111, Ca.sup.2+ binding site 219 80 EGFP-site1-mito-C2 36-274 38, 41, 118, 122, Ca.sup.2+ binding site 230 81 EGFP-site2-C2 1-239 16, 18, 116, 121, Ca.sup.2+ binding site 123 82 EGFP-site3-C2 1-239 84, 153, 155, Ca.sup.2+ binding site 162, 195 83 EGFP-site4-C2 1-239 60, 101, 137, Ca.sup.2+ binding site 142, 178 84 EGFP-site5-C2 1-239 8, 13, 89, 115, Ca.sup.2+ binding site 120 85 EGFP-site6-C2 1-239 8, 13, 89, 115, Ca.sup.2+ binding site 120 86 EGFP-120-C3 1-239 16, 114, 116, Ca.sup.2+ binding site 121, 123 87 EGFP-120b-C3 1-239 16, 112, 116, Ca.sup.2+ binding site 121, 123 88 EGFP-177-C3 1-239 136, 172, 174, Ca.sup.2+ binding site 176, 178 89 EGFP-194a-C3 1-239 6, 80, 83, 86, Ca.sup.2+ binding site 195 90 EGFP-194b-C3 1-239 6, 80, 83, 87, Ca.sup.2+ binding site 195 91 EGFP-229-C3 1-239 79, 82, 198, 200, Ca.sup.2+ binding site 230 92 EGFP-site1-C3 1-239 3, 6, 83, 87, 195 Ca.sup.2+ binding site 93 EGFP-site1-ER-C3 25-263 27, 30, 107, 111, Ca.sup.2+ binding site 219 94 EGFP-site1-mito-C3 36-274 38, 41, 118, 122, Ca.sup.2+ binding site 230 95 EGFP-site2-C3 1-239 16, 18, 116, 121, Ca.sup.2+ binding site 123 96 EGFP-site3-C3 1-239 84, 153, 155, Ca.sup.2+ binding site 162, 195 97 EGFP-site4-C3 1-239 60, 101, 137, Ca.sup.2+ binding site 142, 178 98 EGFP-site5-C3 1-239 8, 13, 89, 115, Ca.sup.2+ binding site 120 99 EGFP-site6-C3 1-239 8, 13, 89, 115, Ca.sup.2+ binding site 120

(258) SEQ ID. No. 105 corresponds to the CaratER sensor. Residues for the ER targeting sequence from calreticulin signal peptide is attached to the N-terminal and the ER retention sequence is attached to the C-terminal. SEQ ID. No.: 105 includes mutations for the new binding site and the ER targeting and retention sequences at the N and C termini, respectively. Additional sequences of the sensor are described in SEQ ID. No. 115 to 159.

(259) The fluorescent host polypeptide can have the molecular recognition motif inserted or integrated into the fluorescent host polypeptide at one of a number of locations, where each different insertion point provides an analyte sensor with different characteristics. For example, when the fluorescent host polypeptide is an enhanced fluorescent protein (EGFP), the molecular recognition motif can be inserted into the positions 152, 172, or 170.

(260) It should also be noted that the fluorescent host polypeptide can be modified to enhance the thermal stability and/or the fluorescent properties of the analyte sensor by including two or three mutations to the fluorescent host polypeptide. In particular, the EGFP can include two mutations (M153T, V163A) and/or three mutations (F99S, M153T, V163A), which increase thermal stability and or fluorescence properties, as described herein. These mutations are noted in SEQ ID Nos.: 16 to 45, SEQ ID Nos.: 48 to 51, SEQ ID Nos.: 54 to 57, and SEQ ID Nos.: 72 to 99, respectively. Additional details and the examples that describe specific embodiments of the present disclosure are provided below.

(261) Based on the fluorescence properties of the analyte sensor, a DNA construct of the analyte sensor may be inserted into a recombinant vector or any suitable vectors that may conveniently be subjected to recombinant DNA procedures. The specific vector can depend on the type of host cells. For example, recombinant DNA plasmid vectors, which can exist as an extrachromosomal entity, may be a suitable vector. Alternatively, the vector may be one that, when introduced into a host cell, is integrated into the host cell genome and replicates together with the chromosome(s) into which it has been integrated. Once the analyte sensor has been constructed, vectors comprising the fluorescent nucleic acid molecules may be formulated into a variety of compositions, such as solutions (for example, buffer solutions) to be used in transfecting host cells.

(262) A fluorescent host polypeptide or variant thereof can be linked to the molecule directly or indirectly, using any linkage that is stable under the conditions to which the protein-molecule complex is to be exposed. Thus, the fluorescent host polypeptide and molecule can be linked via a chemical reaction between reactive groups present on the protein and molecule, or the linkage can be mediated by a linker moiety, which contains reactive groups specific for the fluorescent host polypeptide and the molecule. It will be recognized that the appropriate conditions for linking the fluorescent host polypeptide variant and the molecule are selected depending, for example, on the chemical nature of the molecule and the type of linkage desired. Where the molecule of interest is a polypeptide, a convenient means for linking a fluorescent host polypeptide variant and the molecule is by expressing them as a fusion protein from a recombinant nucleic acid molecule, which includes a polynucleotide encoding, for example, a fluorescent host polypeptide operatively linked to a polynucleotide encoding the polypeptide molecule.

(263) An embodiment of the analyte sensor may be produced as chimeric proteins by recombinant DNA technology. Recombinant production of proteins including fluorescent host polypeptides involves expressing nucleic acids having sequences that encode the proteins. Nucleic acids encoding fluorescent host polypeptides can be obtained by methods known in the art. For example, a nucleic acid encoding the protein can be isolated by a polymerase chain reaction of DNA from A. victoria using primers based on the DNA sequence of A. victoria GFP. Mutant versions of fluorescent host polypeptides can be made by site-specific mutagenesis of other nucleic acids encoding fluorescent proteins, or by random mutagenesis caused by increasing the error rate of PCR of the original polynucleotide with 0.1 mM MnCl.sub.2 and unbalanced nucleotide concentrations.

(264) The molecular recognition motif can include the analyte binding site, one or more structural motif, and a targeting motif. The analyte binding site and the structural can include those described above. The targeting motif can target organelles and sub-organelles such as, but not limited to, ER, mitochondrion, Golgi, nucleus, channels, gap junctions, and extracellular spaces. The targeting motif includes, but is not limited to, signal peptides encoded in the proteins located in the target organelles. The targeting motif includes those listed in SEQ ID Nos.: 5-6, 20-21, 35-36, 65-66, 79-80, 93-94, where the specific amino acid sequences are noted above. As mentioned above, the motifs can be positioned differently than described herein as long as they have characteristics that are consistent with the embodiments disclosed. Additional details and the examples that describe specific embodiments of the present disclosure are provided below.

(265) The present disclosure provides for analyte sensors that comprise a molecular recognition motif that binds a metal ion analyte (e.g., calcium, lead, and/or lanthanide) and a fluorescent host polypeptide in which the molecular recognition motif is operatively linked to or integrated therein. Interaction of the analyte with the molecular recognition motif produces a detectable change. The analyte sensor has a protein sequence that includes the molecular recognition motif and the fluorescent host polypeptide selected from: SEQ ID Nos.: 5, 6, 20, 21, 35, 36, 80, 81, 94, and 95.

(266) An embodiment of the analyte sensor has at least one characteristic selected from the following: is stable at temperatures greater than about 30 C.; has enhanced fluorescent and optical properties (resulting, for example from mutations of the fluorescent protein (e.g., F99S, M153T and V163A)), and combinations thereof. In particular, embodiments of the analyte sensors (denoted as C2 or C3 variants) (SEQ ID NOS.: 16-45, 48-51, 54-57, and 72-99) are able to maintain fluorescence in both mammalian and bacterial cells. Each of the embodiments described herein are able to bind calcium and other metal ions (including but not limited to, Pb.sup.2+, Tb.sup.3+, La.sup.3+, and Gd.sup.3+).

(267) An embodiment of the analyte sensor of the disclosure can be generated by first constructing a molecular recognition motif that includes the analyte binding site that is capable of responding to a metal ion analyte and then operatively inserting the molecular recognition motif into a fluorescent host polypeptide. Molecular recognition motifs typically have a primary structure, a secondary structure, and a tertiary structure in most cases and in some cases a quaternary structure, at least one of which can be tailored to the analyte sensor to achieve a desired level of analyte sensitivity. That is, each of the primary structure, the secondary structure, the tertiary structure, and if present, the quaternary structure can be tailored to the analyte sensor independently or in combination with one or more others of the structures to achieve a desired level of sensitivity for the sensor relative to the analyte. For example, the binding of the analyte to the molecular recognition motif preferably produces a change in a detectable signal (fluorescence, for example) and the manipulation of the molecular recognition motif manipulates the responsiveness of the sensor.

(268) An embodiment of the analyte sensor also can allow the quantification of an analyte due to a molecular recognition motif able to produce a detectable change upon excitation, expressing the protein, providing excitement to the analyte sensor, and then quantifying the detectable change. Preferably, the protein can include a fluorescent host polypeptide, whose emission intensity is relative to the quantity of analyte in a microenvironment.

(269) One method for creating a molecular recognition motif is through the use of an integrating method. The integration method focuses on engineering and constructing a molecular recognition motif by modifying the primary, secondary, tertiary, and/or quaternary structure of an identified binding site.

(270) An illustrative method for constructing a molecular recognition motif using the integration method includes first identifying an analyte binding peptide that binds an analyte with specificity and then ascertaining at least a portion of a nucleic acid sequence encoding the analyte binding peptide. Once this is accomplished, the nucleic acid sequence encoding the analyte binding peptide is tailored into a molecular recognition motif that includes an analyte binding site. After the tailoring is completed, a fluorescent host polypeptide is selected and a relevant portion of the nucleic acid sequence of the fluorescent host polypeptide is identified, and the tailored nucleic acid sequence encoding the analyte binding peptide is operatively linked with the fluorescent host polypeptide nucleic acid sequence into a molecular recognition motif sequence. Finally, the molecular recognition motif sequence is expressed. In this method, the nucleic acid sequence encoding the analyte binding peptide is tailored so as to achieve the molecular recognition motif with a desired specificity for the analyte. Preferably, the nucleic acid sequence encoding the analyte binding peptide is tailored to have specificity for the analyte over other analytes. Resultant proteins encoded by the molecular recognition motif sequence are useful products of this disclosure.

(271) The primary structure of an analyte binding site can be selectively modified by inserting at least one codon into the nucleic acid sequence encoding the analyte binding peptide. Similarly, codons for charged amino acids can be inserted into the nucleic acid sequence encoding the analyte binding peptide. The analyte binding site can also be modified by selectively manipulating and adding helices, loops, bridges or linkers, among other methods. Charged amino acids can be inserted into the amino acid sequence encoding the analyte binding peptide and or aromatic amino acids can be introduced into the amino acid sequence encoding the analyte binding peptide.

(272) Another method for generating a desired molecular recognition motif is through the use of a computational approach in which a computational method for engineering and constructing a molecular recognition motif de novo is based on optimal binding characteristics of an analyte with other moieties. In one illustrative embodiment, using established criteria for evaluating Ca.sup.2+ binding data, a Ca.sup.2+ binding site of desired sensitivity may be constructed by molecular modeling. For example, such computation algorithms may be used to develop desired ion binding motifs based on parameters such as the metal's binding geometry, the folding of the host protein, the location of the charges on the fluorescent protein, the particular chromophores, and other criteria specific to the Ca.sup.2+ binding data.

(273) The computational approach can be used to construct a molecular recognition motif by accessing public and or private databases that include structural data on analyte binding sites, generating at least one preliminary analyte binding site from the structural data based on certain previously selected criteria, selecting one or more suitable analyte binding sites from the preliminary analyte binding sites, and constructing the analyte binding motif by tailoring the selected analyte binding site and operatively linking it with a host protein, keeping in mind that the molecular recognition motif preferably has a specificity for a selected analyte. The structural data typically can include amino acid sequences, secondary structures, nucleic acid sequences, geometric parameters, electrostatic properties, and coordination properties of the analyte binding sites, such as in protein and gene banks.

(274) The computational approach can be performed on or by a system including at least one database that comprises the structural data on analyte binding sites, an algorithm for generating the preliminary analyte binding sites from portions of the structural data using selected criteria relevant to the molecular recognition motif and rating the preliminary analyte binding sites based on specificity for a selected analyte, and a computer for executing the algorithm so as to query the databases to generate the preliminary analyte binding sites. The algorithm generally is a relatively simple searching algorithm that will query the databases based on inputted criteria.

(275) Once the molecular recognition motif has been tailored and operatively linked into the fluorescent host polypeptide, the analyte sensor may show responsiveness to analyte dependent fluorescence variations. The responsiveness of the analyte sensor is caused by the interaction of the fluorescent host polypeptide with the molecular recognition motif, which then may display fluorescence properties proportional to the analyte concentration or flux. In particular, the responsiveness is thought to be caused by changes in the orientation and protonation of the chromophore of the fluorescent protein. The interaction between the analyte and the fluorescent host polypeptide may result in a shift in the emission spectra, quantum yield, and/or extinction coefficient, which may be quantitatively analyzed in real-time to probe the microenvironment.

(276) In use and application, an embodiment of the analyte sensor may be used to detect and quantify the analyte concentration and flux thereof in a sample as a non-ratiometric dye. More particularly, the analyte sensor is inserted into the sample, the sample then is excited by radiation, the fluorescence from the sample then is measured using an optical device, and the fluorescence or flux thereof then is analyzed to quantify or detect the analyte concentration in the sample. In order to analyze the sample, it may be necessary to generate a standard curve based on the fluorescence generated from known analyte concentrations. Specifically, the fluorescence signal of the analyte sensor is compared to the fluorescence of the standard curve so as to determine the concentration of analyte in the sample.

(277) Fluorescent host polypeptides: The analyte sensors according to the disclosure may comprise a fluorescent host polypeptide or polypeptide (also referred to as optically active fluorescent host polypeptide or optically active fluorescent protein). The native signal of the fluorescent protein is altered by the inclusion of the analyte binding site within the amino acid sequence of the fluorescent host polypeptide. Embodiments of the present disclosure provide for specific insertion positions of the analyte binding site within the fluorescent host polypeptide so that the analyte sensor produces an emission that is altered upon interaction of the analyte with the analyte binding site. In this regard, the relative three dimensional position of the chromophore within the fluorescent host polypeptide is altered by the inclusion of the analyte binding site, where such alteration generates the altered signal. In an embodiment, the analyte sensors can emit at two or more distinguishable wavelengths.

(278) Fluorescent host polypeptides suitable for use in the analyte sensors of the disclosure include, but are not limited to, Green Fluorescent Protein isolated from Aequorea victoria (GFP), as well as a number of GFP variants, such as enhanced fluorescent protein (EGFP). In particular, Aequorea green fluorescent protein (GFPs) and its enhanced fluorescent proteins have about 238 amino acid residues in a single polypeptide chain. The native molecule has been shown to regenerate its intrinsic fluorescence from the totally denatured state. GFPs display a strong visible absorbance and fluorescence that is thought to be generated by the autocyclization and oxidation of the chromophore having a tripeptide Ser-Tyr-Gly sequence at positions 65 to 67 of the 238 amino acid sequence. Mutations to GFPs have resulted in various shifts in absorbance and fluorescence. The usefulness of GFPs stems from fluorescence from GFP not requiring additional cofactors; the fluorophore is self-assembling via a cyclization reaction of the peptide backbone.

(279) The chromophore of GFP is formed by the cyclization of the tripeptide Ser65-Tyr66-Gly67. This chromophore is located inside of the 3-barrel that is composed of 11 anti-parallel strands and a single central -helix. There are short helices capping the ends of the -barrel. The chromophore has extensive hydrogen bonding with the protein frame and can be affected by water molecules under the different folding states. The chromophore in a tightly constructed -barrel that exhibits absorption peaks at 400 and 480 nm and an emission peak at 510 nm with a quantum yield of about 0.72 when excited at 470 nm. The chromophore in enhanced green fluorescent protein (EGFP), which is GFP with a mutation S65T, has an improved fluorescence intensity and thermo-sensitivity.

(280) Two (M153T, V163A) or three additional mutations (F99S, M153T, V163A) were added to EGFP to increase the protein expression, stability, chromophore formation at 37 C., or above.

(281) A linker comprising specific analyte binding sites can be grafted between the position 170, 172, and 157, as shown in SEQ ID Nos.: 1-58, as shown in Table 2, for example.

(282) An embodiment of the analyte binding sites can be created by mutation in the fluorescent proteins to form a proper binding pocket without using amino acids from a contiguous stretch of the sequence. All of the sequences shown in SEQ ID Nos.: 59-99, as shown in Table 2, for example.

(283) Analyte Binding Site: The analyte sensor according to the disclosure can have a molecular recognition motif that includes an analyte binding site. The native signal of the fluorescent protein can be altered by integration of the analyte binding site within the amino acid sequence of the fluorescent host polypeptide. The relative three dimensional position of the chromophore within the fluorescent host polypeptide may be altered by the inclusion of the analyte binding site, where such alteration generates the altered signal. This signal change in the sensors can results in a ratiometric change i.e. an increase, a decreases, or increases at one wavelength and an opposite change at another wavelength at both absorption and/or fluorescence excitations.

(284) An embodiment of the analyte binding site functions by interacting with a metal ion analyte, such interaction causing the analyte sensor to produce an altered signal relative to the analyte sensor prior to interaction. The relative three-dimensional position of the chromophore within the fluorescent host polypeptide can be altered upon interaction of the analyte with the analyte binding site, where such alteration generates the altered signal.

(285) The analyte binding site can include, but is not limited to, a binding site where the analyte binds to the analyte sensor. The binding site can be a location where the analyte binds to the analyte sensor. Usually specific types of amino acids in specific sequential or a particular spatial arrangement may be used for a specific type of analyte. Depending on the reaction and the nature of the binding and relative alteration of the chromophore, the binding of the analyte can cause an alteration in the analyte sensor signal. However, the cleavage reaction will cause large changes of the sensor signal. This can be due to the alteration of the local environment of the three dimensional position of the chromophore within the fluorescent host polypeptide which results in alteration of the signal. Such alteration can be due to the perturbation of the hydrogen network, the dynamic properties, the solvent accessibility or chemical properties such as hydrophobic and electrostatic interaction.

(286) An embodiment of the site within the fluorescent host polypeptide for inserting the analyte binding site cleavage site preferably may be selected so that the location is accessible by a metal ion analyte. In addition, the location within the fluorescent host polypeptide can be selected so that the location does not substantially reduce the fluorescence from the fluorescent host polypeptide and so that the locations do not substantially denature or alter the protein folding of the fluorescent host polypeptide or chromophore. Furthermore, the site within the fluorescent host polypeptide for inserting the analyte binding site cleavage site can be selected based on one or more of the following criteria: maximization of solvent accessibility to allow efficient enzymatic action, maximization of fluorescent/optical signals once the analyte binding site is operatively incorporated into the fluorescent host polypeptide; minimization of the disruption to the chromophore environment after interaction of the analyte binding site with the analyte; minimizing the effects on the protein folding and packing of the fluorescent host polypeptide; and maximization of the ratiometric change of chromophore signal due to interaction of the analyte binding site with the analyte so to allow an accurate measurement of the analyte activity in vitro or in vivo. It should be noted that the analyte binding site can be include within or between motifs of the fluorescent host polypeptide, such as within or between a secondary structure motif, a tertiary structure motif, or a quaternary structure motif. In particular, the analyte binding site can be inserted in the loop of the 3-barrel, and between loops.

(287) Structure motifs: The inclusion of a structure motif in the molecular recognition motif allows optimal molecular recognition by incorporating essential structural and chemical properties required for a specific type of analyte. For example, good solvent accessibility for easier access by analytes, good flexibility required for recognition, a special geometric pocket for the interaction, a hydrophilic surface or charged environment to facilitate the binding process and a required environment for the fast kinetic rates such as good off rate required for real time measurements.

(288) For example, but not intended to be limiting, for solvent accessibility and flexibility such as a helix-loop-helix or partial motif can be useful. These helix-loop-helix motifs can be from EF-hand motifs from calcium binding proteins such as calmodulin or troponic c, S100, or from nucleic binding motifs, and the like. Additionally, other structural motifs such as beta-loop-beta or beta-loop-helix, or coiled structures or domains and fragments that contain the cleavage sequence, and which are located at a sensitive location relative to the chromophore with the capability to alter the chromophore environment, can be used in embodiments of the present disclosure, as listed, for example in Table 2.

(289) Targeting Motif: A target motif may have an affinity for a target such as a cell, a tissue, a small molecule, a protein, an organelle, a suborganelle, and the like related to a normal or pathological condition, biological or physiological event of the sample or host. The targeting motif can have an affinity for one or more targets. The targeting motif can be specific or non-specific.

(290) The non-specific targeting moiety can be selected to do one or more of the following: enter a cell or a cell type, enter the vasculature, enter an extracellular space, enter an intracellular space, have an affinity for a cell surface, diffuse through a cell membrane, react with a non-specified moiety on the cell membrane, enter tumors due to leaky vasculature, and the like. The non-specific targeting moiety can include a chemical, biochemical, or biological entity that facilitates the uptake of the probe into a cell. The non-specific targeting moiety can include, but is not limited to, cell penetrating peptides, polyamino acid chains, small molecules, and peptide mimics.

(291) The purified proteins of the disclosure can also be directly injected into the cells or cellular space to measure the analyte concentration. Sensor proteins selected from the SEQ ID Nos. 1-99, 104-105 and 115-159 can be also used to measure analyte changes in vitro such as in solution. The purified proteins can also function as a buffer or chelator to control the concentration of the analyte in vitro and in vivo.

(292) Methods of Use: It is contemplated that the analyte sensors of the disclosure can be used in vivo and/or in vitro. The analyte sensors or systems of the disclosure can be introduced into a cell or host, the analyte sensors or systems can be expressed in the system, and/or the analyte sensors or systems can be included in a transgenic animal or plant. The analyte sensor can include a specific signal peptide for the delivery of the analyte sensor to different subcellular compartments such as cytosol, nucleus, mitochondrial matrix, endoplasmic reticulum, Golgi and peroxisome, and the like.

(293) Embodiments of the present disclosure provide for methods of detecting and measuring a metal ion analyte. The methods can include: introducing an analyte sensor into a system; allowing the analyte sensor to interact with the analyte of interest, which can interact with the analyte binding site of the analyte sensor; and detecting or measuring the fluorescent properties or changes derived from the fluorophore. As the change in fluorescent activity of the analyte sensor is a proxy for the activity of the analyte of interest, this method provides a means for studying and evaluating analyte activity.

(294) Embodiments of the method of the disclosure can include: introducing a plasmid encoding the analyte sensor into a host cell by standard gene transfer methods; expressing the analyte sensor in the host cell; allowing the analyte sensor to interact with the analyte of interest, which can interact with the analyte binding site of the analyte sensor, and thereby detect or measure a fluorescent signal or changes. As the change in fluorescent activity of the analyte sensor is a proxy for the activity of the analyte of interest, this method provides a means for studying and evaluating analyte activity.

(295) The methods can include: introducing an analyte sensor into a system; allowing the analyte sensor to interact with a metal ion analyte which can interact with the analyte binding site of the analyte sensor; and detecting or measuring the fluorescent properties or changes, which can be correlated to a pH change.

(296) Embodiments of the present disclosure can further provide for methods of controlling the concentration of one or more metal ion analytes. In an embodiment, the methods can include: introducing an analyte sensor into a system; allowing the analyte sensor to interact with the analyte, which can interact with the analyte binding site of the analyte sensor. The bonding of the analyte with the analyte controls the amount of analyte in the cell or host.

(297) Samples useful with this disclosure include biological samples, environmental samples, or any other samples for which it is desired to determine whether a particular molecule is present therein. The sample can be, but is not limited to, a living cell or a cell extract, which may be obtained from an animal or a plant. Alternatively, the cells can originate from or be derived from bacterial cells. Further, the cells may be obtained from a culture of such cells, for example, a cell line, or can be isolated from an organism. Where the method is performed using an intact living cell or a freshly isolated tissue or organ sample, the presence of a molecule of interest in living cells can be identified, thus providing a means to determine, for example, the intracellular compartmentalization of the molecule in real time.

(298) Detecting with the analyte sensor: Methods for detecting with the analyte sensor or of a cell expressing containing an analyte sensor may include, but are not limited to, illuminating the analyte sensor or cell expressing the sensor with an illumination source such that the analyte sensor or cell expressing the analyte sensor emits a radiation. Such detection methods may use an illumination source such as an incandescent light source, a fluorescent light source, a halogen light source, sunlight, a laser light, and other equivalent sources. When illuminated by such an illumination source, the analyte sensor can emit fluorescent light that may be detected by unaided optical observation or by other qualitative or quantitative methods. Suitable methods for measuring fluorescence of samples are known and understood by those with ordinary skill in the art.

(299) To overcome the limitation of slow kinetics (Zou et al., Brioche, 2007), an improvement of the off-rate constant k.sub.off to 256 s.sup.1 was obtained by redesigning the binding interface between calmodulin and its targeting peptide in GFP-based Ca.sup.2+ sensors. Optimizing the protonation rate of the chromophore in GFP-based Ca.sup.2+ sensors will provide a means to enhance further the accuracy with which Ca.sup.2+ signals can be measured with high temporal resolution. Ca.sup.2+-induced changes in CatchER's optical properties: The model structure of our designed Ca.sup.2+ sensor, CatchER, was based on the scaffold protein EGFP. The binding site is adjacent to the chromophore (right on top of the Y66 phenolic oxygen) and next to H148, T203, and E222 (FIG. 20A); its fluorescence sensitivity may be due to hydrogen-bond interaction. The X-ray crystal structure shows mutated residue sidechains protruding from the protein surface, providing access to solvents. This putative Ca.sup.2+ binding site is formed by residues 147, 202, 204, 223, and 225, which confer Ca.sup.2+-preferred geometric properties (FIG. 20B). Five variants were created by introducing charged residues in these positions (FIGS. 20D-20H).

(300) CatchER (D11) and its variants (D8-D10 and D12) were bacterially expressed and purified using established methods (Heim & Tsien (1996) Curr. Biol. 6: 178-182; Zou et al., (2007) Biochemistry 46: 12275-12288). Introducing acidic ligand residues added an absorption maximum at 398 nm at the expense of the 490 nm peak (FIG. 20I). This EGFP feature is associated with predominance of the anionic chromophore. The ratio of absorption maxima 395/488 increases from 0.2 for EGFP with no charged residue to 2.3 for D10 with four acidic residues (FIG. 20J). A fluorescence maximum of 510 nm excited at 488 nm parallels the absorbance maxima (FIGS. 25A-25L).

(301) Ca.sup.2+ binding to CatchER and its variants D9 and D10 increased absorbance at 490 nm and decreased it at 398 nm (FIG. 25C-25E, 25M), suggesting that Ca.sup.2+ binding increases the anionic chromophore. In contrast, a 510 nm emission maximum increased when excited at both 395 and 488 nm (FIG. 251-25K, 25M). Among all variants, CatchER had the largest fluorescence enhancement (about 80%) upon Ca.sup.2+ binding (FIG. 25K and FIG. 25M) and attained approximately 50% of EGFP fluorescence intensity. D8's fluorescence response was negligible, possibly because it has few ligand residues and low Ca.sup.2+ binding affinity.

(302) Metal binding assisted chromophore formation, as shown by a 0.7 unit decrease in CatchER's pK.sub.a in the presence of Ca.sup.2+ (FIG. 26B) for a value of 6.9, which is closer to that for EGFP. Ca.sup.2+ binding reverses changes in fluorescence properties associated with adding charged ligand residues presumably because it neutralizes the excess negative charge while enhancing fluorescence when excited at 488 and 395 nm. Taken together, these results suggest a unique mechanism for CatchER, involving a concomitant recovery of fluorescence and a switch in the chromophore's ionic form.

(303) Metal binding properties: Several lines of evidence support a simple CatchER-Ca.sup.2+ stoichiometry reaction. The Job Plot suggests that Ca.sup.2+ forms a 1:1 complex with CatchER (FIG. 26C), and the fluorescence change in response to Ca.sup.2+ titration can be fitted to a 1:1 binding equation (FIG. 21B). The equilibrium dialysis experiments using myoglobin (noncalcium-binding protein), EGFP (noncalcium-binding protein), CatchER, and -lactalbumin (Ca.sup.2+-binding protein with K.sub.d=10.sup.9 M) with Ca.sup.2+ demonstrate that CatchER binds Ca.sup.2+ with weak affinity (FIGS. 27A and 27B).

(304) Ca.sup.2+-induced chemical shift changes of several residues close to the designed CatchER's Ca.sup.2+ binding site (FIGS. 22A-22C) can also be fitted to a 1:1 binding process, with K.sub.d values consistent with those determined by fluorescence change. CatchER exhibits the strongest Ca.sup.2+ binding affinity, with an apparent K.sub.d of 0.180.02 mM, while D9 has the weakest, with an apparent K.sub.d of 0.950.08 mM in 10 mM Tris pH 7.4 (FIG. 20L). CatchER's dissociation constant increases to 0.480.07 mM in the presence of 100 mM KCl, consistent with Ca.sup.2+ electrostatic interaction. Na.sup.+, K.sup.+, Cu.sup.2+, Zn.sup.2+, Mg.sup.2+, ATP, GTP, and GDP cannot compete with Ca.sup.2+ for binding CatchER (FIG. 21C), which demonstrates its good selectivity. In vitro kinetic properties of CatchER: A stopped-flow spectrophotometer was used to record fluorescence changes upon mixing 10 M CatchER with various Ca.sup.2+ concentrations. Baseline corresponded to CatchER mixed with Ca.sup.2+-free buffer. Between 40% and 60% of the initial fluorescence increase occurred within the lag-time of the stopped-flow spectrophotometer (i.e., 2.2 ms). A plot of F as a function of Ca.sup.2+ concentration yielded a hyperbolic pattern, where the K.sub.d value of 0.190.02 mM was in reasonable agreement with the K.sub.d of 0.180.02 mM determined by fluorescence equilibrium titration in the same condition (FIG. 20L). The observed rate constants were independent of the calcium concentration between 50 and 1000 M, with an average value of 7316 s.sup.1.

(305) The CatchER:Ca.sup.2+ off-rate was measured by directly monitoring changes in the fluorescence signal after equilibrating 10 M CatchER with 10 M Ca.sup.2+ plus EGTA. About 70% of the fluorescence change was completed within the instrument lag-time (2.2 ms), consistent with very fast Ca.sup.2+ release. If two half-lives would be required to complete 75% of a first-order process of the type required for Ca.sup.2+ release from CatchER, a k.sub.off value of 700 s.sup.1 can be estimated from the data in FIG. 26E). To our knowledge, CatchER exhibits the fastest off-rate of all reported Ca.sup.2+ sensors.

(306) Structural analysis of Ca.sup.2+-CatchER interaction by high-resolution NMR: After introducing the designed Ca.sup.2+ binding site, residues, such as Y143, T153, near binding sites or V68 around the chromophore exhibited more than a 1.5-ppm change, while most residues had less than a 0.4-ppm change in Ca chemical shift between CatchER and EGFP (FIG. 29C). This finding suggests that adding charged ligand residues changes local chromophore conformation, reduces fluorescence, and shifts the chromophore's ionic state toward its neutral state.

(307) From dynamic NMR, the Ca.sup.2+ sensor remains monomeric in solution. Ca.sup.2+ binding leads to significant chemical shift changes in the HSQC spectra of the T153, Y143, L42, and T43 residues, located near the designed Ca.sup.2+ binding site (FIG. 29C). Note that the main chain of Y143 close to the designed site showed the largest shift. These chemical shifts were fitted to a 1:1 binding equation with a K.sub.d value in agreement with that determined by fluorescence measurements (FIG. 21B), suggesting high correlation between these residues. On the other hand, residues R96, Q94, F165, and V61, which protrude toward the chromophore but away from the designed Ca.sup.2+ binding site, showed no significant chemical shift changes, indicating that Ca.sup.2+ binds specifically to the designed site.

(308) NMR can further reveal Ca.sup.2+-induced chromophore change, despite the lack of chromophore signal in the HSQC spectra. Q69 is buried inside the protein and forms hydrogen bonds with the chromophore. Its single resonance gradually becomes two with the addition of Ca.sup.2+ (FIG. 22B), suggesting that Ca.sup.2+ binding converts Q69 from a fast-exchange state to two different slow-exchange conformations. The hydrogen bond formed between E222 carboxyl group and the chromophore's phenolic oxygen is crucial to its fluorescence intensity; this residue forms a main chain hydrogen bond with L42 in the reported wild-type EGFP X-ray structure (pdb ID=1EMA). L42 also exhibits a significant Ca.sup.2+-induced chemical shift change. From absorbance and fluorescence studies and high-resolution NMR, we can attribute the enhancement in Ca.sup.2+-induced fluorescence with fast kinetics to a local conformational change close to the designed Ca.sup.2+ binding site, which slows down the chemical exchange between two chromophore ionic states (kindle fluorescence by metal binding). Additionally, the fluorescence change via direct metal interaction is likely to be faster than indirect interactions via conformational changes. Ca.sup.2+ binding-induced fluorescence changes also bypass the slow rate between ionic states, as we observed for G1, which distinguishes the sensor of the disclosure apart from GCaMP, although both exhibit a similar fluorescence enhancement at 488 nm in response to Ca.sup.2+.

(309) Endoplasmic Reticulum Ca.sup.2+ concentration and release in various cell types: CatchER was fused with the calreticulin signal peptide and KDEL at the scaffold EGFP N- or C-terminus, respectively, to target it to the ER (FIG. 23B). Confocal microscopy of CatchER and the ER-tracker DsRed2-ER colocalized in HEK-293 and C2C12 cells further confirm CatchER's targeting specificity to the ER (FIGS. 30A and 30B).

(310) To determine CatchER's Ca.sup.2+ binding affinity, permeabilized C2C12 myoblasts were exposed to increasing Ca.sup.2+ concentrations as described. CatchER's K.sub.a was 1.070.26 mM in BHK cells and 1.090.20 mM in C2C12 cells. The fluorescence intensity at the end of the experiment was fully recovered to the value prior to calibration, which demonstrates that CatchER was not washed out in permeabilized BHK and C2C12 cells, further supporting its targeting to, and retention in the ER. The resting ER Ca.sup.2+ concentration in HeLa, HEK293, and C2C12 cells was: 39613.2 (n=7), 742134 (n=5), and 81388.6 M (n=11), respectively, in agreement with reported ER Ca.sup.2+ concentrations of 100-900 M using several Cameleon-based ER sensors.

(311) ER Ca.sup.2+ release evoked by ATP was measured in intact C2C12 myoblast cells (FIG. 23A), and the same batches of cell were permeabilized by digitonin to detect IP.sub.3-induced Ca.sup.2+ signaling (FIG. 23B). Fluorescence recovered when IP.sub.3 was washed away, and adding thapsigargin slowed the decrease in ER Ca.sup.2+ concentration. Again adding IP.sub.3 caused fluorescence to decrease rapidly to the plateau as before, and no recovery was observed after washing, suggesting that thapsigargin completely inhibited the SERCA pumps.

(312) CatchER can detect Ca.sup.2+ release through the ryanodine receptor elicited by 4-chloro-m-cresol (4-CmC) in intact cells. In contrast, no drug-related response was observed for mCherry co-expressed in the ER (FIGS. 23C and 23D). Cytosolic Ca.sup.2+ was monitored in C2C12 myoblasts using Fura-2 (FIG. 24). 4-CmC elicited a concentration-dependent SR Ca.sup.2+ depletion, while adding 500 M 4-CmC and 2 M thapsigargin together induced full SR Ca.sup.2+ depletion (FIG. 23E). CatchER reports ER Ca.sup.2+ release in excitable and nonexcitable cells, such as HeLa and HEK 293, in response to ATP, histamine, thapsigargin, and cyclopiazonic acid (FIG. 31E-31G, 31J).

(313) Kits: This disclosure further encompasses kits that can compromise, but are not limited to, an analyte sensor according to the disclosure, related agents that can facilitate the delivery of the protein to its desired destination and directions (written instructions for their use). The components listed above can be tailored to the particular biological event to be monitored as described herein. A kit for use in transfecting host cells may be assembled using the nucleic acid molecules encoding the analyte sensor, or for labeling target polypeptides with the analyte sensor. Host cell transfection kits may include at least one container containing one or more of the nucleic acid molecules encoding a analyte sensor (or a composition including one or more of the nucleic acid molecules or plasmids described above), which nucleic acid molecule preferably includes plasmid. The kit can further include appropriate buffers and reagents known in the art for administering various combinations of the components listed above to the host cell or host organism. The components of the present disclosure and carrier may be provided in solution or in lyophilized form. When the components of the kit are in lyophilized form, the kit may optionally contain a sterile and physiologically acceptable reconstitution medium such as water, saline, buffered saline, and the like.

(314) One aspect of the disclosure, therefore, encompasses embodiments of an analyte sensor comprising an engineered fluorescent host polypeptide having a metal ion binding site comprising a plurality of negatively charged residues, wherein the negatively charged residues comprise a plurality of carboxyl oxygens orientated in a pentagonal bipyrimdal geometry wherein said geometry provides a metallic ion binding site operatively interacting with a chromophore region of the engineered fluorescent host polypeptide such that binding of a metal ion analyte to the molecular recognition motif modulates the emission of a fluorescent signal emitted by the fluorescent host polypeptide, and optionally, the absorbance spectrum of the engineered fluorescent host polypeptide.

(315) In embodiments of this aspect of the disclosure, the negatively charged residues are on the surface of three anti-parallel beta-sheets.

(316) In embodiments of this aspect of the disclosure, the negatively-charged residues are spread on three strands of the protein with beta-can structure.

(317) In embodiments of this aspect of the disclosure, the amino acid sequence of the analyte sensor can have at least 90% similarity to a sequence selected from the group consisting of SEQ ID Nos.: 104-105 and 113-159.

(318) In embodiments of this aspect of the disclosure, the amino acid sequence of the analyte sensor can have at least 95% similarity to a sequence selected from the group consisting of SEQ ID Nos.: 105.

(319) In embodiments of this aspect of the disclosure, the amino acid sequence of the analyte sensor is according to a sequence selected from the group consisting of SEQ ID Nos.: 104-105 and 113-159.

(320) In embodiments of this aspect of the disclosure, the amino acid sequence of the analyte sensor can have at least 90% similarity to SEQ ID No.: 105.

(321) In embodiments of this aspect of the disclosure, the amino acid sequence of the analyte sensor can have at least 95% similarity to a sequence selected from the group consisting of SEQ ID No.: 105.

(322) In embodiments of this aspect of the disclosure, the amino acid sequence of the analyte sensor is according to SEQ ID No.: 105.

(323) In embodiments of this aspect of the disclosure, the analyte sensor can bind to a metal ion selected from the group consisting of: calcium, lead, gadolinium, lanthanum, terbium, antimony, strontium, mercury, and cadmium.

(324) In some embodiments of this aspect of the disclosure, the analyte sensor can binds to a metal ion selected from the group consisting of: calcium.

(325) In embodiments of this aspect of the disclosure, the analyte sensor can further comprising a targeting motif for selectively targeting the endoplasmic reticulum or the sarcoplasmic reticulum of a cell.

(326) In embodiments of this aspect of the disclosure, the analyte sensor in the presence of an analyte bound thereto can emit a fluorescent signal, the fluorescent signal indicating binding of the analyte to the analyte sensor.

(327) In embodiments of this aspect of the disclosure, the analyte sensor in the absence of an analyte can emit a first fluorescent signal and in the presence of an analyte bound to the analyte sensor can emit a second fluorescent signal, wherein the first and the second fluorescent signals are distinguishably detectable.

(328) In some embodiments of this aspect of the disclosure, the sensor is solubilized.

(329) In some embodiments of this aspect of the disclosure, the sensor is attached to a solid surface.

(330) Another aspect of the disclosure encompasses embodiments of a composition comprising an embodiment of the analyte sensor, where the composition can be formulated for the detection of an analyte in a test sample.

(331) In some embodiments of this aspect of the disclosure, the composition can be formulated for detection of analyte in a tissue or a cell of an animal or human host.

(332) In some embodiments of this aspect of the disclosure, the composition can be formulated for detection of analyte in an isolated cell or tissue, or in a cultured cell or tissue.

(333) In embodiments of this aspect of the disclosure, the composition can be formulated for detection of analyte in a liquid.

(334) In embodiments of this aspect of the disclosure, the composition can further comprise a pharmaceutically acceptable carrier.

(335) Yet another aspect of the disclosure encompasses embodiments of a kit comprising an analyte sensor according to the disclosure and packaging, the packing comprising instructions for the use of the analyte sensor for the detection of an analyte by the analyte sensor.

(336) Still another aspect of the disclosure encompasses embodiments of a method for detecting an analyte, comprising: (i) providing an analyte sensor according to the disclosure; (ii) providing a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iii) detecting a first fluorescent signal emitted by the analyte sensor in the absence of a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iv) contacting the analyte sensor with the test sample; (v) detecting a second fluorescent signal emitted by the analyte sensor in contact with the test sample; and (vi) comparing the first fluorescent signal and the second fluorescent signal, wherein a ratiometric change in the signal indicates an analyte in the test sample is interacting with the analyte sensor.

(337) Still another aspect of the disclosure encompasses embodiments of a method for detecting an analyte, comprising: (i) providing an analyte sensor according to the disclosure; (ii) providing a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iii) detecting a first absorption signal derived from the analyte sensor in the absence of a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iv) contacting the analyte sensor with the test sample; (v) detecting a second absorption signal derived from the analyte sensor in contact with the test sample; and (vi) comparing the first absorption signal and the second absorption signal, wherein a ratiometric change in the absorption signal indicates an analyte in the test sample is interacting with the analyte sensor.

(338) Still another aspect of the disclosure encompasses embodiments of a method for detecting an analyte, comprising: (i) providing an analyte sensor according to the present disclosure; (ii) providing a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iii) detecting a first fluorescent signal emitted by the analyte sensor in the absence of a test sample suspected of comprising an analyte having affinity for the molecular recognition motif of the analyte sensor; (iv) contacting the analyte sensor with the test sample; (v) detecting a second fluorescent signal emitted by the analyte sensor in contact with the test sample; and (vi) comparing the first fluorescent signal and the second fluorescent signal, wherein a ratiometric change in the lifetime of the signal indicates an analyte in the test sample is interacting with the analyte sensor.

(339) In some embodiments of this aspect of the disclosure, the first fluorescent signal in the absence of an analyte is a null emission.

(340) In some embodiments of this aspect of the disclosure, the first fluorescent signal and the second fluorescent signal differ in wavelength, wherein the difference in the wavelengths, and optionally in the intensities thereof, indicates an analyte in the test sample is interacting with the analyte sensor.

(341) In some embodiments of this aspect of the disclosure, the first fluorescent signal and the second fluorescent signal differ in intensity, wherein the difference in the intensities indicates an analyte in the test sample is interacting with the analyte sensor.

(342) In embodiments of this aspect of the disclosure, the ratiometric change in the signal intensity provides a quantitative measurement of the analyte in the test sample.

(343) In embodiments of this aspect of the disclosure, the ratiometric change in the signal intensity in the absorption provides a quantitative measurement of the analyte in the test sample.

(344) In embodiments of this aspect of the disclosure, the changes in the life time signal provides a quantitative measurement of the analyte in the test sample.

(345) In some embodiments of this aspect of the disclosure, the analyte is a metal ion selected from the group consisting of: calcium, lead, gadolinium, lanthanum, terbium, antimony, strontium, mercury, and cadmium.

(346) In some embodiments of this aspect of the disclosure, the test sample is a cell or tissue of an animal or human subject, or a cell or tissue isolated from an animal or human subject.

(347) In some embodiments of this aspect of the disclosure, the method is performed in vitro.

(348) Another aspect of the disclosure encompasses embodiments of a recombinant nucleic acid encoding an analyte sensor according to the disclosure.

(349) In embodiments of this aspect of the disclosure, the recombinant nucleic acid can further comprise a vector nucleic acid sequence.

(350) Another aspect of the disclosure encompasses embodiments of a genetically-modified cell comprising a recombinant nucleic acid according to the disclosure.

(351) In embodiments of this aspect of the disclosure, the cell expresses the analyte sensor encoded by the recombinant nucleic acid.

(352) In embodiments of this aspect of the disclosure, the analyte sensor expressed in the cell can provide a detectable fluorescent signal, absorbance signal, and/or life time change, said signal providing a qualitative or quantitative indicator of an analyte in the cell.

(353) Another aspect of the disclosure encompasses embodiments of a method for characterizing the cellular activity of an analyte comprising: (i) providing a genetically modified cell comprising a recombinant nucleic acid expressing an analyte sensor according to claim 1; (ii) expressing the analyte sensor in the genetically modifying a cell measuring a signal produced from the analyte sensor; (iii) detecting a first fluorescent signal emitted by the analyte sensor; (iv) detecting a second fluorescent signal emitted by the analyte sensor after the induction of a physiological event in the cell; and (v) comparing the first fluorescent signal and the second fluorescent signal, wherein a ratiometric change in the signal indicates a change in the level of the analyte in the cell associated with the physiological in cell.

(354) Another aspect of the disclosure encompasses embodiments of a method for characterizing the cellular activity of an analyte comprising: (i) providing a genetically modified cell comprising a recombinant nucleic acid expressing an analyte sensor according to the present disclosure; (ii) expressing the analyte sensor in the genetically modifying a cell measuring a signal produced from the analyte sensor; (iii) detecting a first absorption signal emitted by the analyte sensor; (iv) detecting a second absorption signal emitted by the analyte sensor after the induction of a physiological event in the cell; and (v) comparing the first absorption signal and the second absorption signal, wherein a ratiometric change in the absorption signal indicates a change in the level of the analyte in the cell associated with the physiological in cell.

(355) Another aspect of the disclosure encompasses embodiments of a method for characterizing the cellular activity of an analyte comprising: (i) providing a genetically modified cell comprising a recombinant nucleic acid expressing an analyte sensor according to the present disclosure; (ii) expressing the analyte sensor in the genetically modifying a cell measuring a signal produced from the analyte sensor; (iii) detecting a first fluorescent signal emitted by the analyte sensor; (iv) detecting a second fluorescent signal emitted by the analyte sensor or absorbance signal after the induction of a physiological event in the cell; and (v) comparing the first fluorescent signal and the second fluorescent signal, wherein a ratiometric change in the lifetime of the signal indicates a change in the level of the analyte in the cell associated with the physiological in cell. In embodiments of this aspect of the disclosure, the genetically modified cell is an isolated genetically modified cell.

(356) In embodiments of this aspect of the disclosure, the analyte is a metal ion selected from the group consisting of: calcium, lead, gadolinium, lanthanum, terbium, antimony, strontium, mercury, and cadmium.

(357) In some embodiments of this aspect of the disclosure, the analyte is calcium.

(358) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to perform the methods and use the compositions and compounds disclosed and claimed herein. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C., and pressure is at or near atmospheric. Standard temperature and pressure are defined as 20 C. and 1 atmosphere.

(359) It should be noted that ratios, concentrations, amounts, and other numerical data may be expressed herein in a range format. It is to be understood that such a range format is used for convenience and brevity, and thus, should be interpreted in a flexible manner to include not only the numerical values explicitly recited as the limits of the range, but also to include all the individual numerical values or sub-ranges encompassed within that range as if each numerical value and sub-range is explicitly recited. To illustrate, a concentration range of about 0.1% to about 5% should be interpreted to include not only the explicitly recited concentration of about 0.1 wt % to about 5 wt %, but also include individual concentrations (e.g., 1%, 2%, 3%, and 4%) and the sub-ranges (e.g., 0.5%, 1.1%, 2.2%, 3.3%, and 4.4%) within the indicated range. In an embodiment, the term about can include traditional rounding according to significant figures of the numerical value. In addition, the phrase about x to y includes about x to about y.

EXAMPLES

Example 1

(360) Construction of EGFP Based Ca.sup.2+ Sensors: The Ca.sup.2+ binding motifs of CaM, loop-III (DKDGNGYISAAE (SEQ ID NO.: 113) and the EF hand motif EEEIREAFRVFDKDGNGYISAAELRHVMTNL (SEQ ID NO.: 114)), were inserted into enhanced GFP (EGFP) as previously reported (J. Biotechnol. 119: 368-378, which is incorporated herein by reference) and the insertions were verified by automated DNA sequencing.

(361) The cDNA encoding the EGFP variant grafted with a Ca.sup.2+ binding motif was cloned into bacterial and mammalian expression vectors between BamH1 and EcoR1 restriction enzyme sites. For bacterial expression, the vector pET28(a) with a 6 His-tag was utilized. For mammalian expression, the protein-encoding DNA was subcloned into a pcDNA3.1+ vector. The ER retention sequence, KDEL, was attached to the C-terminus and the ER targeting sequence of calreticulin (CRsig), MLLSVPLLLGLLGLAAAD (SEQ ID NO.: 112), was attached to the N-terminus of the EGFP-based Ca.sup.2+ sensors through PCR. The Kozak consensus sequence was placed at the N-terminus of the calreticulin sequence for the optimal initiation of protein expression in mammalian cells. DsRed2-ER (BD Biosciences Clontech), which contains CRsig and KDEL signal peptides at the N and C-terminals, respectively, was used as a marker for the ER in co-localization experiments. To improve the folding at 37 C., two additional mutations, M153T and V163A, were also added to the Ca.sup.2+ sensors (Nature Biotechnol. 14: 315-319, Biochemistry 39: 12025-12032, each of which is incorporated herein by reference).

Example 2

(362) Expression and Purification of EGFP and Its Variants: EGFP and its variants were expressed in E. coli BL21 (DE3). Cells were grown at 37 C. in LB medium containing 30 g/ml kanamycin to an O.D..sub.600 greater than 0.6 before protein induction with 0.2 mM isopropyl -D-thiogalactoside (IPTG). Since EGFP exhibits reduced fluorescence at 37 C. in vivo, high-level expression of the soluble mature form of EGFP was achieved by growing the cultures overnight in LB broth at 30 C. EGFP and its variants were purified by sonication of the cell pellet and centrifugation at 22,500g for 20 min. The supernatant was injected into a fast performance liquid chromatography (FPLC) system, AKTAprime, connected to a Hitrap Ni.sup.2+ chelating column (Amersham Biosciences). The protein was eluted from the column with a gradient of imidazole in 50 mM NaH.sub.2PO.sub.4/Na.sub.2HPO.sub.4 and 250 mM NaCl (pH 7.4) and identified by mass spectrometry. Imidazole was removed by dialysis against 10 mM Tris and 1 mM DTT (pH 7.4).

(363) Ultra-violet and Visible Absorption Spectroscopy: Ultra-violet and visible absorption spectra of EGFP and its variants were determined with a Shimadzu UV-1601 Spectrophotometer. Protein concentration was determined by absorbance at 280 nm using the molar extinction coefficient of 21,890 M.sup.1cm.sup.1 for EGFP-wt calculated from the contribution from aromatic residues (1 Trp and 11 Tyr) (5500 and 1490 M.sup.1cm.sup.1 for Trp and Tyr, respectively). The extinction coefficients (at 398 nm or 490 nm) of the EGFP variants were obtained with the Eq. (1):

(364) .Math. P = .Math. P , 280 nm ( A P A P , 280 nm ) ( 1 )
in which, the .sub.p is the extinction coefficient at 398 nm or 490 nm of EGFP variants, .sub.p,280nm is the extinction coefficient at 280 nm of EGFP variants, A.sub.p is the absorption of EGFP variants at 398 nm or 490 nm, and A.sub.p,280nm is the absorption of EGFP variants at 280 nm. EGFP was used as a reference in the measurement of the extinction coefficients of the EGFP variants. Fluorescence Spectroscopy: The properties of EGFP and its variants were monitored using a Fluorescence Spectrophotometer (Photon Technology International, Inc.) with a 10 mm path length quartz cell at 20 C. Fluorescence spectra of the chromophore in proteins were measured in the emission region of 410 to 600 nm and 500 to 600 nm with 398 and 490 nm excitation wavelengths, respectively. The ratio of emission at 500 to 600 nm when excited at 398 and 490 nm as a function of Ca.sup.2+ concentrations was utilized to calculate the apparent dissociation constant K.sub.d for Ca.sup.2+ binding of various EGFP-based Ca.sup.2+ sensors by fitting Eq 2 with a 1:1 metal binding equation:

(365) f = ( [ P ] T + [ Ca ] T + K d ) - ( [ P ] T + [ Ca ] T + K d ) 2 - 4 [ P ] T [ Ca ] T 2 [ P ] T ( 2 )
in which f is the fraction of Ca.sup.2+ bound protein, [P].sub.T is the total protein concentration (mM), [Ca].sub.T is the total Ca.sup.2+ concentration (mM), and K.sub.d is the Ca.sup.2+ dissociation constant of the protein. The fraction of the protein bound with Ca.sup.2+ was calculated according to Eq. 3:

(366) f = R - R min R max - R min ( 3 )
in which R.sub.min, R, R.sub.max are the fluorescence emission ratios (excited at 398 and 490 nm) or the amplitudes measured with a stopped-flow spectrofluorimeter for Ca.sup.2+-free, Ca.sup.2+-bound, and Ca.sup.2+-saturated protein, respectively. The fluorescence emission ratio (excited at 398 and 490 nm) was obtained by fitting the data to Eq. 4:

(367) R = F ( 398 nm ) F ( 490 nm ) ( 4 )
in which F.sub.(398nm) and F.sub.(490nm) are the integrated fluorescence intensities in the range of 500 to 600 nm excited at 398 and 490 nm, respectively. The dynamic range value of Ca.sup.2+ sensors was calculated by dividing the fluorescence emission ratio excited at 398 and 490 nm of the Ca.sup.2+ saturated state (R.sub.max) with that of the Ca.sup.2+-free state (R.sub.min).

(368) The apparent dissociation constant for Ca.sup.2+ binding (K.sub.d) of EGFP-based Ca.sup.2+ sensors was also measured by competitive titration with Rhodamine-5N. Rhodamine-5N is a fluorescent dye (Molecular Probes) with a K.sub.d of 31913 M for Ca.sup.2+ in 100 mM Tris, pH 7.4. The dye concentration was calculated using an extinction coefficient of 63,000 M.sup.1 cm.sup.1 at 552 nm. Measurements with different Ca.sup.2+ concentrations were performed by maintaining the concentration of dye (10 M) and protein constant. The fluorescence emission signal from 560 to 650 nm was measured with a cell of 1 cm path length excited at 552 nm. The slit widths of excitation and emission were set at 2 and 4 nm, respectively. The apparent dissociation constants were obtained by globally fitting the spectra from 560 to 650 nm using Specfit/32 with the metal and two ligand model (Spectrum Software Associates).

(369) The Ca.sup.2+ selectivity of the EGFP-based Ca.sup.2+ sensor was examined by monitoring the change of the fluorescence ratio F.sub.(398nm)/F.sub.(490nm) with 1.0 mM Ca.sup.2+ in the presence of metal ions including 0.1 M Cu.sup.2+, 0.1 mM Zn.sup.2+, 10.0 mM Mg.sup.2+, 5.0 M Tb.sup.3+, or 5.0 M La.sup.3+. The normalized change of the ratio (R) was calculated using Eq. 5:

(370) R = R metal - R 0 R Ca - R 0 100 ( 5 )
in which R.sub.0 is ratio of the EGFP-based Ca.sup.2+ sensor in the absence of Ca.sup.2+ and metal ions, R.sub.Ca is the ratio of the EGFP-based Ca.sup.2+ sensor with 1.0 mM Ca.sup.2+ in the absence of metal ions, and R.sub.metal is the ratio of the EGFP-based Ca.sup.2+ sensor with 1.0 mM Ca.sup.2+ in the presence of the metal ions. Eq (5) was also used to examine the effect of small molecules including adenosine triphosphate (ATP), adenosine diphosphate (ADP), guanosine triphosphate (GTP), guanosine diphosphate (GDP), and Glutathione (GSH) on the Ca.sup.2+ response of GFP-based Ca.sup.2+ sensors. Data are expressed as a percentage.
Stopped-flow Spectrofluorometry: Stopped-flow kinetic measurements were performed on a Hi-Tech SF-61 stopped-flow spectrofluorometer (10 mm path length, dead time of <2 ms) with a 1:1 (v/v) ratio of the protein sensor and calcium at 20 C., as described previously (J. Am. Chem. Soc. 127: 2067-2074). Fluorescence emission changes associated with binding of Ca.sup.2+ to Ca-G1 were determined by mixing Ca.sup.2+ and Ca-G1 in 10 mM Tris and 1 mM DTT (pH 7.4) with excitation at 398 nm and a long-pass 455 nm filter. The concentrations of Ca.sup.2+ ranged from 0 to 10 mM. Fluorescence emission changes associated with dissociation of Ca.sup.2+ from Ca-G1 were measured upon mixing Ca-G1 preloaded with Ca.sup.2+ in 10 mM Tris and 1 mM DTT (pH 7.4) with the same buffer. Generally, six duplicate measurements were carried out for each point and the last three were fitted to obtain the observed rate, k.sub.obs. The k.sub.obs for each Ca.sup.2+ concentration was obtained by fitting of the stopped-flow traces according to the single exponential function shown in Eq. 6:
F.sub.t=F.sub.0+Amp [1exp(k.sub.obst)](6)
in which F.sub.t is the fluorescence intensity at any stopped-flow time, F.sub.0 is the initial fluorescence intensity, Amp is the final value of the fluorescence signal at the end of the process at a given Ca.sup.2+ concentration, k.sub.obs is the observed rate of fluorescence change (s.sup.1), and t is the reaction time (s). Measurements typically differed by less than 1% between duplicate experiments.

Example 3

(371) Cell Culture and Transfection: Both BHK-21 and HeLa cells were grown on 100 mm culture dishes or glass coverslips (0.5-1.010.sup.6 cells/dish) in 35 mm culture dishes in Dulbecco's Modified Eagles Medium (DMEM, Sigma Chemical Co., St. Louis, Mo.) with 44 mM NaHCO.sub.3, pH 7.2 and supplemented with 10% (v/v) Fetal Bovine Serum (FBS), 100 U/ml penicillin and 0.1 mg/ml streptomycin (Pen/Strep) at 37 C. with 5% CO.sub.2 in a humidified incubation chamber. The cells were seeded and grown overnight before transient transfection with Ca.sup.2+ sensor plasmid constructs.

(372) Plasmid DNA used for transfection was harvested from transformed E. coli (DH5) using a QIAGEN Miniprep protocol (Qiagen). Each of the GFP variants was individually and transiently transfected into BHK-21 and HeLa cells with Lipofectamine-2000 (Invitrogen Life Technologies) and serum-free Opti-MEMI (Gibco Invitrogen Corporation) per the manufacturer's instructions. The plasmid DNA (2 g) with a ratio of DNA to Lipofectamine between 1:1 and 1:3 (g/l) was generally used in a typical transfection. Following incubation at 37 C. for 4 hrs, the medium containing the DNA-Lipofectamine complex was removed and replaced with DMEM enriched with FBS and Pen/Strep. The cells were then grown for 1 to 3 days in a humidified chamber with 5% CO.sub.2 at 30 or 37 C. before fluorescence or confocal microscope imaging.

Example 4

(373) Confocal Microscope Imaging: BHK-21 and HeLa cells were transferred from DMEM to Hank's Balanced Salt Solution without divalent cations (HBSS(-), Sigma Chemical Co., St. Louis, Mo.) media with 10 mM HEPES, 5 mM NaHCO.sub.3, 1 mM EGTA, and pH 7.2 for live imaging experiments on a LSM 510 laser confocal microscope (Carl Zeiss Inc., Thornwood, N.Y.) using a 100 oil-immersion objective (Zeiss, Fluar, 1.30 n.a.). Prior to imaging, cells and buffers were brought to ambient temperature and allowed to equilibrate to room air. The localization of EGFP-based Ca.sup.2+ sensors was visualized by excitation of EGFP with the 488 nm line of an Argon laser and the narrowest bandpass filter (505-530 nm) was employed for emission. DsRed2-ER was excited with the 543 nm line of a HeNe laser, and emission was detected through a long-pass filter (emission above 560 nm). Zeiss LSM 510 software (Carl Zeiss, Inc.) was used to control the image acquisition parameters. All images were acquired at high resolution (10241024).

Example 5

(374) Fluorescence Microscope Imaging and Its Quantification: BHK-21 cells were imaged 1-3 days following transfection with GFP variants. A Nikon TE200 microscope running Metafluor software (Universal Imaging) with dual excitation capability was used for the cell imaging experiments. The ratio of fluorescence emission of EGFP-based Ca.sup.2+ sensors (measured at 510 nm) in response to excitation wavelengths of 385 nm and 480 nm was measured to monitor changes in [Ca.sup.2+].sub.ER in time series experiments. The [Ca.sup.2+].sub.ER in BHK-21 cells was quantified according to Eq. 7:

(375) [ Ca 2 + ] = K d ( R - R min R max - R ) 1 n ( 7 )
in which R is the fluorescent emission ratio (measured at 510 nm) for 385 nm/480 nm excitation at the initial state, R.sub.min is the minimum of the emission ratio determined at the Ca.sup.2+-free state, R.sub.max is the maximum of the emission ratio at the Ca.sup.2+-saturated state, K.sub.d is the apparent dissociation constant (mM) and n is the Hill coefficient (n=1). Ca.sup.2+-free and Ca.sup.2+-saturated states were obtained on cells treated with 5 M ionomycin and exposed to 1.0 mM EGTA and 1.0 mM Ca.sup.2+, respectively.

Example 6

(376) Design of EGFP-based Ca.sup.2+ Sensors with a Single Inserted Ca.sup.2+-binding Motif: FIG. 1 illustrates the design of Ca.sup.2+ sensors made by integrating a Ca.sup.2+-binding motif, a combination of CaM loop-III and its flanking helices, into EGFP based on the following criteria. First, Ca.sup.2+-binding motifs such as loop-III or intact EF-hand motif III from CaM were used to create Ca.sup.2+-binding sites in EGFP. Ca.sup.2+ is chelated by 12-residues in the EF-hand motif. Thus, peptide fragments of an EF-motif of CaM interact with any CaM target enzymes, thereby producing a sensor that is unlikely to interfere with cellular signaling events. The Ca.sup.2+-binding affinity of the grafted loop can be varied by modifying charged residues in the loop and flanking helices (J. Am. Chem. Soc. 127: 3743-3750; J. Inorg. Biochem. 99: 1376-1383, each of which are incorporated herein by reference), altering the Ca.sup.2+ binding affinity of any designed sensor.

(377) Three integration sites were selected: Glu172-Asp173 within Loop-9 of EGFP (position 1), Gln157-Lys158 within Loop-8 (position 2), and Asn144-Tyr145 within Loop-7 (position 3). Loop-III of CaM, with or without the flanking helices, was used as a Ca.sup.2+ binding motif and grafted at these positions to construct EGFP-based Ca.sup.2+ sensors (FIG. 1A). Next, mutations M153T and V163A were inserted into construct Ca-G1 to create a sensor with improved expression at 37 C. (Ca-G1-37) (Nature Biotechnol. 14: 315-319; Biochemistry 39: 12025-12032, each of which are incorporated herein by reference). Finally, a construct with both ER targeting sequence and retention sequence, which specifically targets Ca-G1 to the ER of mammalian cells, was designed and is referred to as Ca-G1-ER.

Example 7

(378) Spectroscopic Properties of EGFP-based Ca.sup.2+ Sensors and Sensitive Locations of EGFP: Spectroscopic properties of Ca.sup.2+ sensors were first investigated using purified proteins (pH 7.4). FIGS. 2A and 2B show the visible absorbance and the fluorescence emission spectra of EGFP-wt and different Ca.sup.2+ sensor constructs. The spectroscopic properties including extinction coefficients and quantum yields of Ca.sup.2+ sensors are summarized in Table 3.

(379) TABLE-US-00003 TABLE 3 Spectroscopic Properties of EGFP and Ca.sup.2+ Sensor Constructs Extinction coefficient Quantum (398 nm).sup.a (490 nm) (490 nm)/ (398 nm) yield EGFP.sup.b 9.8 55.9 5.7 0.60 Ca-G1 10.9 34.4 3.2 0.53 Ca-G1 25.9 21.5 0.8 0.59 Ca-G2 9.3 46.4 5.0 0.60 Ca-G2 8.5 38.6 4.5 0.69 Ca-G3.sup.c N/A.sup.d N/A N/A N/A .sup.ais the extinction coefficient in units of 10.sup.3 M.sup.1 cm.sup.1. The wavelengths in absorption peaks are shown in the parentheses. .sup.bEGFP-wt was used as a reference in the calculation of absorbance extinction coefficient () and fluorescent quantum yield of EGFP variants. .sup.cThe chromophore was not formed in Ca-G3. .sup.dN/A, not available.

(380) The insertion of loop-III of CaM at Gln157-Lys158 of EGFP (Ca-G2 and Ca-G2 (only Ca-G2 is shown in FIGS. 2A and 2B), FIG. 1A) resulted in a protein with spectroscopic properties similar to EGFP-wt with a slight decrease in absorbance intensity. Note that the major absorbance peak at 490 nm and minor absorbance peak at 398 nm reflect the relative population of anionic and neutral states of the chromophore. FIG. 2B shows that excitation at 398 nm (the neutral state) contributed greatly to the emission peak at 510 nm.

(381) As shown in Table 3, the constructs with a Ca.sup.2+-binding motif grafted at Gln157-Lys158 (position 2) (Ca-G2 and Ca-G2) had spectroscopic properties (extinction coefficients and quantum yield constants at both 398 nm and 490 nm) similar to that of EGFP-wt. The integrating loop III of CaM at Glu172-Asp173 of EGFP (Ca-G1) resulted in the formation of a protein which showed a slight increase of absorbance at 398 nm and a decrease of absorbance at 490 nm compared to EGFP-wt. Moreover, the insertion of loop III containing the flanking EF-helices at the same location (Ca-G1) resulted in a protein which had a further increase in absorbance at 398 nm and a decrease at 490 nm. The extinction coefficients of Ca-G1 were increased 2.6-fold at 398 nm and decreased about 60% at 490 nm compared to EGFP-wt. Concurrently, a corresponding increase in fluorescence emission was observed for both Ca-G1 and Ca-G1 (FIG. 2B).

(382) In contrast, the chromophore was not formed after insertion of loop III at Asn144-Tyr145 of EGFP (Ca-G3), indicated by the lack of green fluorescence in the bacterial expression as well as in the purified protein. Thus, the integration of a Ca.sup.2+ binding motif at Glu172-Asp173 in EGFP significantly shifts the population of the chromophore from the anionic state as indicated by the 490 nm peak to the neutral state as indicated by 398 nm peak. It is likely that Glu172-Asp173 of EGFP is a chromophore sensitive location.

(383) CD analysis was performed to test whether the changes in the chromophore properties of the Ca.sup.2+ sensor constructs were due to structural changes. All Ca.sup.2+ sensor constructs exhibited CD spectra similar to that of EGFP-wt (FIG. 7), suggesting that the insertion of a Ca.sup.2+ binding motif into EGFP did not significantly change the folding of the -sheet structure of GFP.

(384) The pH sensitivity of the optical properties of Ca-G1, since a few GFP-based biosensors have been reported to be pH sensitive. FIGS. 8A and 8B shows the absorbance spectra of Ca-G1 as a function of pH. Changing pH from 9.0 to 5.0 resulted in an increase of the absorbance at 398 nm and a decrease of the absorbance at 488 nm. The pK.sub.a of Ca-G1 is 7.450.05 whereas the pK.sub.a of EGFP is 6.0. These data suggest that the optical properties of the designed Ca.sup.2+ sensor are more sensitive to pH at physiological pH than those of EGFP-wt.

Example 8

(385) Effect of Ca.sup.2+ Binding on Spectroscopic Properties of EGFP-based Ca.sup.2+ Sensors: As shown in FIG. 3A, an increase in absorbance at 398 nm concomitant with a decrease at 490 nm was observed in response to the addition of Ca.sup.2+ to Ca-G1-37. Similarly, Ca.sup.2+ binding resulted in an increase in fluorescence with excitation at 398 nm (FIG. 3B) and a decrease with excitation at 490 nm (FIG. 3C).

(386) The dynamic range value was 1.8 and was calculated by dividing the fluorescence emission ratio excited at 398 and 490 nm of the Ca.sup.2+ saturated state (R.sub.max) by that of the Ca.sup.2+-free state (R.sub.min) (see Experimental procedures). FIG. 3D shows the fluorescence emission ratio, F.sub.(398nm)/F.sub.(490nm), of Ca-G1-37 as a function of Ca.sup.2+ concentration. The normalized fluorescence emission ratio change could be fitted as a 1:1 Ca-G1-37-Ca.sup.2+ complex (Eq 2), yielding an apparent dissociation constant (K.sub.a=0.440.04 mM) for its Ca.sup.2+ binding affinity. The Ca.sup.2+ binding affinity of EGFP-based Ca.sup.2+ sensors was also determined using a Rhodamine-5N competition titration approach. The Ca.sup.2+ binding affinities of these Ca.sup.2+ sensors varied from 0.4 to 2 mM (Table 4), as determined by different techniques.

(387) TABLE-US-00004 TABLE 4 Comparison of Ca.sup.2+ Binding Affinities of Different EGFP-based Ca.sup.2+ Sensors Ca.sup.2+ Binding Affinity, K.sub.d (mM) Rhodamine-5N Ca.sup.2+ titration Competitive titration Ca-G1 2.0 0.4.sup. 0.9 0.2 Ca-G1 0.8 0.1.sup.a 0.4 0.1 0.8 0.1.sup.b 0.6 0.1.sup.c Ca-G1-37 0.44 0.04.sup. 0.2 0.1 Ca-G2 N/A 0.8 0.2 Ca-G2 N/A 0.2 0.1 Ca-G3 N/A 0.7 0.2 .sup.aestimated with results of fluorescence spectrophotometer. .sup.bestimated with fitting Scheme 1 using results from stopped-flow spectrofluorometer. .sup.cestimated with fitting normalized changes (Amp) of stopped-flow spectrofluorimeter.

(388) These values agreed with the approximate calcium concentration found in cellular compartments such as the ER, making these Ca.sup.2+ sensors promising candidates for physiological experiments in living cells.

Example 9

(389) Ca.sup.2+ Selectivity of the EGFP-based Ca.sup.2+ Sensor: The binding selectivity of the developed Ca.sup.2+ sensors for Ca.sup.2+ was examined by measuring the change of the ratio F.sub.(398nm)/F.sub.(490nm) in the presence of 1.0 mM Ca.sup.2+ before and following the addition of various metal ions. In cells, total metal concentrations for Cu.sup.2+, Zn.sup.2+, and Mg.sup.2+ are estimated to be approximately 10 M, approximately 0.1 mM, and greater than 10 mM, respectively. However, the free levels of these metal ions are significantly lower than the total concentrations, which protects the cell against potentially toxic reactions. For example, intracellular free copper is not detected and copper chaperone is used in vivo to allocate copper to its target proteins directly.

(390) FIG. 4A shows the Ca.sup.2+ responses of sensor Ca-G1-37 in the presence of Cu.sup.2+, Zn.sup.2+, Mg.sup.2+, Tb.sup.3+, and La.sup.3+. Note that no effect of Cu.sup.2+ (0.1 M) on the fluorescence response of the sensor for Ca.sup.2+ was observed (101.953.02% compared to the reference value of 100% for 1.0 mM Ca.sup.2+). Zn.sup.2+ (0.1 mM) and Mg.sup.2+ (10.0 mM) produced only a small change in the fluorescence response (reduction to 85.713.34% and 74.291.22%, respectively). Non-physiological metal ions, such as Tb.sup.3+ (5.0 M) and La.sup.3+ (5.0 M) have metal coordination properties similar to Ca.sup.2+ and are able to compete more strongly with Ca.sup.2+ responses of the sensor (0.155.4% and 16.09.0%, respectively). These results suggest that the developed Ca.sup.2+ sensor, Ca-G1-37, has good metal selectivity for Ca.sup.2+, La.sup.3+ and Tb.sup.3+ and only to a lesser degree with the other physiological metal ions.

(391) The effects of small molecules including adenosine triphosphate (ATP), adenosine diphosphate (ADP), guanosine triphosphate (GTP), guanosine diphosphate (GDP), and Glutathione (GSH) on the Ca.sup.2+ response of GFP-based Ca.sup.2+ sensors were also analyzed by measuring the change of the ratio F.sub.(398nm)/F.sub.(490nm) in the presence of 1.0 mM Ca.sup.2+ before and following their addition.

(392) FIG. 4B indicates that the addition of ATP (0.2 mM), ADP (0.2 mM), GTP (0.1 mM), GDP (0.1 mM), and GSH (1.0 mM) only resulted in a small decrease in the fluorescence response (reduction to 85.7513.98%, 96.171.36%, 88.308.09%, 93.291.01%, and 89.182.90%, respectively). These results indicate that the developed Ca.sup.2+ sensor, Ca-G1-37, has a high Ca.sup.2+ binding affinity to compete with small molecules including ATP, ADP, GTP, GDP, and GSH in the intracellular environment.

Example 10

(393) Kinetics of Ca.sup.2+ Binding to the EGFP-based Ca.sup.2+ Sensor: As shown in FIG. 5A, mixing Ca-G1 with various concentrations of Ca.sup.2+ resulted in a rapid increase in the fluorescence emission at 510 nm with excitation at 398 nm. The change in fluorescence signal is consistent with a single exponential function (Eq. 6) yielding observed rates for fluorescence emission change (k.sub.obs) and amplitudes (Amp).

(394) As shown in FIG. 5B, the k.sub.obs values of Ca-G1 decreased with increasing concentration of Ca.sup.2+, consistent with the kinetic model of Scheme 1, in which Ca.sup.2+ rapidly associates with one species of Ca-G1 that is in equilibrium with a second form of the biosensor. The increases in fluorescence emission excited at 398 nm of Ca-G1 observed upon Ca.sup.2+ binding as shown in FIG. 5A further suggest that the neutral form of Ca-G1 is the species that binds Ca.sup.2+ (E** in Scheme 1), whereas the anionic form of the biosensor (E*) does not bind Ca.sup.2+.

(395) According to this kinetic model, k.sub.1 is the first order rate constant (s.sup.1) for the conversion of the anionic species to the neutral species of Ca-G1, k.sub.2 is first order rate constant (s.sup.1) for the conversion of the neutral species to the anionic form of Ca-G1, and K.sub.d2 represents the apparent dissociation constant for the binding of Ca.sup.2+ to the neutral form of Ca-G1 (mM).

(396) ##STR00001##

(397) By fitting k.sub.obs values determined as a function of Ca.sup.2+ concentration to Eq 8, the k.sub.1 and k.sub.2 values were estimated to be 9.50.3 s.sup.1 and 14.00.6 s.sup.1, respectively, and a K.sub.d2 value of 0.80.1 mM was determined. The K.sub.d2 value was independently estimated to be 0.60.1 mM by fitting the normalized amplitude in fluorescence emission as a function of the concentration of Ca.sup.2+ by using Eq. 2 (FIG. 5C). Within errors associated with the measurements, the K.sub.d values determined using stopped-flow fluorescence spectroscopy are in agreement with the K.sub.d value independently determined in static titrations using a spectrofluorometer, which yielded a K.sub.d value of 0.80.1 mM (Table 1). This, in turn, strongly supports the validity of the proposed minimal kinetic mechanism of Scheme 1 for Ca.sup.2+ binding to Ca-G1, where rates of fluorescence changes associated with Ca.sup.2+ binding to the neutral species of Ca-G1 reflect rates of interconversion of the neutral and anionic forms of Ca-G1, as compared to the rapid association and dissociation of Ca.sup.2+ to and from the biosensor.

(398) k obs = k 1 + k 2 ( K d 2 K d 2 + [ Ca 2 + ] ) ( 8 )

(399) According to the minimal kinetic mechanism of Scheme 1 and the data shown in FIG. 5A, the release of Ca.sup.2+ from preloaded Ca-G1 is expected to be associated with a decrease in fluorescence whose rate of fluorescence change represents the slow rate of conversion from the neutral to the anionic form of Ca-G1, i.e., k.sub.2. Consequently, stopped-flow spectroscopy was utilized to independently determine k.sub.2 by mixing equal volumes of Ca.sup.2+-saturated sensor with 10 mM Tris and 1 mM DTT (pH 7.4). As expected, the fluorescence intensity at 510 nm decreased following Ca.sup.2+ release and the time course of fluorescence change was consistent with a single exponential process (Eq. 6).

(400) As shown in FIG. 5D, a k.sub.obs value of 16.91.0 s.sup.1 was estimated in this experiment by fitting the data to Eq. 6, in good agreement with the value of 14 s.sup.1 determined for k.sub.2 from the data in FIG. 5B. Together, the kinetic data support the conclusion that Ca.sup.2+ rapidly associates with and dissociates from the neutral form of Ca-G1, yielding a change in the relative amounts of neutral and anionic species that is associated with a change in the intensity of the fluorescence signal from Ca-G1.

(401) Ca.sup.2+ binding to Ca-G1 results in a rapid shift of the chemical equilibrium of the chromophore between its anionic and neutral states (Scheme 1). This conclusion is supported by visible absorption, fluorescence emission, and stopped-flow fluorescence data. Both kinetic and thermodynamic parameters, including the forward and reverse rate constants for the interconversion of the anionic and neutral states of the chromophore, as well as the apparent dissociation constant for binding of Ca.sup.2+ to Ca-G1 were determined using stopped-flow fluorescence measurements. This approach established that the rates of Ca.sup.2+ association and dissociation to and from the sensor must be significantly larger than both the forward and reverse first-order rate constants that define the chemical equilibrium of the chromophore (k.sub.1 and k.sub.2 in Scheme 1), which are between 10 and 20 s.sup.1. The rate of Ca.sup.2+ association to proteins is generally a diffusion-limited process with an on-rate (k.sub.on) equal or greater than 110.sup.6 M.sup.1 s.sup.1. Since the apparent dissociation constant for the Ca.sup.2+ binding process determined in this study for Ca-G1 is 0.8 mM for Ca-G1, an off-rate (k.sub.off) of 800 s.sup.1 can be estimated from k.sub.off=k.sub.onK.sub.d. Whereas the on-rate of GFP-based Ca.sup.2+ sensors is generally not the limiting factor in Ca.sup.2+ measurements, the slow off-rate exhibited by Ca.sup.2+ sensors limits their usefulness in monitoring changes in Ca.sup.2+ concentration in vivo, especially for fast Ca.sup.2+ oscillations. To overcome this limitation, an improvement of the off-rate constant k.sub.off to 256 s.sup.1 was obtained by redesigning the binding interface between calmodulin and its targeting peptide in GFP-based Ca.sup.2+ sensors. Optimizing the protonation rate of the chromophore in GFP-based Ca.sup.2+ sensors will provide a means to enhance further the accuracy with which Ca.sup.2+ signals can be measured with high temporal resolution.

Example 11

(402) Monitoring ER Ca.sup.2+ Responses in Cells: Localization of the Ca.sup.2+ sensor, Ca-G1-ER, was confirmed in HeLa cells by co-transfecting the cells with the ER marker DsRed2-ER that has been shown to localize exclusively to this region in mammalian cells. FIG. 6 shows images taken through the green (A, Ca-G1-ER) and red (B, DsRed2-ER) channels which were excited at 488 and 543 nm, respectively. The merged image (FIG. 6C) indicates the complete co-localization of Ca-G1-ER with the ER marker DsRed2-ER in the ER of HeLa cells. FIG. 6D shows the ER distribution of Ca-G1-ER in a BHK-21 cell, a mammalian fibroblast cell line. Note the same granular distribution of Ca-G1-ER in FIGS. 6A and 6D, suggesting that the Ca.sup.2+ sensor also specifically localizes to the ER of BHK cells. In contrast, Ca-G1, which lacked the ER signal peptides, was expressed diffusely throughout the cytoplasm of the cells, thereby serving as a negative control (data not shown).

(403) BHK-21 cells have been used previously to investigate the physiological roles of [Ca.sup.2+].sub.ER in intact cells by using small, low-affinity Ca.sup.2+ indicators. ATP (100 M) is a Ca.sup.2+-mobilizing agonist of this cell type and elicits Ca.sup.2+ release from the ER through Ins(1,4,5)P.sub.3-mediated pathways. As shown in FIG. 6E, the addition of ATP (100 M) resulted in a significant decrease (7.30.6% relative change) in the fluorescence ratio measured at 510 nm (excitation at 385 and 480 nm). The experiment shows five representative cells imaged in the same experiment and the results are typical of results obtained in 5 independent experiments. This decrease of [Ca.sup.2+].sub.ER was also observed following application of ATP in Ca.sup.2+-free buffer, suggesting that ATP released Ca.sup.2+ from the ER independent of extracellular Ca.sup.2+. The refilling of the Ca.sup.2+ store required several minutes in the presence of normal extracellular Ca.sup.2+ in the medium. Similarly, the addition of the Ca.sup.2+ ionophore, ionomycin, under Ca.sup.2+ free conditions significantly emptied the ER store as indicated by the decreased 385 nm/480 nm fluorescence ratio. To obtain an estimate of [Ca.sup.2+].sub.ER, a pseudo-calibration was performed in BHK-21 cells using Eq. 7 and a K.sub.d of 0.8 mM for Ca-G1 as shown in Table 1 (FIG. 6F). The 385 nm/480 nm fluorescence ratio decreased to a minimum value (R.sub.min) following a wash with Ca.sup.2+ free medium (EGTA) and the subsequent addition of ionomycin (approximately 5 M) to the Ca.sup.2+-free medium (estimated to contain less than 10 nM Ca.sup.2+ using the freeware program Bound and Determined). The addition of millimolar extracellular Ca.sup.2+ (approximately 1 mM) resulted in a large increase in the Ca.sup.2+ signal with a plateau that approached the saturation state with a maximum of 385 nm:480 nm fluorescence ratio (R.sub.max). The initial Ca.sup.2+ concentration in the ER of the BHK-21 cell was estimated to be less than 1 mM using Eq 7 and addition of ATP (100 M) reduced [Ca.sup.2+].sub.ER to approximately 0.15 mM (FIG. 6F). As expected, no significant fluorescence signal change was observed in response to the above experimental protocol in cells transfected with the wild type control construct, EGFP-wt-ER (data not shown). These imaging experiments demonstrate the usefulness of this novel class of Ca.sup.2+ sensors in living cells and it is anticipated that their future application will facilitate the investigation of the role of the ER in Ca.sup.2+ signaling and Ca.sup.2+ homeostasis.

Example 12

(404) Variant Constructs: The GFP variant EGFP-D2 (SEQ ID No.: 64) with a discontinuous calcium binding site (S2D, S86D, L194E), cycle 3 (F99S, M153T, V163A) mutations was made through site-directed mutagenesis with PCR and turbo pfu (Strategene) following the manufacturer's suggestions with EGFP (S65T, F64L, V22L, M2181, H231L) as the initial template.

(405) EGFP-G1 contains a continuous EF-hand Ca.sup.2+ binding motif III that was inserted by several rounds of PCR utilizing turbo pfu. The linear DNA was ligated with T4 DNA ligase (Promega) following the manufacturer's instructions, and the circular DNA was transformed into E. coli DH5 competent cells for DNA amplification. The variant DNA was verified by automated sequencing. The cDNA encoding the EGFP variants with BamH I and EcoR I restriction enzyme sites between the N and C terminals were subcloned into mammalian expression vector pcDNA3.1+ that uses the CMV promoter.

Example 13

(406) Bacterial Expression and Purification: The proteins were expressed from the vector pet28a (EMD Biosciences) with a 6 His-tag using E. coli BL21(DE3) in LB-kanamycin (30 g/mL). Expression was induced at an O.D.sub.600 of 0.6 with 0.2 mM IPTG and expression was allowed to continue for 21 hrs before the cells were harvested by centrifugation. For these studies, the temperature was controlled at both 30 C. and 37 C. after induction. The expression of EGFP and its variants was monitored with the fluorescence intensity at 510 nm with a Fluo-star instrument and an excitation wavelength of 488 nm.

(407) Protein purification was with an Amersham-Pharmacia 5 mL HiTrap chelating HP column charged with nickel. The cell pellets were resuspended in 20 mM Tris, 10 mM NaCl, 0.1% Triton X-100, pH 8.8 and sonicated. The cellular debris was removed by centrifugation and the protein was loaded onto the prepared HiTrap column connected to an Amersham-Pharmacia AktaPrime FPLC. After washing to remove contaminant proteins, the protein of interest was eluted with an imidazole gradient. Contaminant imidazole was removed by dialysis, and the protein was further purified using a HiTrap Q ion-exchange column (Amersham) with a NaCl gradient at pH 8.0. Protein purity was verified by SDS-PAGE.

Example 14

(408) Mammalian Cell Culture: HeLa cells were grown on 60 mm culture dishes in Dulbecco's Modified Eagles Medium (DMEM, Sigma Chemical Co., St. Louis, Mo.) with 44 mM NaHCO.sub.3, pH 7.2, and supplemented with 10% (v/v) fetal bovine serum (FBS), 100 U/ml penicillin and 0.1 mg/ml streptomycin (Pen/Strep) at 37 C. with 5% CO.sub.2 humidified incubation chamber. HeLa cells were grown to confluency before transient transfection.

(409) Plasmid DNA used for transfection was harvested from transformed E. coli (DH5a) using QIAGEN's miniprep protocol (Qiagen). Each of the nine GFP variants were individually and transiently transfected into HeLa cells with Lipofectamine-2000 (Invitrogen Life Technologies) and serum-free Opti-MEMI (Gibco Invitrogen Corporation) as per the manufacturer's instructions. A typical transfection consisted of 1 or 2 g plasmid DNA with a ratio of DNA to Lipofectamine between 1:1 and 1:3 (g/l) dependent upon the protein construct. Protein expression was allowed to proceed for 48 and 72 h before inverted epifluorescence imaging. Control transfections with EGFP were performed in the same conditions as each construct.

Example 15

(410) Measurement of fluorescent intensity: Three 1 ml samples were collected at time points throughout the expression, and centrifuged at 14 K rpm for 3 min. The cell pellets were resuspended in 1 ml of Tris buffer at pH 7.4, and 200 l was analyzed using a FLUOstar OPTIMA (BMG Labtech) plate reader with excitation filters of 390 and/or 460 nm and an emission filter at 510 nm.

Example 16

(411) Fluorescence microscopy/imaging and its quantifications: An inverted epifluorescence microscope (Zeiss Axiovert 200) was utilized for fluorescence intensity screening in vivo. The microscope was equipped with a xenon arc Lamp, filters for Sapphire GFP with 398 nm excitation and 510 nm emission, with standard DAPI, FITC, and Texas Red filters, and transmitted light. An Axiocam 5 CCD camera was connected to the microscope at a right angle to the stage, and Zeiss Axiovision Rel 4.3 software was used for data collection and analysis. For fluorescence intensity measurements a 40 dry objective was used with Sapphire GFP and FITC filters and exposure times from 50 to 2000 ms. The images with exposure allowing for fluorescence intensity within the dynamic range were utilized for data analysis. The fluorescence intensity measured in this time range was a linear function of the exposure time.

(412) Both the area and mean fluorescence intensity of transfected cells (n>20 cells per image) were measured and the total mean fluorescence intensity of cells in each imaged field was obtained with the calculation of Eq. (9):

(413) F = .Math. i = 1 n S i F i .Math. i = 1 n S i ( 9 )
in which, F is the total mean fluorescence intensity excited at 398 nm or 480 nm of cells in each image, and n is the number of fluorescent cells. S.sub.i is the area of i.sup.th fluorescent cell and F.sub.i is the mea fluorescent intensity excited at 398 nm or 480 nm of i.sup.th fluorescent cell.

(414) The total mea fluorescent intensity excited at 398 nm or 480 nm of the HeLa cells three days after transfection with EGFP-G1-C3 was used as a reference, and the fluorescence intensity excited at different wavelengths of the HeLa cells grown for different times with other GFP variants was expressed as a percentage of EGFP-G1-C3 fluorescence according to Eq. (10):

(415) F = F F 0 100 ( 10 )
in which, the F is the relative fluorescent intensity excited at 398 nm or 480 nm of the HeLa cells, F is the total mean fluorescence intensity excited at 398 nm or 480 nm of the HeLa cells, and F.sub.0 is the total mea fluorescent intensity excited at 398 nm or 480 nm of the HeLa cells incubated for three days after transfection with EGFP-G1-C3.

Example 17

(416) Measurement of ultra-violet (UV) and visible absorption spectrum: Spectroscopic properties of EGFP and its variants were measured by UV and visible absorption spectra with a Shimadzu UV and Visible Light Spectrophotometer from 600 to 220 nm. The concentrations of the proteins were determined by UV-vis absorbance at 280 nm using the molar extinction coefficient of 21,890 M.sup.1cm.sup.1 calculated from the contribution from aromatic residues (1 Trp and 11 Tyr) (5500 and 1490 M.sup.1cm.sup.1 for Trp and Tyr, respectively). The extinction coefficient at 398 nm or 490 nm of the EGFP variants were obtained with the Eq. (11):

(417) 0 .Math. P = .Math. P , 280 nm ( A P A P , 280 nm ) ( 11 )

(418) in which, .sub.p is the extinction coefficient at 398 nm or 490 nm of EGFP variants, .sub.p,280nm is the extinction coefficient at 280 nm of EGFP variants, A.sub.p is the absorption of EGFP variants at 398 nm or 490 nm, and A.sub.p,280nm is the absorption of EGFP variants at 280 nm. EGFP was used as a reference in the measurement of the extinction coefficients of the variants.

Example 18

(419) Fluorescence excitation and emission spectra: Spectroscopic properties of EGFP and its variants were also monitored with their fluorescence spectra, measured in a Fluorescence Spectrophotometer (Hitachi Co. Ltd.) with a 1 cm path length quartz cell at room temperature and at 1 M concentration in 10 mM Tris and 1 mM DTT (pH 7.4). Slit widths of 3 nm and 5 nm were used for excitation and emission, respectively. The quantum yield of EGFP variants with different excitation wavelengths was obtained with a calculation of equation Eq. (12):

(420) p = r ( A r A p ) ( F p F r ) ( n p 2 n r 2 ) ( 12 )
in which, .sub.p is the relative quantum yield excited at 398 nm or 490 nm of EGFP variants; .sub.r is the relative quantum yield excited at 398 nm or 490 nm of the reference sample; A.sub.p is the absorption of EGFP variants at 398 nm or 490 nm; A.sub.r is the absorption of the reference sample at 398 nm or 490 nm; F.sub.p is the integrated fluorescence intensity in the range of 500 nm to 600 nm excited at 398 nm or 490 nm of EGFP variants; F.sub.r is the integrated fluorescence intensity in the range of 500 nm to 600 nm excited at 398 nm or 490 nm of the reference sample; n.sub.p is the refractive index of EGFP variants; and n.sub.r is the refractive index of the reference sample.

(421) EGFP was used as the reference sample in the measurement of quantum yield of EGFP variants.

Example 19

(422) Statistical analysis: Statistical analysis was performed with the software package Super ANOVA (Abacus Concepts, Berkeley, Calif.). Values were expressed as meanSEM. Control and treatment groups were compared by performing an analysis of variance (ANOVA). Fisher's Protected Least Significance Difference Test (Fisher's PLSD) was employed for post-hoc tests of statistical significance. Significance levels compared to day 1 are indicated as follows: *p0.05; **p0.01; ***p0.001.

Example 20

(423) Design of EGFP-based calcium binding proteins: Two different types of calcium binding sites were created in enhanced green fluorescent protein (EGFP). FIG. 9A shows the design of EGFP-D2 (SEQ ID No.: 64) containing a discontinuous calcium binding site based on common pentagonal bipyramidal geometry and chemical properties (J. Am. Chem. Soc. 127: 2085-2093; J. Am. Chem. Soc. 125: 6165-6171). It was formed by oxygen from five negatively charged ligand residues from sidechain carboxyl groups by the mutated amino acid positions, S2D L194E, S86D, and the natural ligands of D82 and E5. FIG. 9A also shows the engineering of a continuous calcium binding site EGFP-G1 (SEQ ID No.: 4) by integrating the EF hand calcium binding motif III of calmodulin inserted on loop 9 between residues E172 and D173 of EGFP. In addition to fulfilling the required criteria for calcium binding to have proper local calcium binding geometric properties and charge arrangement, these calcium binding sites were also selected based on criteria to assist chromophore formation: (i) site location and residue mutations should not abolish the chromophore synthesis or folding of the protein. Any residues that are conserved in fluorescent proteins and essential for protein structure and folding are not mutated; (ii) the location should be in a solvent-exposed region to have a good accessibility to enable calcium binding; (iii) to avoid drastic alterations of protein folding and chromophore formation by the introduced charged calcium ligand residues, a calcium binding pocket with few mutations necessary is preferred.

(424) Additional mutants were also created to test the effect of folding mutations on the fluorescence at both temperatures. The cycle 3 mutations were applied in sets of two or three of each calcium binding site to examine the differences in fluorescence in accordance with the applied mutations. Two mutations, M153T and V163A, were applied to EGFP-D2 and EGFP-G1 to create EGFP-D2-C2 and EGFP-G1-C2 (SEQ ID No.: 19) constructs, respectively. The last mutation F99S was further incorporated to create the C3 constructs, EGFP-D2-C3 and EGFP-G1-C3 (SEQ ID No.: 34). The same mutations (C2 and C3) were also applied to EGFP-wt.

(425) FIG. 9B illustrates a model structure of modified grafting EGFP sensor. One EF-hand was inserted in the fluorescent sensitive location of EGFP, generating EGFP-G1. A site-directed mutagenesis on the beta-sheet surface introducing a negatively charged residue to form a Ca.sup.2+ binding site with three existed negatively-charged residues.

(426) Bacteria expression of the EGFP calcium binding proteins: The nine proteins, EGFP, EGFP-C2, EGFP-C3, EGFP-D2 (SEQ ID No 64), EGFP-D2-C2, EGFP-D2-C3, EGFP-G1 (SEQ ID No.: 4), EGFP-G1-C2 (SEQ ID No.: 19), and EGFP-G1-C3 (SEQ ID No.: 34) were first expressed in bacteria at 30 C. and 37 C. to examine the differences in the chromophore maturation by monitoring the fluorescence intensity at 510 nm (excited at 490 nm). Average intensities of the nine proteins were taken at five time points throughout the expression.

(427) FIG. 10 lists the average fluorescence intensities for 22 hrs after IPTG induction. The differences between the 30 C. and 37 C. expression fluorescence intensities were also calculated. As shown in FIG. 10, at 30 C. the addition of both types of calcium binding sites into EGFP does not alter the chromophore formation. However, the fluorescent intensities of expressed properties in bacteria were significantly decreased.

(428) The fluorescent intensities of both EGFP-D2 (SEQ ID No.: 64) and EGFP-G1 (SEQ ID No.: 4) is significantly lower than in EGFP at both 30 C. and 37 C. The C2 and C3 mutations in EGFP-D2 (SEQ ID No.: 64) resulted in 37- and 18-fold increases of its fluorescence intensity at 30 C., respectively. The fluorescence intensity increase (6- and 4-fold) was also observed with C2 and C3 mutations in EGFP-G1 (SEQ ID No.: 4) at 30 C. However, the similar fluorescence intensity increase was not observed with C2 and C3 mutations in EGFP at 30 C. The fluorescent intensities at 510 nm of the proteins with the addition of calcium binding sites D2 and G1 at 30 C. were greater than that at 37 C., respectively. While EGFP does not have any significantly difference in fluorescent intensity for both C2 and C3 variants, the C2 constructs for D2 and G1 surprisingly exhibited an increased fluorescence over the C3 variants. Though it is not as low in fluorescence as the protein variants with none of the cycle 3 mutations added, this indicates that F99S actually interferes with the folding of the protein variant when applied to the M153T/V163A construct.

Example 21

(429) Mammalian cell expression of EGFP-based calcium binding proteins: The effect of the C2 and C3 mutations on the expression of EGFP calcium proteins in mammalian cells was also monitored using fluorescence microscopy. FIG. 11 shows the fluorescence microscope imaging of the HeLa cells at two day expression at 30 C. and 37 C. after transfection of EGFP-G1, EGFP-G1-C2, and EGFP-G1-C3. As shown in FIGS. 11A-11C, after two days transfection and expression at 30 C., EGFP-G1 (SEQ ID No.: 4) variant and its C2 and C3 mutations were expressed and folded in the majority of the HeLa cells as indicated by their strong fluorescence signals. However, as shown in FIG. 11D, EGFP-G1 (SEQ ID No.: 4) lost its fluorescence signal at 37 C. indicating that this temperature was not suitable to the maturation of EGFP-G1 (SEQ ID No.: 4) in HeLa cells. In contrast, the addition of C2 and C3 mutations in EGFP-G1 (SEQ ID No.: 4) resulted in a maturation of the proteins at 37 C. in HeLa cells, as shown in FIGS. 11E and 11F.

(430) FIGS. 12A and 12B show the quantitative analysis of fluorescence intensity of HeLa cells (more than 20 cells per image) transfected with both EGFP-D2 and EGFP-G1 series at both 30 C. and 37 C. A low fluorescence intensity of HeLa cells transfected with EGFP-D2 (SEQ ID No.: 64) was observed at both 30 C. and 37 C. (FIG. 12A) compared with that of EGFP-G1 (SEQ ID No.: 4). The C2 mutation in EGFP-D2 resulted in the increase of fluorescence intensity, but further increase was not observed in the C3 mutation. This result with mammalian cells corresponded with that observed in E coli. A similar result was also indicated with a C2 mutation in EGFP-G1 at 37 C. although the effect of C2 and C3 mutations of EGFP-G1 was not observed at 30 C., shown in FIG. 12B.

Example 22

(431) Spectroscopic properties of the calcium binding GFPs: To further explore this phenomenon, the proteins were purified. EGFP-D2-C2 and EGFP-G1-C2 (SEQ ID No.: 19) were much harder to purify than the parent proteins at the increased concentrations of the protein, indicating that the protein folds more efficiently and there were more soluble fractions that could easily be released during sonication. This was expected as EGFP-D2-C2 and EGFP-G1-C2 (SEQ ID No.: 19) had 37- and 19-fold higher fluorescence than their counterparts with no folding mutations.

(432) Spectroscopic properties of EGFP-based Ca.sup.2+ binding proteins were investigated using purified proteins. FIGS. 13A and 13B show the visible absorbance and fluorescence emission spectra of EGFP, EGFP-D2 (SEQ ID No.: 64), and EGFP-G1 (SEQ ID No.: 4) at pH 7.4.

(433) TABLE-US-00005 TABLE 5 Spectroscopic property of EGFP, EGFP-D2, and EGFP-G1 and their C2 and C3 mutations Extinction Coefficient Quantum (), M1cm1 Yield 398 nm 488 nm 488 nm EGFP 5126.6 55900 0 EGFP-C2 7184.3 55506 0 EGFP-C3 6672.1 55840 0 EGFP-G1 9228.1 28463 0 EGFP-G1-C2 14063 26999 0 EGFP-G1-C3 9906.1 28401 0 EGFP-D2 1291.5 9323.8 0 EGFP-D2-C2 5490.0 52989 0 EGFP-D2-C3 5404.6 56416 0

(434) Table 5 summarizes the spectroscopic properties of EGFP, EGFP-D2, and EGFP-G1 and their C2 and C3 mutations. As shown in FIG. 13A, a major absorbance peak at 488 nm and a minor absorbance peak at 398 nm appeared in the visible spectra of EGFP, indicating that the anionic state of chromophore was the main form in EGFP. A fluorescence emission peak at 510 nm was observed in EGFP fluorescence spectrum (FIG. 13B). The similar spectroscopic properties including both extinction coefficients and quantum yield constant at 398 nm and 488 nm (Table 1) indicate that there is no effect of C2 and C3 mutations on the visible absorption spectra in EGFP-C2 and EGFP-C3. The formation of a Ca.sup.2+-binding site by using three mutated ligands S2D, L194E and S86D and two natural ligands D82 and E5 of EGFP (EGFP-D2 (SEQ ID No.: 64)) resulted in a decrease of visible absorption at both 398 nm and 488 nm as observed in FIG. 13A. Comparing to EGFP, for example, the extinction coefficient at 488 nm of EGFP-D2 (SEQ ID No.: 64) was decreased from 55900 M.sup.1 cm.sup.1 to 9324 M.sup.1 cm.sup.1. Concurrently, the fluorescence emission peak at 510 nm was decreased in its fluorescence spectrum (FIG. 13B) although the quantum yield of EGFP-D2 (SEQ ID No.: 64) was almost same with that of EGFP. Strikingly, both C2 and C3 mutations in EGFP-D2 (SEQ ID No.: 64) reproduced the major absorbance peak at 488 nm and minor absorbance peak at 398 nm similar to that of EGFP (Table 5). Taken together, while the quantum yield is significantly increased for EGFP variants with both types of calcium binding sites, the relative distribution of ionic-neutral states of the chromophore was not altered by the addition of folding mutations.

Example 23

(435) Computational Design: The design of calcium-binding sites used the GFPc3 structure, 1 b9c, due to its 30,000-fold greater fluorescence than wild type GFP with expression at 37 C. The potential calcium binding sites were computationally constructed with the desired oxygen-calcium-oxygen angle, oxygen-calcium distance, ligand type, and number of ligands. One anchor Asp and four additional potential ligands from Asp, Asn, Glu, or the backbone were utilized. The calcium-oxygen length was in the range of 2.0 to 3.0 . The oxygen-calcium-oxygen angles ranged 45 from the theoretical angles of the ideal pentagonal bipyramid geometry (Biochemistry 44: 8267-73; J. Am. Chem. Soc. 127: 2085-2093; J. Am. Chem. Soc. 125: 6165-6171).

Example 24

(436) Cloning and purification of GFP variants: Site-directed mutagenesis was carried out by the classical polymerase chain reaction with pfu or turbo pfu (Invitrogen) and with EGFP DNA as the initial template and the forward primer sequence 5-ACGGCGACGCGAACCTCGCCGACC-3 (SEQ ID No.: 106) and the reverse sequence is 5-CCTCGTCGTTGTGGCGGATCTTG-3 (SEQ ID No.: 107). The linear DNA was ligated with T4 DNA ligase (Promega), and the circular DNA was amplified in E. coli (either DH5 or Top10) competent cells. The mutations to engineer 177c3 included the above mutations, with the addition of F99S, M153T, and V163A, known as cycle 3 (C3). The F99S forward and reverse primers 5-CGCACCATCTCCTTCAAGGACG-3 (SEQ ID No.: 108) and 5-CTCCTGGACGTAGCCTTCCC-3 (SEQ ID No.: 109), respectively. M153T and V163A were made, together with the forward primer 5-GAACGGCATCAAGGCGAACTTCAA-3 (SEQ ID No.: 110) and the reverse primer 5-TTCTGCTTGTCGGCCGTGATATAGA-3 (SEQ ID No.: 111). The mutations were carried out utilizing turbo pfu (Stratagene), following the manufacturer's protocol with annealing temperatures of 61 C. for F99S and 63 C. for 153/163. The DNA was purified with a Qiagen Miniprep kit, and the circular variant DNA was verified by automated sequencing at the GSU core facility.

(437) The vector pcDNA3.1+ (Invitrogen) was utilized during the mutagenesis and for the expression of the protein in mammalian cells in the cytosol. For expression of the protein in the ER, the pcDNA3.1+ vector was modified through PCR to contain the calreticulin signal peptide at the N-terminus of the protein and the KDEL retention sequence at the C-terminus. The N-terminal tag from calreticulin, MLLSVPLLLGLLGLAAAD (SEQ ID No.: 112) directs the expression of the gene to commence in the ER. The C-terminal tag, KDEL, is a retention sequence that retains the expressed protein in the ER and does not allow it to be shuffled to the Golgi. The N-terminus tag was inserted in two rounds of PCR with four primers due to its length. The proteins were expressed fused to a 6 histidine tag with a pet28a vector (EMD Biosciences) in LB medium containing 30 g/mL kanamycin. Protein expression was induced at an OD.sub.600 of 0.6 with 0.2 mM IPTG, and growth was continued for 3-4 hr before harvesting by centrifugation at 9500 g for 20 min. After breaking the cells with sonication, the proteins were dissolved with 8 M urea. The denatured protein was refolded by 10 dilution into the buffer (10 mM Tris, 1 mM DTT, 1% glycerol, pH 7.4) and was centrifuged to remove cellular debris. The refolded protein was purified using Sephadex G-75 size exclusion FPLC (10 mM Tris, pH 7.3) to greater than 95% purity. The expression and purity of the protein were analyzed by SDS-PAGE. The protein concentration was estimated using a calculated extinction coefficient of 21,890 M.sup.1 cm.sup.1 at 280 nm. The histidine tag used for purification did not have any effect on calcium and terbium binding.

Example 25

(438) Terbium fluorescence: All buffers for the metal binding and conformational analysis studies in this work were pretreated with Chelex-100 Resin (Bio-Rad). The terbium binding of the proteins was measured with a PTI fluorimeter following the emission at 545 nm with an excitation at 280 nm. For terbium titration, the initial protein concentration was 3 M in 20 mM PIPES, 10 mM KCl, 1 mM DTT, 1% glycerol, pH 6.8, for proteins GFP.Ca1-3 and 10 mM Tris, 1 mM DTT, 1% glycerol, pH 7.4 for GFP.Ca2. A 1.0 or 5.0 mM stock terbium containing the same concentration of protein was added directly into the protein samples. Blank samples consisted of the buffer with increasing terbium without protein. The data were baseline corrected, and the integrated area of the peak at 545 nm was fitted by assuming a 1:1 terbium:protein binding (J. Am. Chem. Soc. 125: 6165-6171). The data were also analyzed using Specfit/32 (Talanta, 33, 943). Each binding affinity is an average of 4 to 6 titrations. To investigate the metal selectivity, GFP.Ca1 and GFP.Ca2 (3 M) with 20 M terbium were incubated with 0.1 and 1 mM calcium, 10 mM magnesium, or 100 M lanthanum in 10 mM Tris, 1 mM DTT, 1% glycerol, pH 7.4; and the terbium fluorescence of each sample was measured.

Example 26

(439) Calcium binding dye competition: The protein (30 or 40 M) and Rhodamine-5N (approximately 20 M, Molecular Probes) (J. Biol. Chem. 264 19449-19457) were incubated in 10 mM Tris, 1 mM DTT, 1% glycerol, pH 7.4. A 100 mM CaCl.sub.2 stock containing the same concentrations of dye. Protein was gradually added into the mixture, and the fluorescence was measured with a 1 cm path length cell and an excitation of 552 nm. After the titration, the dye concentration was verified by absorbance at 552 nm with an extinction coefficient of 63,000 M.sup.1 cm.sup.1. The data were analyzed by globally fitting the spectra from 560 to 650 nm using Specfit/32 with the metal-ligand-ligand model (Talanta, 33, 943).

Example 27

(440) Mammalian cell transfection: Untransfected HeLa cells were maintained on 100 mm tissue culture dishes in filter-sterilized Dulbecco's Modified Eagle's Medium (DMEM, Sigma Chemical Co.) with 44 mM NaHCO.sub.3, pH 7.2, and were supplemented with 10% v/v Fetal Calf Serum (FCS, Hyclone), 100 U/ml penicillin and 0.1 mg/ml streptomycin (Pen/Strep, Sigma) at 37 C. with 5% CO.sub.2 in a humidified incubation chamber. The designed protein DNA was subcloned into pcDNA3.1+ vector (Invitrogen) for expression in mammalian cells through EcoRI and BamHI digestion, followed by ligation with T4 DNA Ligase. The DNA, confirmed by automated sequencing, was transfected into previously prepared 90% confluent HeLa (HEK293, Vero, or CHO) cells using Lipofectamine 2000 (Invitrogen) on 60 mm cell-culture-treated dishes. The DNA (3 g) was mixed with Lipofectamine 2000 in a 1:3 ratio in Opti-MEMI serum-free medium (Invitrogen) and was allowed to equilibrate at room temperature for 20 min in the dark before being added to the cells in Opti-MEMI medium. The transfection was allowed to proceed for 4 hrs at 37 C. and 5% CO.sub.2. The transfection medium was removed and was replaced with DMEM, 10% FCS, 1% Penicillin-Streptomycin Solution; and the cells were grown at 30 C. at 5% CO.sub.2 for 72 hrs. Mock-transfected HeLa cells were treated in the same way without DNA addition for a background control.

Example 28

(441) Microscopy Imaging: HeLa cells transfected with GFP.Ca1 were imaged 72 hrs following transfection. Coverslips with cells were transferred to a micro-incubation chamber (model MSC-TD, Harvard Apparatus, Holliston, Mass.). Briefly, imaging of GFP.Ca1 fluorescence was performed on a Nikon TE300 (Nikon Inc., Melville, N.Y.) inverted microscope equipped with a Nikon filter block optimized for GFP optics (.sub.ex480, .sub.em 510; Chroma Technology Corp, Rockingham, Vt.), a Metaltek filter wheel (Metaltek Instruments, Raleigh, N.C.) to regulate excitation light exposure times, a 75 watt xenon short arc lamp, a Hamamatsu CCD digital camera (Hamamatsu Corporation, Bridgewater, N.J.), and supported on a vibration isolation table. MetaFluor software (Universal Imaging Corp., v 3.5, Downington, Pa.) was utilized for image acquisition. Acquisition time was 50 ms with a gain of 1-3, depending upon the transfection efficiency.

(442) The fluorescence intensity of the transiently transfected GFP.Ca1 or GFP.Ca1c3 was monitored for several minutes to obtain a baseline value before the addition of ionomycin to the bath buffer to a final concentration of 2 M. The designed protein's fluorescence was imaged until the fluorescence intensity was stable (typically 2 min), and the intracellular calcium concentration was then manipulated by the subsequent addition of concentrated CaCl.sub.2 to obtain the targeted extracellular calcium concentration. Multiple additions of CaCl.sub.2 were typically spaced 1 min apart. Extracellular calcium concentrations were returned to basal levels by bath perfusion of HBSS.sup.++ buffer. EGFP without a calcium binding site was utilized as a control.

(443) To test the calcium response of the sensor expressed in the ER, 50-100 M ATP and 100 M histamine were added to the bathing medium to induce calcium release from the ER. Higher concentrations of ionomycin (2.5-5 M) were utilized to permeabilize the ER membrane and to allow for calcium uptake with addition of calcium to the bathing medium (10-100 mM). Thapsigargin (1 M) and calmidozolium (2 M) were added to the bathing medium to empty slowly the ER of calcium.

Example 29

(444) Application of engineered variants of EGFP as analyte sensors with high affinity and selectivity for Pb.sup.2+ and Gd.sup.3+ ions: Toxic metals (e.g. Gd.sup.3+, La.sup.3+, Tb.sup.3+, Pb.sup.2+, Sm.sup.3+, Sr.sup.2+, Hg.sup.2+ and Cd.sup.2+) can interact adversely with biological systems. While the toxicological effects of metals have been extensively studied, the mechanisms of toxicity relative to interaction with proteins are not fully-understood. Lead (Pb.sup.2+) is a persistent, anthropogenic toxic metal responsible for a variety of health problems related to neurological disorders, anemia, kidney damage, hypertension and male fertility decrease (Reprod. Toxicol. (2005). 20: 221-228; (2000) Am. J. Ind. Med. 38: 310-315; (2005) Neurotoxicol. Teratol. 27: 245-257; (1997) Annu. Rev. Nutr. 17: 37-50; (2001) Int. J. Toxicol. 20: 113-120; (2000) Int. J. Dev. Neurosci. 18: 791-795; (1987) Ann. N. Y. Acad. Sci. 514: 191-203). Lanthanides are known to block calcium channels in human and animal cells, and Pb.sup.2+, Cd.sup.2+, and Hg.sup.2+ will specifically target voltage-gated calcium channels ((2003) J. Bioenerg. Biomembr. 2003. 35: 507-532). There is, therefore, a strong need to develop inexpensive, benign materials for the detection and neutralization of toxic metals in natural systems, and for biological remediation. The present disclosure, therefore, encompasses the application of the engineered variants of EGFP of the disclosure as analyte sensors with high affinity and selectivity for such as Pb.sup.2+ and Gd.sup.3+ ions. The autofluorescence of GFP and its variants make it a versatile tag for metal-binding studies where the close proximity of a metal cation to a chromophore in the protein results in a detectable quenching of the fluorescent peaks ((2000) Biochem. Biophys. Res. Commun. 268: 462-465.)

Example 30

(445) Development of EGFP-Based Pb.sup.2+ and Ln.sup.3+ Sensors: EGFP protein variants designed for metal-binding and protease studies were developed via sub-cloning using PCR. Proteins were prepared for purification on a Ni.sup.2+-chelating sepharose column by the addition of a 6 His-tag. These variants provide the scaffold for mutagenesis studies to provide protein variants with high metal selectivity, and for use as a protease sensor. EMD Omnipur tris (hydroxymethyl)aminoethane (EMD Chemicals, Inc., Gibbstown, N.J.), or TRIS, was the buffering agent for the expressed proteins.

(446) Transformation: Recombinant pET28a vector comprising regions encoding EGFP variants were transformed into E. coli cell strain DE3 by heat shock for 90 s at 42 C. The sample was placed on ice for 2 minutes. LB Medium (50 L) was added and the sample incubated for 30 mins at 37 C. before plating on selective media.
Expression: Kanamycin was used at 0.03 mg/mL. 1.0 L LB media cultures were incubated to an A.sub.600 of 0.60.1isopropyl-beta-D-thiogalactopyranoside (IPTG) was added to a concentration of 0.2 mM, and the temperature reduced to 20-25 C. 1.0 mL samples were removed every hour for three hrs, followed by a final sample on the following day, to evaluate protein expression using SDS-PAGE gels. Cells were harvested and stored at 4 C.
Purification: A cell pellet was suspended in about 20 mL of extraction buffer (20 mM TRIS, 100 mM NaCl, 0.1% Triton x-100) and placed on ice. The sample was sonicated 630 s periods, with about 5 min intervals between sonications and centrifuged for 20 min at about 510.sup.4 g. The supernatant was filtered with 0.45 m pore size filter (Whatman, Florham Park, N.J.) and diluted with the appropriate binding buffer prior to injection into an FPLC system.

(447) Purification of EGFP variants was completed using an Aktaprime FPLC (Amersham Biosciences, Piscataway, N.J.) equipped with a UV detector and a 280 nm optical filter. For most purifications, a Hitrap 5 mL HP Chelating sepharose column was used. The binding Buffer A was 1 M K.sub.2HPO.sub.4, 1 M KH.sub.2PO.sub.4, 250 mM NaCl, pH 7.4 and elution Buffer B was of Buffer A and 0.5 M imidazole.

(448) The column was first rinsed with 100 mM EDTA, 1 M NaCl, pH 8.0 to remove metals, and rinsed with distilled water. The column was then washed with 0.1 M NiSO.sub.4 to bind Ni.sup.2+ onto the column, which was rinsed again with distilled water to remove unbound NiSO.sub.4.

(449) For additional protein purification, a Hitrap Q Ion Exchange column (GE Healthcare, Piscataway, N.J.) was used. The binding Buffer A was 20 mM TRIS, pH 8.0 and the elution Buffer B was of 20 mM TRIS, 1 M NaCl, and pH 8.0.

(450) Protein injections onto the column were limited to 5-8 mL and eluted bound protein was collected in 8 mL fractions that were then further purified by dialysis in 2.0 L of 10 mM TRIS, 1 mM Dithiothreitol, pH 7.4. Protein fractions were dialysed in dialysis bags with a molecular weigh cutoff value of 3,500 Da for 72 hrs to remove imidazole and other impurities. Purity was evaluated using SDS-PAGE gels.

Example 31

(451) Spectroscopic Analysis: Fluorometric spectral analyses of EGFP variants were conducted with excitation slit widths set at 1 nm, to reduce photobleaching of the proteins, and the emission slit widths were set at 2 nm. Excitation wavelengths of 398 nm and 490 nm were used. Data from the fluorometers were collected at 1 nm intervals.

(452) The selectivity of the EGFP-based sensors for Pb.sup.2+ and Gd.sup.3+ was examined by monitoring the change of the fluorescence ratio F.sub.(398nm)/F.sub.(490nm) obtained with 1.0 mM Ca.sup.2+ in the presence of the test metal ions.

(453) The ratiometric change from the metal-free protein to the metal-protein complex was calculated by integrating the peak areas for each of the emissions scans (398 nm and 488 nm) from 500-600 nm as a sum of the intensities recorded at each 1 nm interval, and then evaluating the ratio of (F398/F488), as seen in Eq. 13.

(454) Ratiometric change = ( F 398 / F 488 ) = ( .Math. 500 600 Counts 3 98 .Math. 500 600 Counts 488 ) ( Eq . 13 )

(455) The ratio eliminates possible errors associated of absolute intensity values due to instrumental variations.

(456) The fluorescent ratiometric change (F398/F490) was evaluated for 1.0 M of the EGFP variants to evaluate selectivity between Ca.sup.2+ and either Pb.sup.2+ or Gd.sup.3+ in 10 mM TRIS-Cl, pH 7.4. First, 1 mM Ca.sup.2+ was added to the protein, followed by aliquots of the competing metal.

(457) The affinity of a competing ion was assumed to be directly proportional to the change in the ratio (F398/F490), as calculated using Equation 11. To calculate the K.sub.eq for the competitive titration, the value for the fraction of the competing ion (F) was normalized across the range of concentrations evaluated. This F Normalized value (F.sub.Norm) was calculated with Eq. 14.
F.sub.Norm=(F.sub.Ca initialF.sub.M+)/(F.sub.Ca initialF.sub.M+ final)(Eq. 14)

(458) In Equation 3, F.sub.Ca initial is the initial ratio (F398/F490) following addition of Ca.sup.2+, F.sub.M+ is the ratio at each point of addition of a competing metal ion, and F.sub.M+ final is the ratio at the final concentration of metal. K for the competitive titration was the calculated in using the curve-fitting equation:
F.sub.Norm=((([P].sub.t+[M].sub.tK)(([P].sub.t+[M].sub.t+K).sup.24[P].sub.t[M].sub.t).sup.1/2)/2[P].sub.t)+(C*[M].sub.t)(Eq. 15)
where the final term, (C*[M].sub.t), accounts for non-specific binding. The K.sub.d for Pb.sup.2+ or Gd.sup.3+ was calculated using Eq. 4, with K calculated from Eq. 15, and the K.sub.d for Ca.sup.2+ which was previously determined for the EGFP-C2 variant to be 440 M.
K.sub.dM+=K/(1+([Ca.sup.2+]/K.sub.dCa))(Eq. 16)

(459) The absorbance scan encompassed the range of 600-220 nm.

Example 32

(460) It was determined from competitive titrations that Gd.sup.3+ and Pb.sup.2+ displace Ca.sup.2+ in the binding sites of the engineered EGFP variants of the disclosure. FIG. 18 shows the normalized ratiometric changes associated with displacement of Ca.sup.2+ by Pb.sup.2+. FIG. 19A to D show changes in fluorescence intensity resulting from displacement of Ca.sup.2+ by Pb.sup.2+, and a 2-3 nm red shift in the spectra near 10 M Pb.sup.2+. This red shift is believed to be the result of conformational changes relative to the chromophore, unrelated to displacement of Ca.sup.2+ which had already occurred. These data were then used to calculate binding affinities for both Gd.sup.3+ and Pb.sup.2+.

(461) For the EGFP-C2 variant analyzed in this work, the binding affinities for Pb.sup.2+ and Gd.sup.3+ were both found to be approximately 200 times higher than for Ca.sup.2+ (FIGS. 19B and 19D). For the other EGFP variant (SEQ ID Nos.: 18 and 19), the binding affinity for Pb.sup.2+ was found to be over 100 times higher than Ca.sup.2+. (FIG. 19C). These higher affinities, coupled with the conformational changes associated with the binding of these metals, suggests an important relationship to toxicity. It also provides for a sensor capable of high-affinity binding for Pb.sup.2+ and Gd.sup.3+.

Example 33

(462) CatchER biosensor family design strategy: Based on key determinants for fine-tuning Ca.sup.2+ binding affinity and Ca.sup.2+-induced conformational changes and the established chromophore properties of fluorescent proteins, Ca.sup.2+ sensors with fast fluorescence response were designed by coupling Ca.sup.2+ binding sites directly to the chromophore rather than relying on stretched protein-protein interaction to modulate chromophore conformation.

(463) The computationally-assisted design was based on the following criteria and considerations: (i) it requires four or five oxygen ligand atoms from protein residues (typically, carboxyl groups of D, E, N, Q) situated in the spherical geometry characteristic of natural Ca.sup.2+ binding proteins; (ii) appropriate choice of residue charge and type can be chosen to fine-tune Ca.sup.2+ binding affinity and metal selectivity; (iii) diffusion-limited access of Ca.sup.2+ to the site requires good solvent accessibility; (iv) propagating Ca.sup.2+-induced, local conformational and electrostatic changes to the chromophore can be achieved by properly locating of the charged ligand residues with respect to it; (v) these changes must occur rapidly than the rate of conversion from a neutral to anionic state ascribed to these chromophores; and (v), the created binding site must not interfere with the chromophore's synthesis and formation. The EGFP variant with the M153T/V163A mutation (EGFP Cycle 2) was chosen as the scaffold protein because of its high fluorescence intensity, folding efficiency, and thermostability.

Example 34

(464) Plasmid construction, protein expression, and purification: Bacterial expression plasmids for EGFP variants D8 to D12 were constructed by site-directed mutagenesis on cycle 2 EGFP (F64L/S65T/M153T/T163A) inserted in the pET28a vector (EMD Biosciences, San Diego, Calif.) vector between the BamHI and EcoRI restriction enzyme cleavage sites. The DNA sequence of the designed EGFP variants between these two restriction sites were cleaved and inserted into pcDNA3.1+ vector (Invitrogen, Carlsbad, Calif.). Calreticulin ER targeting sequence (CRsig) MLLSVPLLLGLLGLAAAD (SEQ ID No.: 112) and ER retention sequence KDEL were added to the N- and C-termini, respectively, to construct the mammalian cell expression plasmids. CatchER (D11) and its variants (D8-D10 and D12) were bacterially expressed in Escherichia coli BL21(DE3) and purified using established methods (Heim & Tsien (1996) Curr. Biol. 6:178-182; Zou et al., (2007) Biochemistry 46: 12275-12288).

Example 35

(465) In situ measurement of CatchER's Ca.sup.2+ dissociation constant: CatchER's Ca.sup.2+ dissociation constant (K.sub.a) was measured in BHK and C2C12 cells. ER Ca.sup.2+ in BHK cells was depleted by applying 100 M histamine and 5 M thapsigargin in Ringer 0 Ca.sup.2+ buffer. Cells were permeabilized in 100 M digitonin in intracellular-like solution containing 140 mM KCl, 10 mM NaCl, 1 mM MgCl.sub.2, 20 mM Hepes, pH 7.25. Calibration buffers were prepared by adding Ca.sup.2+ to the intracellular-like solution, reaching final concentrations of 0.05, 0.1, 0.5, 1, 5, and 10 mM, and 200 M EGTA buffer. F.sub.min and F.sub.max were determined in 200 M EGTA and 10 mM Ca.sup.2+ with no Ca.sup.2+ ionophore, respectively.

(466) Similar in situ K.sub.d calibration was conducted in C2C12 myoblasts. ER Ca.sup.2+ of permeabilized cells was depleted in intracellular buffer containing 10 M IP3 and 2 M thapsigargin. For calibration, 1, 3, 10, and 20 mM Ca.sup.2+ buffers were applied in the presence of 5 M ionomycin. F.sub.min and F.sub.max were determined in 3 mM EGTA and 20 mM Ca.sup.2+, respectively.

(467) The fluorescence was normalized according to the equation:

(468) f = F - F min F max - F min
and K.sub.d determined by the Hill-equation:

(469) f = [ Ca 2 + ] n K d + [ Ca 2 + ] n
The Kd was 1.070.26 mM (0.900.19 Hill coefficient) in BHK cells and 1.090.20 mM (0.940.17 Hill coefficient) in C2C12 cells.

Example 36

(470) Kinetic analysis of Ca.sup.2+ binding to CatchER by stopped-flow: The fluorescence kinetics of bacterially expressed CatchER was investigated using an SF-61 stopped-flow spectrofluorometer (Hi-Tech Scientific, Salisbury, UK; 10-mm path length, 2.2-ms deadtime at room temperature) at 22 C. Fluorescence intensity changes were recorded with a 455 nm long-pass filter with excitation at 395 nm. Equal volumes of Ca.sup.2+-free protein in 10 mM Tris-Cl at pH 7.4 and Ca.sup.2+ in the same buffer were mixed in the stopped-flow spectroflurometer, yielding final concentrations of 10 M CatchER and 50, 100, 200, 300, 500, and 1000 M Ca.sup.2+. The stopped-flow traces were fit to Eq. (1), which describes F, the fluorescence intensity at any given time; F.sub., the fluorescence at infinite time; and F, the amplitude of the fluorescence change.
F=F.sub.Fexp(k.sub.obs.Math.t)17)
F=F.sub.+Fexp(k.sub.obs.Math.t)18)
k.sub.obs.Math.=ln 219)

Example 37

(471) Apparent pK.sub.a determination by pH profile: The apparent pK.sub.a of Ca.sup.2+-free or Ca.sup.2+-loaded CatchER was determined with bacterially expressed protein by fitting the fluorescence intensity change at 510 nm (ex=488/395 nm). 5 M protein was dissolved in different buffers with pH ranging from 4.5 to 9.5 in the presence of either 10 M EGTA (apo) or 4 mM Ca.sup.2+ (holo), and the actual pH was determined after measuring fluorescence. The proposed interaction scheme is

(472) HP + H + + P 20 ) pH = pKa + log [ P ] [ HP + ] f = F - F min F max - F min 21 ) F min = [ P ] T c 1 22 ) F max = [ P ] T c 2 23 ) F = ( [ P ] T - [ P ] ) c 1 + [ P ] c 2 24 ) f = [ P ] T c 1 - [ P ] c 1 + [ P ] c 2 - [ P ] T c 1 [ P ] T c 2 - [ P ] T c 1 = [ P ] [ P ] T 25 ) [ P ] [ HP + ] = 1 1 / f - 1 26 ) f = 1 1 + exp ( pKa - pH c ) 27 )
H.sup.+ is the proton; P is the CatchER protein; f, the normalized F change; [P].sub.T, the total protein concentration; c.sub.1 or c.sub.2 is the extinction coefficient of HP.sup.+ or P fluorescence, respectively; F is the real-time fluorescence; F.sub.min, the fluorescence at the lowest pH; F.sub.max, the fluorescence at the highest pH; c is a constant for adjustment. The value theoretically equals Ige. The apparent pK.sub.a, fitted by a single exponential (Eq. 11), were 7.590.03 and 6.910.03 for apo and holo forms excited at 488 nm and 7.140.02 and 6.950.06 at 395 nm, respectively.

Example 38

(473) CatchER:Ca.sup.2+ stoichiometry studied by the Job Plot: The stoichiometry of the CatchER and Ca.sup.2+ interaction was determined at the maximal relative amount of Ca.sup.2+-bound CatchER in the Job Plot (15). Ca.sup.2+-free and bound [CatchER] were converted to fluorescence intensity following the equation: F=S.sub.f.Math.C.sub.f+S.sub.b.Math.C.sub.b, where F is the apparent fluorescence intensity; S.sub.f and S.sub.b are the coefficients of Ca.sup.2+ free and bound CatchER, respectively; and C.sub.f and C.sub.b are the concentration of Ca.sup.2+ free and bound CatchER, respectively. The relative amount of Ca.sup.2+ bound CatchER (C.sub.b.Math.V, V=1) was calculated using the Eq. (12). Fluorescence emission (.sub.ex=488/395 nm) and absorbance spectra were recorded with [CatchER]: 28.7, 23.3, 19.4, 15.1, 11.6 M in response to [Ca.sup.2+]: 11.3, 16.7, 20.6, 24.9, 28.4 M, respectively.

(474) F Ca 2 + - bound F Ca 2 + - free = S f .Math. C f + S b .Math. C b S f .Math. C T = S f ( C T - C b ) + S b .Math. C b S f .Math. C T = 1 + C b .Math. ( S b - S f ) S f .Math. C T 28 ) a = S b - S f S f 29 ) C b C T .Math. a = F Ca 2 + - bound F Ca 2 + - free - 1 30 ) C b .Math. V = ( F Ca 2 + - bound F Ca 2 + - free - 1 ) .Math. C T a 31 )

Example 39

(475) NMR Spectroscopy: All NMR experiments were performed at 37 C. using a Varian 800 or 600 MHz spectrometer. Typically, NMR samples contained 0.3 mM .sup.15N- or .sup.13C, .sup.15N-labeled protein in 10 mM Tris, 10 mM KCl, 10% D.sub.2O, pH 7.4. For backbone assignment of .sup.1H, .sup.13C, and .sup.15N resonances, a HNCA was collected on a Varian Inova 800 MHz spectrometer, and a CBCA(CO)NH was collected on a Varian Inova 600 MHz spectrometer, both equipped with a cryogenic probe. For Ca.sup.2+ titration, {.sup.1H, .sup.15N} HSQC spectra were collected, and chemical shift perturbations calculated using the equation .sub.av={0.5[(.sup.1H.sup.N).sup.2+(0.2(.sup.15N)).sup.2]}.sup.1/2, where is the change in chemical shift between the apo and Ca.sup.2+-loaded form. Rotational correlation time (.sub.c) was measured using a shared, constant-time, cross-correlated relaxation (SCT-CCR) pulse sequence. In this measurement, a series of highly sensitive HSQC spectra were collected at relaxational acquisition times from 0 to about 100 ms. Residue-specific .sub.c values were then extracted from the exponential decay rates. T1 and T2 were collected on a Varian Inova 600 MHz spectrometer. Integrations of peak collected at 0, 30, 60, 100, 240, 480, 720, 1000, and 1500 ms (T1) and 10, 30, 50, 70, 90, 110, 130, and 150 ms (T2) were fitted with I=I.sub.0exp(t/T.sub.1/2), where I.sub.0 is the intensity at zero decay, and t, the relaxation decay. .sub.c values were calculated following the equation below:
.sub.c=(2.sub.N).sup.1.Math.{square root over ((6T.sub.1/T.sub.27))}32)
.sub.N=2.Math.f.sub.N33)

Example 40

Structure Analysis of Catcher and its Variants by NMR and Verified by X-Ray

(476) The reality of calcium binding to the sensor can be further proved by calcium titration by NMR after the construction of the relationship between fluorescence intensity and calcium concentration. The condition of sample preparation is very important to affect the quality of the NMR spectra as the protein is the beta-sheet protein which has the tendency to be aggregation. One of the factors is the temperature that will influence the desperation of the peaks, so we test the D11 spectra quality in different temperatures in 500 MHz NMR. FIG. 32 shows the temperature dependent NMR HSQC spectra changes of CatchER.

(477) The peak number increases from 128 to 194 along with the temperature raise from 20 C. to 37 C. As the total amino acid number of EGFP is 238, the optimal temperature for the experiment operation is above 37 C.

(478) Prior to the gNhsqc calcium titration, 1D NMR calcium titration was operated to roughly detect chemical shifts and besides the sidechains dispersed around 0 to 6 ppm, the major chemical shifts of the NH group were approximate 6.6 to 7.8 ppm which was later proved to be from sidechain NH. The region of 8 to 11 ppm did not exhibit obvious shift due to the huge number of peaks overlap together what was insensitive to be distinguished.

(479) gNhsqc is conducted to verify the chemical shift of each residues as 1D experiment is not effective enough to explore such a huge protein. The protein with the concentration of 0.3 mM is dissolved in 10 mM pH 7.4 Tris buffer and 10% of D.sub.2O for the final concentration. The operation temperature is 40 C. for 600 MHz NMR. FIG. 33 shows a 1D NMR spectra of chemical shift changes of CatchER triggered by Ca.sup.2+.

(480) Salt effect should firstly be examined to verify whether D11 can nonspecifically bind to monovalent cations. 0.1 mM EGTA was added into the sample as the starting points and then titrated with 10 mM KCl to monitor the chemical shifts. After these two spectra overlapped, they perfectly matched. It hinted that high concentration salt could not cause conformation change of the protein so that there is no nonspecific binding.

(481) X-ray crystal structure of Ca2+_free_CatchER, Ca2+_loaded CatchER Ca2+-free CatchER exhibited a major absorption peak at 395 nm and a minor peak at 490 nm, which is similar to the wtGFP, with a ratio of 395 nm to 490 nm 3.0 measured in vitro (Tang, et. al.). From the crystal structures of Ca2+ free and loaded form CatchER (FIG. 34), the sidechain of 222 rotated to change the distance of hydrogen bonds between carboxyl group of sidechain Glu222 and Ser205 and hydroxyl group of chromophore. The proposed hydrogen networks surrounding the chromophore are based on the previous reported crystal structure of wtGFP (pdb code: 1EMB) and EGFP (pdb code: 1EMA). The previous reported wtGFP from A jellyfish has two absorption peaks at 390 nm (major) and 490 nm (minor), suggesting a mixture of two forms of chromophore co-existed in one fluorescent protein (Heim, 1996). Though from the DNA sequence alignment, the site directed mutagenesis S65T is the cause of the major difference, however, the chromophore of wtGFP and EGFP can be overlapped well from the crystal structure, but the sidechain surrounding the chromophore exhibited different conformation, especially for Thr203 and Glu222 (Baird, 1997). In wtGFP, the mainchain of Thr203 distantly interacts with the chromophore through a water molecule (Reminton, 1996 and Tsien, 1998), while for EGFP, the polar sidechain hydroxyl oxygen interact oxygen atom of chromophore directly, forming a short hydrogen bond 2.5 A, and stabilize the chromophore at anionic form, causing a major absorption peak at 490 nm. This stabilization is further enhanced by the special orientation of sidechain carboxyl group of E222, the only negative charged residue protrude toward the chromophore, forming a restricted hydrogen network among E222, V61 and T65 conjugated within the chromophore. However, the oxygen of Tyr66 of wtGFP only directly interacts with H.sub.2O without forming hydrogen bonds with polar residues, maintained neutral form, contributing to the major absorption peak at 395 nm. The two oxygen atoms of the carboxyl group of E222 are equally partially charged forming hydrogen bonds with Ser205 and chromophore. A hydrogen bridge between the hydroxyl group of T65 and Y66 is formed via E222, S205 and a water molecule, ensuring an efficient electron transfer between polar residues within the chromophore. An interesting observation of carboxyl group of E222 rotating between Ca.sup.2+-free and loaded form CatchER from the crystal structure, altering the distance of the hydrogen bonds between the carboxyl group of E222 to S205 and chromophore. Up to now, the rotation of Glu222 triggered by analyte binding has not been reported, especially correlated with the optical properties change. It is possible that the E222 sidechain rotation in response to Ca.sup.2+may contribute to the fast kinetics of CatchER as a single residue rotation is faster than long-range protein-protein interaction in FRET pair based sensor. However, this sidechain rotation of Glu222 was not observed in comparison of Gd.sup.3+-free and Gd.sup.3+-soaking CatchER structure (FIG. 35, it is plausible that the residues buried inside the beta-barrel structure of GFP did not exhibit further conformational change after crystallization, even during the metal soaking, though fluorescent intensity of CatchER was dramatically enhanced after adding Gd3+ during in vitro titration. The other key residue Thr203 of CatchER maintained one hydrogen bond between the main chain oxygen and water close to chromophore in all of metal-free, Ca.sup.2+-loaded and Gd.sup.3+-loaded form CatchER, similar to the wtGFP, suggesting that the fluorescent intensity of Ca.sup.2+-loaded CatchER only recover 50% of EGFP is possibly due to the fixe hydrogen bond network close to the phenol group of Tyr66 of chromophore maintained similar to wtGFP.

(482) TABLE-US-00006 Sequencelistings: <SEQIDNo.:1;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLys ValAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGly MetAspGluLeuTyrLys <SEQIDNo.:2;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLys ValAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGly TyrIleSerAlaAlaGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeu LeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeu GluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:3;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLys ValAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisValMetThr AsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAsp AsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheVal ThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:4;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLys ValAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGly TyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThr ProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGlu LysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:5;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArgMetValSer LysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerVal SerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValPro TrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhe PheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAlaGlu ValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIleLeuGly HisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLysValAsnPheLys IleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAla GluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAsp GlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:6;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHis SerLeuGlySerGlyProSerArgMetValSerLysGlyMetValSerLysGlyGluGluLeuPheThrGlyValValProIle LeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAspAlaThrTyr8GlyLys LeuThrLeuLysPheIleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThrLeuThrTyrGlyVal GlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGlu ArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAspThrLeu160ValAsn ArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsn1IleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHis AsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLysValAsnPheLysIleArgHisAsnIleGluGluGluGluIle ArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisVa1240MetThrAsn LeuAspGlySerValGlnLeuAlaAspHisTyrGlnGln2AsnThrProIleGlyAspGlyProValLeuLeuProAspAsn HisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThr AlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys310 <SEQIDNo.:7;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluSerGluGluGluLysArgGluAlaGluArgValPheAspLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisAlaAlaThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:8;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAsnLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:9;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAsnLysAsnGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:10;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:11;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAspGlyThrIleThrThrLysGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThrLeu GlyMetAspGluLeuTyrLys <SEQIDNo.:12;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerCysAspLysPheLeuAspAspAsp IleThrAspAspIleMetCysAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAsp ProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:13;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerAlaAspLysPheLeuAspAspAspIle ThrAspAspIleMetCysAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:14;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerCysAspLysPheLeuAspAspAsp IleThrAspAspIleMetAlaAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:15;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerAlaAspLysPheLeuAspAspAspIle ThrAspAspIleMetAlaAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:16;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThr LeuGlyMetAspGluLeuTyrLys <SEQIDNo.:17;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsn GlyTyrIleSerAlaAlaGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProVal LeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp24HisIleValLeu LeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:18;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisValMet ThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuPro AspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleVa124LeuLeuGlu PheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:19;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:20;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArgMetValSer LysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerVal SerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValPro TrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhe PheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAlaGlu ValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsn16IleLeu GlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPhe LysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAla AlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGln24AsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:21;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHisSer LeuGlySerGlyProSerArgMetValSerLysGlyMetValSerLysGlyGluGluLeuPheThrGlyValValProIle LeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLys LeuThrLeuLysPheIleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThrLeuThrTyrGlyVal GlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGlu ArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAspThrLeu16ValAsn ArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHis AsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArg GluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisVa124MetThrAsnLeuAsp GlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyr LeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla GlyIleThrLeuGlyMetAspGluLeuTyrLys31 <SEQIDNo.:22;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluSerGluGluGluLysArgGluAlaGluArgValPheAspLysAspGly AsnGlyTyrIleSerAlaAlaGluLeuArgHisAlaAlaThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAsp ProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:23;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAsnLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:24;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAsnLysAsnGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:25;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:26;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAspGlyThrIleThrThrLysGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThr LeuGlyMetAspGluLeuTyrLys <SEQIDNo.:27;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerCysAspLysPheLeuAspAspAsp IleThrAspAspIleMetCysAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAsp ProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:28;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerAlaAspLysPheLeuAspAspAspIle ThrAspAspIleMetCysAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:29;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerCysAspLysPheLeuAspAspAsp IleThrAspAspIleMetAlaAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:30;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerAlaAspLysPheLeuAspAspAspIle ThrAspAspIleMetAlaAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGln AsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:31;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThrLeu GlyMetAspGluLeuTyrLys <SEQIDNo.:32;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGly TyrIleSerAlaAlaGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeu LeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp24HisIleValLeu LeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:33;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisValMet ThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuPro AspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleVa124LeuLeuGluPhe ValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:34;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGly TyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspProAsn GluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:35;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArgMetValSer LysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerVal SerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValPro TrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhe PheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLysThrArgAlaGlu ValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsn16IleLeu GlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPhe LysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAla AlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGln24AsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:36;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHis SerLeuGlySerGlyProSerArgMetValSerLysGlyMetValSerLysGlyGluGluLeuPheThrGlyValValProIle LeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLys LeuThrLeuLysPheIleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThrLeuThrTyrGlyVal GlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGlu ArgThrIleSerPheLysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAspThrLeu16ValAsn ArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsn ValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGlu AlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisVa124MetThrAsnLeuAsp GlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyr LeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGly IleThrLeuGlyMetAspGluLeuTyrLys31 <SEQIDNo.:37;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluSerGluGluGluLysArgGluAlaGluArgValPheAspLysAspGlyAsn GlyTyrIleSerAlaAlaGluLeuArgHisAlaAlaThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:38;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAsnLysAspGlyAsnGly TyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspProAsn GluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:39;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAsnLysAsnGlyAsnGly TyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspProAsn GluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:40;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGly TyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspProAsn GluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:41;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspLysAspGlyAspGlyThrIleThrThrLysGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThrLeu GlyMetAspGluLeuTyrLys <SEQIDNo.:42;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerCysAspLysPheLeuAspAspAspIle ThrAspAspIleMetCysAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:43;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerAlaAspLysPheLeuAspAspAspIle ThrAspAspIleMetCysAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:44;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerCysAspLysPheLeuAspAspAspIle ThrAspAspIleMetAlaAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:45;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluSerArgAsnIleCysAspIleSerAlaAspLysPheLeuAspAspAspIle ThrAspAspIleMetAlaAlaLysLysIleLeuAspIleLysGlyAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeu24SerLysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:46;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnAspLys16AspGly AsnGlyTyrIleSerAlaAlaGluLysAsnGlyIleLysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThrLeu GlyMetAspGluLeuTyrLys <SEQIDNo.:47;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnGluGlu16GluIle ArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeu LysAsnGlyIleLysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:48;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnAspLys16AspGly AsnGlyTyrIleSerAlaAlaGluLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThrLeu GlyMetAspGluLeuTyrLys <SEQIDNo.:49;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnGluGlu16GluIle ArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeu LysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:50;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnAspLys16AspGly AsnGlyTyrIleSerAlaAlaGluLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGln LeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGln SerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAla24GlyIleThrLeu GlyMetAspGluLeuTyrLys <SEQIDNo.:51;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnGluGlu16GluIleArg GluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIleSerAlaAlaGluLeuArgHisValMetThrAsnLeuLys AsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspProAsn GluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:52;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:53;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnThrGluGluGlnIleAlaGluPheLysGluAlaPheSerLeuPheAspLysAsp GlyAspGlyThrIleThrThrLysGluLeuGlyThrValMetArgSerIleGluAspGlySerValGlnLeuAlaAspHisTyr GlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSer24AlaLeuSer LysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeu TyrLys <SEQIDNo.:54;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspPro AsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:55;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnThrGluGluGlnIleAlaGluPheLysGluAlaPheSerLeuPheAspLysAsp GlyAspGlyThrIleThrThrLysGluLeuGlyThrValMetArgSerIleGluAspGlySerValGlnLeuAlaAspHisTyr GlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSer24AlaLeuSer LysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeu TyrLys <SEQIDNo.:56;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsn ThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSer24LysAspProAsn GluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys27 <SEQIDNo.:57;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnThrGluGluGlnIleAlaGluPheLysGluAlaPheSerLeuPheAspLysAspGly AspGlyThrIleThrThrLysGluLeuGlyThrValMetArgSerIleGluAspGlySerValGlnLeuAlaAspHisTyrGln GlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSer24AlaLeuSerLys AspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeu TyrLys <SEQIDNo.:58;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValAspPheGluGlyAspThrLeuAsnAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:59;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleAsnValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuAsnAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:60;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnAspGluAspGlyAspValAsnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:61;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetAspGln HisAspPhePheAspSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:62;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetAspGln HisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:63;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisAsnLysGln AspAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnAspTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyAspThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:64;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:65;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArgMetValSer LysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerVal SerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValPro TrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhe PheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAla GluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsn16IleLeu GlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsnGlyIleLysValAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyPro ValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg24AspHisIle ValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:66;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHis SerLeuGlySerGlyProSerArgMetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAsp GlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPhe IleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArg TyrProAspHisMetLysGlnHisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePhe LysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGlu16LeuLys GlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAla AspLysGlnLysAsnGlyIleLysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHis TyrGlnGlnAsnThrProIleGlyAspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGln24SerAlaLeuSer LysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGlu LeuTyrLys <SEQIDNo.:67;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleAspValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuSerAsnGluIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:68;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspAspPheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrGluMetAspAspLysGlnLysAsn16GlyAsp LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:69;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProAspLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePheGluLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnSerLeuGlyHisLysAsnGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGluLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:70;PRT3;Artificialsequence> MetValSerLysGlyGluGluAspPheThrGlyValAsnProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaSerProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysAspGluGlyAspThrAspValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:71;PRT3;Artificialsequence> MetValSerLysGlyGluGluAspPheThrGlyValAsnProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaThrProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysAspGluGlyAspThrGluValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleMetAlaAspLysGlnLysAsn16GlyIle LysValAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:72;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValAspPheGluGlyAspThrLeuAsnAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:73;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleAsnValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuAsnAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:74;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnAspGluAspGlyAspValAsnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:75;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetAspGln HisAspPhePheAspSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:76;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetAspGln HisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:77;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisAsnLysGln AspAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnAspTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyAspThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:78;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:79;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArgMetValSer LysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerVal SerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValPro TrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhe PheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAla GluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsn16IleLeu GlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPhe LysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyPro ValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg24AspHisIleVal LeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:80;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHis SerLeuGlySerGlyProSerArgMetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAsp GlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPhe IleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArg TyrProAspHisMetLysGlnHisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIlePhePhe LysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGlu16LeuLys GlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAla AspLysGlnLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHis TyrGlnGlnAsnThrProIleGlyAspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGln24SerAlaLeuSer LysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGlu LeuTyrLys <SEQIDNo.:81;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleAspValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuSerAsnGluIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:82;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspAspPheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrGluThrAspAspLysGlnLysAsn16GlyAsp LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:83;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProAspLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePheGluLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnSerLeuGlyHisLysAsnGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGluLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:84;PRT3;Artificialsequence> MetValSerLysGlyGluGluAspPheThrGlyValAsnProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaSerProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysAspGluGlyAspThrAspValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:85;PRT3;Artificialsequence> MetValSerLysGlyGluGluAspPheThrGlyValAsnProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaThrProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysAspGluGlyAspThrGluValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:86;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValAspPheGluGlyAspThrLeuAsnAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:87;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleAsnValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuAsnAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:88;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnAspGluAspGlyAspValAsnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:89;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetAspGln HisAspPhePheAspSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:90;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetAspGln HisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValAsnLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:91;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisAsnLysGln AspAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnAspTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyAspThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:92;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:93;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArgMetValSer LysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerVal SerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValPro TrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhe PheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLysThrArgAlaGlu ValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsn16IleLeu GlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPhe LysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyPro ValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg24AspHisIleVal LeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:94;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHis SerLeuGlySerGlyProSerArgMetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAsp GlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPhe IleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArg TyrProAspHisMetLysGlnHisAspPhePheLysAspAlaMetProGluGlyTyrValGlnGluArgThrIleSerPhe LysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGlu16LeuLys GlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAla AspLysGlnLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHis TyrGlnGlnAsnThrProIleGlyAspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGln24SerAlaLeuSer LysAspProAsnGluLysArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGlu LeuTyrLys <SEQIDNo.:95;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleAspValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuSerAsnGluIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:96;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspAspPheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrGluThrAspAspLysGlnLysAsn16GlyAsp LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValGluLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArg AspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:97;PRT3;Artificialsequence> MetValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProAspLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIleSerGluLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnSerLeuGlyHisLysAsnGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIle LysAlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGluLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:98;PRT3;Artificialsequence> MetValSerLysGlyGluGluAspPheThrGlyValAsnProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaSerProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysAspGluGlyAspThrAspValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:99;PRT3;Artificialsequence> MetValSerLysGlyGluGluAspPheThrGlyValAsnProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLys PheSerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeu ProValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGln HisAspPhePheLysSerAlaThrProGluGlyTyrValGlnGluArgThrIleSerPheLysAspAspGlyAsnTyrLys ThrArgAlaGluValLysAspGluGlyAspThrGluValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGly AsnIleLeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsn16GlyIleLys AlaAsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGly AspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAsp HisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:100;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspGlySerGlyProSerArg <SEQIDNo.:101;PRT3;Artificialsequence> LysAspGluLeu <SEQIDNo.:102;PRT3;Artificialsequence> MetSerValLeuThrProLeuLeuLeuArgGlyLeuThrGlySerAlaArgArgLeuProValProArgAlaLysIleHis SerLeuGlySerGlyProSerArg <SEQIDNo.:103;PRT3;Artificialsequence> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:104;PRT3;Artificialsequence> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:105;PRT3;Artificialsequence> MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspValSerLysGlyGluGluLeuPhe ThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAsp AlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThr LeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhePheLysSerAlaMetProGlu GlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAsp ThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsn TyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGlu AspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHis TyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluGluValGluAla AlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:106;DNA;Artificialsequence> ACGGCGACGCGAACCTCGCCGACC <SEQIDNo.:107;DNA;Artificialsequence> CCTCGTCGTTGTGGCGGATCTTG <SEQIDNo.:108;DNA;Artificialsequence> CGCACCATCTCCTTCAAGGACG <SEQIDNo.:109;DNA;Artificialsequence> CTCCTGGACGTAGCCTTCCC <SEQIDNo.:110;DNA;Artificialsequence> GAACGGCATCAAGGCGAACTTCAA <SEQIDNo.:111;DNA;Artificialsequence> TTCTGCTTGTCGGCCGTGATATAGA <SEQIDNo.:112;PRT;Artificialsequence> MLLSVPLLLGLLGLAAAD <SEQIDNo.:113;PRT;Artificialsequence> DKDGNGYISAAE <SEQIDNo.:114;PRT;Artificialsequence> EEEIREAFRVFDKDGNGYISAAELRHVMTNL <SEQIDNo.:115;DNA;Artificialsequence> TATTACGTGTTCGCTGGCTaGCGTTTaACTTaAGCTTATGGGGGCCAGAGCAGTGTCCGAG CTGCGGCTGGCACTGCTGTTTGTACTGGTGCTAGGGACGCCCAGGTTAGGGGTCCAGGG GGAAGATGGGTTGGACTTCCCTGAGTACGACGGTGTGGACCGTGTGATCAATGTGAATGC CAAGAACTACAAGAACGTGTTTAAGAAGTATGAGGTGCTGGCCCTCCTCTACCATGAGCCC CCTGAGGACGACAAGGCCTCGCAGAGACAATTTGAGATGGAGGAGCTAATCCTGGAGTTA GCAGCCCAAGTCTTAGAAGACAAGGGTGTTGGCTTTGGCCTGGTGGACTCAGAGAAGGAT GCAGCTGTGGCCAAGAAACTAGGACTAACTGAAGAAGACAGCGTTTATGTGTTCAAAGGA GATGAAGTCATTGAATATGACGGCGAGTTTTCTGCAGACACTCTGGTGGAGTTTCTGCTTG ATGTCCTAGAAGACCCTGTAGAGTTGATTGAAGGTGAACGAGAGCTGCAGGCATTTGAGA ATATTGAAGATGAAATCAAACTCATTGGCTACTTCAAGAGCAAAGACTCAGAGCATTACAAA GCCTACGAGGACGCAGCTGAAGAGTTCCATCCCTACATCCCTTTCTTCGCTACCTTCGACA GCAAGGTGGCAAAGAAGCTGACTCTGAAGTTGAATGAGATTGATTTCTACGAGGCCTTCAT GGAAGAGCCTATGACCATCCCAGACAAGCCCAACAGTGAAGAGGAGATTGTGAGCTTCGT GGAGGAGCACAGGAGATCAACCCTGAGGAAACTGAAGCCTGAGAGTATGTACGAGACTTG GGAGGATGACCTGGATGGAATCCACACTGTCGCCTTTGCAGAGGAAGCAGATCCTGATGG CTATGAGTTCTTAGAGACTCTCAAGGCTGTGGCCCAAGACAACACTGAGAACCCCGACCT CAGTATCATCTGGATTGATCCTGATGACTTCCCGCTGCTGGTCCCGTACTGGGAGAAGAC CTTTGACATTGACCTGTCAGCTCCACAAATAGGAGTTGTCAATGTTACAGACGCGGACAGC ATATGGATGGAGATGGATAACGAGGAGGACCTGCCTTCTGCTGATGAGCTGGAGGACTGG CTGGAGGACGTGCTGGAGGGCGAGATCAACACAGAGGATGACGACGACGATGACGACGA TGACGATGATGACGATGATGACGACGACGGATCCGGGCCCTCTAGAATGGTGAGCAAGG GCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAAC GGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGAC CCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCAC CCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTT CTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGA CGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCA TCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAG TACAACTACAACGAGCACAACGTCTATATCACGGCCGACAAGCAGAAGAACGGCATCAAG GCGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTA CCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGG ACACCGAATCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTG GAGGAGGTGGAGGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAAGAATT CTGCAGATATCCAGCACAGTGGCGGCCGCTCGAGTCTAGAGGGCCCGTTTAAACCCGCT GATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGT <SEQIDNo.:116;PRT;Artificialsequence> ITCSLASVLKLMGARAVSELRLALLFVLVLGTPRLGVQGEDGLDFPEYDGVDRVINVNAKNYKN VFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGL TEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSK DSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPMTIPDKPNSEEEIVSF VEEHRRSTLRKLKPESMYETWEDDLDGIHTVAFAEEADPDGYEFLETLKAVAQDNTENPDLSII WIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSIWMEMDNEEDLPSADELEDWLEDVLE GEINTEDDDDDDDDDDDDDDDDDGSGPSRMVSKGEELFTGWPILVELDGDVNGHKFSVSGE GEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQ ERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNEHNVYITADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLDTESALSKDPNEKRDHMVLLEE VEAAGITLGMDELYK-EFXXQISSTVAAARV-RARLNPLISLDCAF-LPAICC <SEQIDNo.:117;DNA;Artificialsequence> TATTACGTGTTCGCTGGCTaGCGTTTaACTTaAGCTTATGGGGGCCAGAGCAGTGTCCGAG CTGCGGCTGGCACTGCTGTTTGTACTGGTGCTAGGGACGCCCAGGTTAGGGGTCCAGGG GGAAGATGGGTTGGACTTCCCTGAGTACGACGGTGTGGACCGTGTGATCAATGTGAATGC CAAGAACTACAAGAACGTGTTTAAGAAGTATGAGGTGCTGGCCCTCCTCTACCATGAGCCC CCTGAGGACGACAAGGCCTCGCAGAGACAATTTGAGATGGAGGAGCTAATCCTGGAGTTA GCAGCCCAAGTCTTAGAAGACAAGGGTGTTGGCTTTGGCCTGGTGGACTCAGAGAAGGAT GCAGCTGTGGCCAAGAAACTAGGACTAACTGAAGAAGACAGCGTTTATGTGTTCAAAGGA GATGAAGTCATTGAATATGACGGCGAGTTTTCTGCAGACACTCTGGTGGAGTTTCTGCTTG ATGTCCTAGAAGACCCTGTAGAGTTGATTGAAGGTGAACGAGAGCTGCAGGCATTTGAGA ATATTGAAGATGAAATCAAACTCATTGGCTACTTCAAGAGCAAAGACTCAGAGCATTACAAA GCCTACGAGGACGCAGCTGAAGAGTTCCATCCCTACATCCCTTTCTTCGCTACCTTCGACA GCAAGGTGGCAAAGAAGCTGACTCTGAAGTTGAATGAGATTGATTTCTACGAGGCCTTCAT GGAAGAGCCTATGACCATCCCAGACAAGCCCAACAGTGAAGAGGAGATTGTGAGCTTCGT GGAGGAGCACAGGAGATCAACCCTGAGGAAACTGAAGCCTGAGAGTATGTACGAGACTTG GGAGGATGACCTGGATGGAATCCACACTGTCGCCTTTGCAGAGGAAGCAGATCCTGATGG CTATGAGTTCTTAGAGACTCTCAAGGCTGTGGCCCAAGACAACACTGAGAACCCCGACCT CAGTATCATCTGGATTGATCCTGATGACTTCCCGCTGCTGGTCCCGTACTGGGAGAAGAC CTTTGACATTGACCTGTCAGCTCCACAAATAGGAGTTGTCAATGTTACAGACGCGGACAGC ATATGGATGGAGATGGATAACGAGGAGGACCTGCCTTCTGCTGATGAGCTGGAGGACTGG CTGGAGGACGTGCTGGAGGGCGAGATCAACACAGAGTGATGACGATGATGACGACGACG GATCCGGGCCCTCTAGAATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCC ATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGG CGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGC TGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGC CGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTAC GTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGT GAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGG AGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACGAGCACAACGTCTATA TCACGGCCGACAAGCAGAAGAACGGCATCAAGGCGAACTTCAAGATCCGCCACAACATCG AGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGC CCCGTGCTGCTGCCCGACAACCACTACCTGGACACCGAATCCGCCCTGAGCAAAGACCC CAACGAGAAGCGCGATCACATGGTCCTGCTGGAGGAGGTGGAGGCCGCCGGGATCACTC TCGGCATGGACGAGCTGTACAAGTAAGAATTCTGCAGATATCCAGCACAGTGGCGGCCGC TCGAGTCTAGAGGGCCCGTTTAAACCCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCC AGCCATCTGTTGT <SEQIDNo.:118;PRT;Artificialsequence> ITCSLASVLKLMGARAVSELRLALLFVLVLGTPRLGVQGEDGLDFPEYDGVDRVINVNAKNYKN VFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGL TEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSK DSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPMTIPDKPNSEEEIVSF VEEHRRSTLRKLKPESMYETWEDDLDGIHTVAFAEEADPDGYEFLETLKAVAQDNTENPDLSII WIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSIWMEMDNEEDLPSADELEDWLEDVLE GEINTEGSGPSRMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTG KLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVK FEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNEHNVYITADKQKNGIKANFKIRHNIEDGSVQLA DHYQQNTPIGDGPVLLPDNHYLDTESALSKDPNEKRDHMVLLEEVEAAGITLGMDELYKEFXX QISSTVAAARVRARLNPLISLDCAFLPAICC <SEQIDNo.:119;PRT;Artificialsequence> FCLTLRRRYTMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGPSRMVSKGEELFTGV VPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYP DHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGH KLEYNYNEHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLDIE SALSKDPNEKRDHMVLLEEVEAAGITLGMDELYKEFELRRQACGRTRVPPPPPLRSGCQSPK GSXGCCPTPLPXXRIRPXQRPXXSAXXXXCX <SEQIDNo.:120;PRT;Artificialsequence> XITCSLASVLKLGTELGSGPSRMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG KLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNEHNVYITADKQKNGIKANFKIR HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLDTESALSKDPNEKRDHMVLLEEVEAAGITLG MDELYKFYTLRFLALFLAFAINFILLFYKVSEFCRYPAQWRPLESRGPVTRSASTVPSSCQPSV <SEQIDNo.:121;PRT3;> (D8-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:122;PRT3;> (D9-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:123;PRT3;> (D10-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:124;PRT3;> (D11-EGFP,CatchERwithoutERtag) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:125;PRT3;> (D11-EGFP,CatchERwithERtag) MetLeuLeuSerValProLeuLeuLeuGlyLeuLeuGlyLeuAlaAlaAlaAspValSerLysGlyGluGluLeuPhe ThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPheSerValSerGlyGluGlyGluGlyAsp AlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuProValProTrpProThrLeuValThrThr LeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAspPhePheLysSerAlaMetProGlu GlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArgAlaGluValLysPheGluGlyAsp ThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIleLeuGlyHisLysLeuGluTyrAsn TyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsnPheLysIleArgHisAsnIleGlu AspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyProValLeuLeuProAspAsnHis TyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIleValLeuLeuGluGluValGluAla AlaGlyIleThrLeuGlyMetAspGluLeuTyrLysLysAspGluLeu <SEQIDNo.:126;PRT3;> (D12-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluAspValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:127;PRT3;> (D13-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrAsnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluAspValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:128;PRT3;> (D14-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisGluValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:129;PRT3;> (D15-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisGluValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:130;PRT3;> (D16-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisGluValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:131;PRT3;> (D11-EGFP-2031,CatchER-2031) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspIleGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:132;PRT3;> (D11-EGFP-203V,CatchER-203V) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspValGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:133;PRT3;> (D11-EGFP-203D,CatchER-203D) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspAspGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:134;PRT3;> (D11-EGFP-203F,CatchER-203F) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspPheGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:135;PRT3;> (D11-EGFP-203E,CatchER-203E) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspGluGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:136;PRT3;> (D11-EGFP-175G,CatchER-175G) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlyGlyValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyPro ValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:137;PRT3;> (D11-EGFP-148D,CatchER-148D) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluAspAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAla AsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:138;PRT3;> (G1M1-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLys ArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:139;PRT3;> (G1M2-EGFP) ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuGluGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLys ArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.:140;PRT;> (calsequestrintetheredCatchER) ITCSLASVLKLMGARAVSELRLALLFVLVLGTPRLGVQGEDGLDFPEYDGVDRVINVNAKNYKN VFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGL TEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSK DSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPMTIPDKPNSEEEIVSF VEEHRRSTLRKLKPESMYETWEDDLDGIHTVAFAEEADPDGYEFLETLKAVAQDNTENPDLSII WIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSIWMEMDNEEDLPSADELEDWLEDVLE GEINTEDDDDDDDDDDDDDDDDDGSGPSRMVSKGEELFTGWPILVELDGDVNGHKFSVSGE GEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQ ERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNEHNVYITADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLDTESALSKDPNEKRDHMVLLEE VEAAGITLGMDELYK-EFXXQISSTVAAARV-RARLNPLISLDCAF-LPAICC <SEQIDNo.:141;PRT;> (calsequestrin17AspdeletedtetheredCatchER) ITCSLASVLKLMGARAVSELRLALLFVLVLGTPRLGVQGEDGLDFPEYDGVDRVINVNAKNYKN VFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGL TEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSK DSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPMTIPDKPNSEEEIVSF VEEHRRSTLRKLKPESMYETWEDDLDGIHTVAFAEEADPDGYEFLETLKAVAQDNTENPDLSII WIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSIWMEMDNEEDLPSADELEDWLEDVLE GEINTEGSGPSRMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTG KLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVK FEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNEHNVYITADKQKNGIKANFKIRHNIEDGSVQLA DHYQQNTPIGDGPVLLPDNHYLDTESALSKDPNEKRDHMVLLEEVEAAGITLGMDELYKEFXX QISSTVAAARVRARLNPLISLDCAFLPAICC <SEQIDNo.142:D8-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.143:D9-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.144:D10-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.145:D11-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.146:D12-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluAspValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.147:D13-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrAsnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluAspValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.148:D14-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisGluValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGlnSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.149:D15-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisGluValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.150:D16-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisGluValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.151:D11-EGFP-203I> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspIleGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.152:D11-EGFP-203V> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspValGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.153:D11-EGFP-203D> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspAspGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.154:D11-EGFP-203F> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspPheGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.155:D11-EGFP-203E> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspGluGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.156:D11-EGFP-175G> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluAspGlyGlyValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGlyPro ValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.157:D11-EGFP-148D> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnGluAspAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAla AsnPheLysIleArgHisAsnIleGluAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIleGlyAspGly ProValLeuLeuProAspAsnHisTyrLeuAspThrGluSerAlaLeuSerLysAspProAsnGluLysArgAspHisIle ValLeuLeuGluGluValGluAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.158:G1M1-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnAspIleGluLeuLysGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLys ArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys <SEQIDNo.159:G1M2-EGFP> ValSerLysGlyGluGluLeuPheThrGlyValValProIleLeuValGluLeuAspGlyAspLeuAsnGlyHisLysPhe SerValSerGlyGluGlyGluGlyAspAlaThrTyrGlyLysLeuThrLeuLysPheIleCysThrThrGlyLysLeuPro ValProTrpProThrLeuValThrThrLeuThrTyrGlyValGlnCysPheSerArgTyrProAspHisMetLysGlnHisAsp PhePheLysSerAlaMetProGluGlyTyrValGlnGluArgThrIlePhePheLysAspAspGlyAsnTyrLysThrArg AlaGluValLysPheGluGlyAspThrLeuValAsnArgIleGluLeuGluGlyIleAspPheLysGluAspGlyAsnIle LeuGlyHisLysLeuGluTyrAsnTyrAsnSerHisAsnValTyrIleThrAlaAspLysGlnLysAsnGlyIleLysAlaAsn PheLysIleArgHisAsnIleGluGluGluGluIleArgGluAlaPheArgValPheAspLysAspGlyAsnGlyTyrIle SerAlaAlaGluLeuArgHisValMetThrAsnLeuAspGlySerValGlnLeuAlaAspHisTyrGlnGlnAsnThrProIle GlyAspGlyProValLeuLeuProAspAsnHisTyrLeuSerThrGlnSerAlaLeuSerLysAspProAsnGluLys ArgAspHisIleValLeuLeuGluPheValThrAlaAlaGlyIleThrLeuGlyMetAspGluLeuTyrLys