Genetically modified clostridium thermocellum engineered to ferment xylose
09546385 ยท 2017-01-17
Assignee
Inventors
- Aaron Argyros (White River Junction, VT)
- Trisha Barrett (Bradford, VT)
- Nicky Caiazza (Rancho Santa Fe, CA)
- Dave Hogsett (Grantham, NH, US)
Cpc classification
C12N9/1205
CHEMISTRY; METALLURGY
Y02E50/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N15/74
CHEMISTRY; METALLURGY
Y02P20/52
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N9/92
CHEMISTRY; METALLURGY
International classification
C12N9/92
CHEMISTRY; METALLURGY
C12N15/74
CHEMISTRY; METALLURGY
Abstract
One aspect of the invention relates to industrial bioconversion of the xylose portion of biomass materials into fuels and chemicals. Another aspect of the invention relates to industrial bioconversion of the xylan portion of biomass materials into fuels and chemicals. In one embodiment, the invention is directed to the bacterium Clostridium thermocellum, a highly cellulolytic organism that has much potential as a biocatalyst in a consolidated bioprocess configuration. In some embodiments, the invention is a genetic modification that confers the ability to ferment xylose to C. thermocellum and the strains created with this modification. In some embodiments, the genetic modification is composed of two genes contained in an operon from T. saccharolyticum. The genes express proteins with xylose isomerase (XI) and xylulokinase activites (XK). In other embodiments, the invention relates to a recombinant Clostridium thermocellum host cell capable of fermenting xylan.
Claims
1. A recombinant Clostridium thermocellum host cell capable of fermenting xylan, wherein the host cell comprises one or more heterologous polynucleotides encoding one or more xylanase enzymes, wherein the polynucleotide comprises a nucleotide sequence from any one of the nucleotide sequences of SEQ ID NOs: 5-21, wherein the host cell further comprises one or more additional heterologous polynucleotides encoding a xylose isomerase and/or a xylulokinase, and wherein the heterologous polynucleotide that encodes the xylose isomerase comprises the nucleotide sequence of SEQ ID NO: 1 and the heterologous polynucleotide that encodes the xylulokinase comprises the nucleotide sequence of SEQ ID NO: 2.
2. The recombinant Clostridium thermocellum host cell of claim 1, wherein one or more heterologous polynucleotides are integrated at a specific site in the genome of the host cell.
3. The recombinant Clostridium thermocellum host cell of claim 2, wherein the integration of at least one of the heterologous polynucleotides occurs at the site of a specific gene in the genome of the host cell.
4. The recombinant Clostridium thermocellum host cell of claim 3, wherein the specific gene is disrupted as a result of integration of the heterologous polynucleotide.
5. The recombinant Clostridium thermocellum host cell of claim 3, wherein the specific gene is deleted as a result of integration of the heterologous polynucleotide.
6. The recombinant Clostridium thermocellum host cell of claim 4, wherein the host cell cannot make the protein product of the disrupted gene.
7. The recombinant Clostridium thermocellum host cell of claim 5, wherein the host cell cannot make the protein product of the deleted gene.
8. The recombinant Clostridium thermocellum host cell of claim 1, wherein one or more heterologous polynucleotides are present in the host cell in an extrachromosomal plasmid.
9. The recombinant Clostridium thermocellum host cell of claim 1, wherein one or more heterologous polynucleotides are randomly integrated into the genome of the host cell.
10. The recombinant Clostridium thermocellum host cell of claim 1, wherein the host cell ferments xylan to ethanol.
11. A co-culture comprising the recombinant Clostridium thermocellum host cell of claim 1 and at least one other host cell.
12. The co-culture of claim 11, wherein the host cells express the same xylan metabolizing enzymes.
13. The co-culture of claim 11, wherein the host cells express different xylan metabolizing enzymes.
14. The co-culture of claim 11, wherein the host cells express at least one common xylan metabolizing enzyme.
15. The recombinant Clostridium thermocellum host cell of claim 1, wherein the one or more heterologous polynucleotides that encode a xylanase enzyme encode a polypeptide comprising an amino acid sequence from any one of the amino acid sequences of SEQ ID NOs: 22-38.
16. The recombinant Clostridium thermocellum host cell of claim 1, further comprising one or more heterologous polynucleotides encoding one or more xylose transporters, wherein the polynucleotide comprises a nucleotide sequence from any one of the nucleotide sequences of SEQ ID NOs: 39-50.
17. The recombinant Clostridium thermocellum of claim 16, wherein the one or more heterologous polynucleotides that encode a xylose transporter encode a polypeptide comprising an amino acid sequence from any one of the amino acid sequences of SEQ ID NOs: 51-62.
18. The recombinant Clostridium thermocellum host cell of claim 1, wherein the host cell further comprises a lactate dehydrogenase promoter and terminator.
19. The recombinant Clostridium thermocellum host cell of claim 1, wherein one or more heterologous polynucleotides encoding one or more xylanse enzymes are expressed.
20. The recombinant Clostridium thermocellum host cell of claim 19, wherein expression of one or more heterologous polynucleotides confers to the recombinant host cell the ability to ferment xylan.
21. The recombinant Clostridium thermocellum host cell of claim 1, further comprising a deletion of one or more genes endogenous to the host cell.
22. The recombinant Clostridium thermocellum host cell of claim 21, wherein the deletion of one or more genes endogenous to the host cell comprises the hypoxanthine phosphoribosyl transferase (HPT) gene.
23. The recombinant Clostridium thermocellum host cell of claim 21, wherein the deletion of one or more genes endogenous to the host cell comprises the phosphotransacetylase (PTA) gene.
24. The recombinant Clostridium thermocellum of claim 1, wherein the heterologous polynucleotide that encodes a xylose isomerase encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 3.
25. The recombinant Clostridium thermocellum host cell of claim 1, wherein expression of the heterologous polynucleotide encoding the xylose isomerase confers to the recombinant host cell the ability to ferment xylose.
26. The recombinant Clostridium thermocellum of claim 1, wherein the heterologous polynucleotide that encodes a xylulokinase encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 4.
Description
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION OF THE INVENTION
(11) This specification discloses one or more embodiments that incorporate the features of this invention. The disclosed embodiment(s) merely exemplify the invention. The scope of the invention is not limited to the disclosed embodiment(s). The invention is defined by the claims appended hereto.
(12) In the following description, for purposes of explanation, specific numbers, materials and configurations are set forth in order to provide a thorough understanding of the invention. It will be apparent, however, to one having ordinary skill in the art that the invention may be practiced without these specific details. In some instances, well-known features may be omitted or simplified so as not to obscure the present invention.
(13) The embodiment(s) described, and references in the specification to one embodiment, an embodiment, an example embodiment, etc., indicate that the embodiment(s) described can include a particular feature, structure, or characteristic, but every embodiment may not necessarily include the particular feature, structure, or characteristic. Moreover, such phrases are not necessarily referring to the same embodiment. Further, when a particular feature, structure, or characteristic is described in connection with an embodiment, it is understood that it is within the knowledge of one skilled in the art to effect such feature, structure, or characteristic in connection with other embodiments whether or not explicitly described.
(14) The description of a or an item herein may refer to a single item or multiple items. It is understood that wherever embodiments are described herein with the language comprising, otherwise analogous embodiments described in terms of consisting of and/or consisting essentially of are also provided.
DEFINITIONS
(15) The term heterologous when used in reference to a polynucleotide, a gene, a polypeptide, or an enzyme refers to a polynucleotide, gene, polypeptide, or an enzyme not normally found in the host organism. Heterologous also includes a native coding region, or portion thereof, that is removed from the source organism and subsequently reintroduced into the source organism in a form that is different from the corresponding native gene, e.g., not in its natural location in the organism's genome. The heterologous polynucleotide or gene may be introduced into the host organism by, e.g., gene transfer. A heterologous gene may include a native coding region that is a portion of a chimeric gene including non-native regulatory regions that is reintroduced into the native host. Foreign genes can comprise native genes inserted into a non-native organism, or chimeric genes. A heterologous polynucleotide, gene, polypeptide, or an enzyme may be derived from any source, e.g., eukaryotes, prokaryotes, viruses, or synthetic polynucleotide fragments. The term heterologous as used herein also refers to an element of a vector, plasmid or host cell that is derived from a source other than the endogenous source. Thus, for example, a heterologous sequence could be a sequence that is derived from a different gene or plasmid from the same host, from a different strain of host cell, or from an organism of a different taxonomic group (e.g., different kingdom, phylum, class, order, family genus, or species, or any subgroup within one of these classifications). The term heterologous is also used synonymously herein with the term exogenous.
(16) By promoter is meant a region of DNA that facilitates the transcription of a particular gene. Promoters are typically located near the genes they regulate, on the same strand and upstream (towards the 5 region of the sense strand). The terms promoter or surrogate promoter is intended to include a polynucleotide that can transcriptionally control a gene-of-interest that it does not transcriptionally control in nature. In certain embodiments, the transcriptional control of a surrogate promoter results in an increase in expression of the gene-of-interest. In certain embodiments, a surrogate promoter is placed 5 to the gene-of-interest. A surrogate promoter may be used to replace the natural promoter, or may be used in addition to the natural promoter. A surrogate promoter may be endogenous with regard to the host cell in which it is used, or it may be a heterologous polynucleotide sequence introduced into the host cell, e.g., exogenous with regard to the host cell in which it is used.
(17) As used herein, the term terminator or transcription terminator is a section of genetic sequence that marks the end of a gene or operon on genomic DNA for transcription.
(18) As used herein, the term operon refers to a functioning unit of genomic material containing a cluster of genes under the control of a single regulatory signal or promoter. The genes are transcribed together into an mRNA strand and either translated together in the cytoplasm, or undergo trans-splicing to create monocistronic mRNAs that are translated separately, i.e., several strands of mRNA that each encode a single gene product. The result of this is that the genes contained in the operon are either expressed together or not at all. Originally operons were thought to exist solely in prokaryotes but since the discovery of the first operons in eukaryotes in the early 1990s, more evidence has arisen to suggest they are more common than previously assumed. Operons occur primarily in prokaryotes but also in some eukaryotes, including Drosophila melanogaster and C. elegans.
(19) Thermophilic or thermotolerant bacteria are those bacteria whose growth temperature optimum is above about 45 C. Thermophilic bacteria offer major advantages for biotechnological processes, many of which run more rapidly and efficiently at high temperatures. Higher incubation temperatures increase the diffusion rate and solubilities of non-gaseous compounds of interest and tend to discourage non-thermophilic microbial contamination. Cell culture carried out at high temperatures also eliminates or greatly reduces cooling costs.
(20) By mesophilic is meant an organism that thrives at a temperature of about 20-45 C.
(21) The terms gene(s) or polynucleotide or polynucleotide sequence(s) are intended to include nucleic acid molecules, e.g., polynucleotides which include an open reading frame encoding a polypeptide, and can further include non-coding regulatory sequences, and introns. In addition, the terms are intended to include one or more genes that map to a functional locus. In addition, the terms are intended to include a specific gene for a selected purpose. The gene may be endogenous to the host cell or may be recombinantly introduced into the host cell, e.g., as a plasmid maintained episomally or a plasmid (or fragment thereof) that is stably integrated into the genome. In addition to the plasmid form, a gene may, for example, be in the form of linear DNA. In certain embodiments, the gene or polynucleotide is involved in at least one step in the bioconversion of a acetate to a non-charged solvent, including but not limited to, acetone, isopropanol, ethyl acetate, or ethanol. Accordingly, the term is intended to include any gene encoding a polypeptide, such as the enzymes acetate kinase (ACK), phosphotransacetylase (PTA), lactate dehydrogenase (LDH), pyruvate formate lyase (PFL), aldehyde dehydrogenase (ADH) and/or alcohol dehydrogenase (ADH), acetyl-CoA transferase (ACS), acetaldehyde dehydrogenase, acetaldehyde/alcohol dehydrogenase, glycerol-3-phosphate dehydrogenase (GPD), acetyl-CoA synthetase, thiolase, CoA transferase, acetoacetate decarboxylase, enzymes in the D-xylose pathway, such as xylose isomerase and xylulokinase, enzymes in the L-arabinose pathway, such as L-arabinose isomerase and L-ribulose-5-phosphate 4-epimerase. The term gene is also intended to cover all copies of a particular gene, e.g., all of the DNA sequences in a cell encoding a particular gene product.
(22) The term expression is intended to include the expression of a gene at least at the level of mRNA production.
(23) The term expression product is intended to include the resultant product, e.g., a polypeptide, of an expressed gene.
(24) The term cellulolytic activity is intended to include the ability to hydrolyze glycosidic linkages in oligohexoses and polyhexoses. Cellulolytic activity may also include the ability to depolymerize or debranch cellulose and hemicellulose.
(25) The term xylanolytic activity is intended to include the ability to hydrolyze glycosidic linkages in oligopentoses and polypentoses.
(26) As used herein, the term lactate dehydrogenase or LDH is intended to include the enzymes capable of converting pyruvate into lactate. It is understood that LDH can also catalyze the oxidation of hydroxybutyrate. LDH includes those enzymes that correspond to Enzyme Commission Number 1.1.1.27.
(27) As used herein the term alcohol dehydrogenase or ADH is intended to include the enzymes capable of converting acetaldehyde into an alcohol, such as ethanol. ADH also includes the enzymes capable of converting acetone to isopropanol. ADH includes those enzymes that correspond to Enzyme Commission Number 1.1.1.1.
(28) As used herein, the term phosphotransacetylase or PTA is intended to include the enzymes capable of converting hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. HPT includes those enzymes that correspond to Enzyme Commission Number 2.4.2.8.
(29) As used herein, the term hypoxanthine phosphoribosyltransferase or HPT is intended to include the enzymes capable of converting acetyl-phosphate into acetyl-CoA. PTA includes those enzymes that correspond to Enzyme Commission Number 2.3.1.8.
(30) A xylose metabolizing enzyme can be any enzyme involved in xylose digestion, metabolism and/or hydrolysis, including a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, a transketolase, and a transaldolase protein. See, e.g. Gu et al., BMC Genomics, 11:255-268, 2010.
(31) By xylulokinase (XK) is meant an enzyme that catalyzes the chemical reaction: ATP+D-xyluloseADP+D-xylulose 5-phosphate. Thus, the two substrates of this enzyme are ATP and D-xylulose, whereas its two products are ADP and D-xylulose 5-phosphate. This enzyme belongs to the family of transferases, specifically those transferring phosphorus-containing groups (phosphotransferases) with an alcohol group as acceptor. The systematic name of this enzyme class is ATP:D-xylulose 5-phosphotransferase. Other names in common use include xylulokinase (phosphorylating), and D-xylulokinase. This enzyme participates in pentose and glucuronate interconversions. XK includes those enzymes that correspond to Enzyme Commission Number 2.7.1.17.
(32) By xylose isomerase (XI) is meant an enzyme that catalyzes the chemical reaction: D-xyloseD-xylulose. This enzyme belongs to the family of isomerases, specifically those intramolecular oxidoreductases interconverting aldoses and ketoses. The systematic name of this enzyme class is D-xylose aldose-ketose-isomerase. Other names in common use include D-xylose isomerase, D-xylose ketoisomerase, and D-xylose ketol-isomerase. This enzyme participates in pentose and glucuronate interconversions and fructose and mannose metabolism. The enzyme is used industrially to convert glucose to fructose in the manufacture of high-fructose corn syrup. It is sometimes referred to as glucose isomerase. XI includes those enzymes that correspond to Enzyme Commission Number 5.3.1.5.
(33) As used herein, the term xylose transport proteins or xylose transporter is intended to include a membrane protein that is involved in the movement of xylose across a biological membrane, thereby facilitating xylose utilization by the host organism. See, e.g. Gu et al., BMC Genonmics, 11:255-268, 2010. As used herein, the term xylose transport genes is intended to include the genes that encode a xylose transport protein.
(34) Certain embodiments of the present invention provide for the inactivation or deletion of certain genes or particular polynucleotide sequences within microorganisms, which inactivation or deletion of genes or particular polynucleotide sequences may be understood to encompass genetic modification(s) or transformation(s) such that the resulting strains of said microorganisms may be understood to be genetically modified or transformed. In certain embodiments, strains of microorganisms may be of bacterial, fungal, or yeast origin.
(35) Certain embodiments of the present invention provide for the insertion, (e.g., the addition, integration, incorporation, or introduction) of certain genes or particular polynucleotide sequences within thermophilic or mesophilic microorganisms, which insertion of genes or particular polynucleotide sequences may be understood to encompass genetic modification(s) or transformation(s) such that the resulting strains of said thermophilic or mesophilic microorganisms may be understood to be genetically modified or transformed. In certain embodiments, strains of microorganisms may be of bacterial, fungal, or yeast origin.
(36) The term CBP organism is intended to include microorganisms of the invention, e.g., microorganisms that have properties suitable for CBP.
(37) The terms fermenting and fermentation are intended to include the enzymatic process (e.g., cellular or acellular, e.g., a lysate or purified polypeptide mixture) by which ethanol is produced from a carbohydrate, in particular, as a product of fermentation.
(38) As used herein, the term undesirable end products of fermentation is intended to include products of fermentation other than ethanol and carbon dioxide. Undesirable end products may include, but are not limited to, acetate, lactate, pyruvate, and glyceraldehyde.
(39) As used herein, selection or selection methods or selection protocol(s) refers to methods for putting pressure on (or challenging) a given strain to adapt to new conditions. The selection methods favor sporadic variants of the original strain wherein the variants undergo some genetic or epigenetic change that confers a growth advantage in the culture conditions of the embodiment.
(40) In one aspect of the invention, the genes or particular polynucleotide sequences are inserted to activate the activity for which they encode, such as the expression of an enzyme. In certain embodiments, genes encoding enzymes in the metabolic production of ethanol, e.g., enzymes that metabolize pentose and/or hexose sugars, may be added to a mesophilic or thermophilic organism. In certain embodiments of the invention, the enzyme may confer the ability to metabolize a pentose sugar and be involved, for example, in the D-xylose pathway and/or L-arabinose pathway. In certain embodiments of the invention, genes encoding enzymes in the conversion of acetate to a non-charged solvent, including but not limited to, acetone, isopropanol, ethyl acetate, or ethanol, may be added to a mesophilic or thermophilic organism.
(41) In one aspect of the invention, the genes or particular polynucleotide sequences are partially, substantially, or completely deleted, silenced, inactivated, or down-regulated in order to inactivate the activity for which they encode, such as the expression of an enzyme. Deletions provide maximum stability because there is no opportunity for a reverse mutation to restore function. Alternatively, genes can be partially, substantially, or completely deleted, silenced, inactivated, or down-regulated by insertion of nucleic acid sequences that disrupt the function and/or expression of the gene (e.g., P1 transduction or other methods known in the art). The terms eliminate, elimination. and knockout are used interchangeably with the terms deletion, partial deletion, substantial deletion, or complete deletion. In certain embodiments, strains of microorganisms of interest may be engineered by site directed homologous recombination to knockout specific genes. In still other embodiments, RNAi or antisense DNA (asDNA) may be used to partially, substantially, or completely silence, inactivate, or down-regulate a particular gene of interest.
(42) In certain embodiments, the genes targeted for deletion or inactivation as described herein may be endogenous to the native strain of the microorganism, and may thus be understood to be referred to as native gene(s) or endogenous gene(s). An organism is in a native state if it has not been genetically engineered or otherwise manipulated by the hand of man in a manner that intentionally alters the genetic and/or phenotypic constitution of the organism. For example, wild-type organisms may be considered to be in a native state. In other embodiments, the gene(s) targeted for deletion or inactivation may be non-native to the organism.
(43) Similarly, the enzymes of the invention as described herein can be endogenous to the native strain of the microorganism, and can thus be understood to be referred to as native or endogenous.
(44) The term expression, as used herein, refers to the transcription and stable accumulation of sense (mRNA) or antisense RNA derived from the nucleic acid fragment of the invention. Expression may also refer to translation of mRNA into a polypeptide.
(45) The term lignocellulose refers to material that is comprised of lignin and cellulose.
(46) A saccharolytic enzyme can be any enzyme involved in carbohydrate digestion, metabolism and/or hydrolysis, including amylases, cellulases, hemicellulases, cellulolytic and amylolytic accessory enzymes, inulinases, levanases, and pentose sugar hydrolyzing enzymes.
(47) A pentose sugar utilizing enzyme can be any enzyme involved in pentose sugar digestion, metabolism and/or hydrolysis, including xylanase, arabinase, arabinoxylanase, arabinosidase, arabinofuranosidase, arabinoxylanase, arabinosidase, arabinose isomerase, ribulose-5-phosphate 4-epimerase, xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, xylose transketolase, and/or xylose transaldolase.
(48) A cellulolytic enzyme can be any enzyme involved in cellulose digestion, metabolism and/or hydrolysis. The term cellulase refers to a class of enzymes produced chiefly by fungi, bacteria, and protozoans that catalyze cellulolysis (i.e. the hydrolysis) of cellulose. However, there are also cellulases produced by other types of organisms such as plants and animals. Several different kinds of cellulases are known, which differ structurally and mechanistically. The EC number for this group of enzymes is EC 3.2.1.4. There are general types of cellulases based on the type of reaction catalyzed: endocellulase breaks internal bonds to disrupt the crystalline structure of cellulose and expose individual cellulose polysaccharide chains; exocellulase cleaves 2-4 units from the ends of the exposed chains produced by endocellulase, resulting in the tetrasaccharides or disaccharide such as cellobiose. There are two main types of exocellulases (or cellobiohydrolases, abbreviate CBH)one type working processively from the reducing end, and one type working processively from the non-reducing end of cellulose; cellobiase or beta-glucosidase hydrolyses the exocellulase product into individual monosaccharides; oxidative cellulases that depolymerize cellulose by radical reactions, as for instance cellobiose dehydrogenase (acceptor); cellulose phosphorylases that depolymerize cellulose using phosphates instead of water. In the most familiar case of cellulase activity, the enzyme complex breaks down cellulose to beta-glucose. A cellulase can be any enzyme involved in cellulase digestion, metabolism and/or hydrolysis, including an endoglucanase, glucosidase, cellobiohydrolase, xylanase, glucanase, xylosidase, xylan esterase, arabinofuranosidase, galactosidase, cellobiose phosphorylase, cellodextrin phosphorylase, mannanase, mannosidase, xyloglucanase, endoxylanase, glucuronidase, acetylxylanesterase, arabinofuranohydrolase, swollenin, glucuronyl esterase, expansin, and feruoyl esterase protein.
(49) An amylolytic enzyme can be any enzyme involved in amylase digestion, metabolism and/or hydrolysis. The term amylase refers to an enzyme that breaks starch down into sugar. Amylase is present in human saliva, where it begins the chemical process of digestion. Foods that contain much starch but little sugar, such as rice and potato, taste slightly sweet as they are chewed because amylase turns some of their starch into sugar in the mouth. The pancreas also makes amylase (-amylase) to hydrolyse dietary starch into disaccharides and trisaccharides which are converted by other enzymes to glucose to supply the body with energy. Plants and some bacteria also produce amylase. All amylases are glycoside hydrolases and act on -1,4-glycosidic bonds. Some amylases, such as -amylase (glucoamylase), also act on -1,6-glycosidic bonds. Amylase enzymes include -amylase (EC 3.2.1.1), 3-amylase (EC 3.2.1.2), and -amylase (EC 3.2.1.3). An amylase can be any enzyme involved in amylase digestion, metabolism and/or hydrolysis, including -amylase, -amylase, glucoamylase, and alpha-glucosidase. The -amylases are calcium metalloenzymes, unable to function in the absence of calcium. By acting at random locations along the starch chain, -amylase breaks down long-chain carbohydrates, ultimately yielding maltotriose and maltose from amylose, or maltose, glucose and limit dextrin from amylopectin. Because it can act anywhere on the substrate, -amylase tends to be faster-acting than -amylase. In animals, it is a major digestive enzyme and its optimum pH is about 6.7-7.0. Another form of amylase, 3-amylase, is also synthesized by bacteria, fungi, and plants. Working from the non-reducing end, -amylase catalyzes the hydrolysis of the second -1.4 glycosidic bond, cleaving off two glucose units (maltose) at a time. Many microbes produce amylase to degrade extracellular starches. In addition to cleaving the last (1-4)glycosidic linkages at the nonreducing end of amylose and amylopectin, yielding glucose, -amylase will cleave (1-6) glycosidic linkages. Another amylolytic enzyme is pullulanase. Pullulanase is a specific kind of glucanase, an amylolytic exoenzyme, that degrades pullulan. Pullulan is regarded as a chain of maltotriose units linked by alpha-1,6-glycosidic bonds. Pullulanase (EC 3.2.1.41) is also known as pullulan-6-glucanohydrolase (Debranching enzyme). Another amylolytic enzyme, isopullulanase, hydrolyses pullulan to isopanose (6-alpha-maltosylglucose). Isopullulanase (EC 3.2.1.57) is also known as pullulan 4-glucanohydrolase. An amylase can be any enzyme involved in amylase digestion, metabolism and/or hydrolysis, including -amylase, -amylase, glucoamylase, pullulanase, isopullulanase, and alpha-glucosidase.
(50) The term xylan includes a wide variety of highly complex polysaccharides that are found in plant cell walls and some algae. Xylans are polysaccharides made from units of xylose.
(51) The term xylanase is the name given to a class of enzymes which degrade the linear polysaccharide beta-1,4-xylan into xylose, thus breaking down hemicellulose, one of the major components of plant cell walls. As such, it plays a major role in micro-organisms thriving on plant sources (mammals, conversely, do not produce xylanase). Additionally, xylanases are present in fungi for the degradation of plant matter into usable nutrients. Xylanases include those enzymes that correspond to Enzyme Commission Number 3.2.1.8. A xylose metabolizing enzyme can be any enzyme involved in xylose digestion, metabolism and/or hydrolysis, including a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, xylose transketolase, and a xylose transaldolase protein.
(52) A pentose sugar hydrolyzing enzyme can be any enzyme involved in pentose sugar digestion, metabolism and/or hydrolysis, including xylanase, arabinase, arabinoxylanase, arabinosidase, arabinofuranosidase, arabinoxylanase, arabinosidase, arabinose isomerase, ribulose-5-phosphate 4-epimerase, xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, xylose transketolase, and/or xylose transaldolase.
(53) Biomass
(54) Biomass can include any type of biomass known in the art or described herein. The terms lignocellulosic material, lignocellulosic substrate, and cellulosic biomass mean any type of biomass comprising cellulose, hemicellulose, lignin, or combinations thereof, such as but not limited to woody biomass, forage grasses, herbaceous energy crops, non-woody-plant biomass, agricultural wastes and/or agricultural residues, forestry residues and/or forestry wastes, paper-production sludge and/or waste paper sludge, waste-water-treatment sludge, municipal solid waste, corn fiber from wet and dry mill corn ethanol plants, and sugar-processing residues. The terms hemicellulosics, hemicellulosic portions, and hemicellulosic fractions mean the non-lignin, non-cellulose elements of lignocellulosic material, such as but not limited to hemicellulose (i.e., comprising xyloglucan, xylan, glucuronoxylan, arabinoxylan, mannan, glucomannan, and galactoglucomannan), pectins (e.g., homogalacturonans, rhamnogalacturonan I and II, and xylogalacturonan), and proteoglycans (e.g., arabinogalactan-protein, extensin, and proline-rich proteins). Biomass also includes starch and hexose and pentose sugars.
(55) In a non-limiting example, the lignocellulosic material can include, but is not limited to, woody biomass, such as recycled wood pulp fiber, sawdust, hardwood, softwood, and combinations thereof; grasses, such as switch grass, cord grass, rye grass, reed canary grass, miscanthus, or a combination thereof; sugar-processing residues, such as but not limited to sugar cane bagasse; agricultural wastes, such as but not limited to rice straw, rice hulls, barley straw, corn cobs, cereal straw, wheat straw, canola straw, oat straw, oat hulls, and corn fiber; stover, such as but not limited to soybean stover, corn stover; succulents, such as but not limited to, Agave; and forestry wastes, such as but not limited to, recycled wood pulp fiber, sawdust, hardwood (e.g., poplar, oak, maple, birch, willow), softwood, or any combination thereof. Lignocellulosic material may comprise one species of fiber; alternatively, lignocellulosic material may comprise a mixture of fibers that originate from different lignocellulosic materials. Other lignocellulosic materials are agricultural wastes, such as cereal straws, including wheat straw, barley straw, canola straw and oat straw; corn fiber, stovers, such as corn stover and soybean stover; grasses, such as switch grass, reed canary grass, cord grass, and miscanthus; or combinations thereof.
(56) Paper sludge is also a viable feedstock for lactate or acetate production. Paper sludge is solid residue arising from pulping and paper-making, and is typically removed from process wastewater in a primary clarifier.
(57) Consolidated Bioprocessing
(58) Consolidated bioprocessing (CBP) is a processing strategy for cellulosic biomass that involves consolidating into a single process step four biologically-mediated events: enzyme production, hydrolysis, hexose fermentation, and pentose fermentation. Implementing this strategy requires development of microorganisms that both utilize cellulose, hemicellulosics, and other biomass components, such as hexose and pentose sugars, while also producing a product of interest at sufficiently high yield and concentrations. The feasibility of CBP is supported by kinetic and bioenergetic analysis. See van Walsum and Lynd (1998) Biotech. Bioeng. 58:316.
(59) Acetate
(60) Acetate is produced from acetyl-CoA in two reaction steps catalyzed by phosphotransacetlyase (PTA) and acetate kinase (ACK). The reactions mediated by these enzymes are shown below:
PTA reaction: acetyl-CoA+phosphate=CoA+acetyl phosphate(EC 2.3.1.8)
ACK reaction: ADP+acetyl phosphate=ATP+acetate(EC 2.7.2.1)
(61) C. thermocellum makes acetate under standard fermentation conditions and has well annotated genes encoding PTA and ACK.
(62) Pyruvate
(63) Pyruvate is an important intermediary compound of metabolism. For example, under aerobic conditions pyruvate may be oxidized to acetyl coenzyme A (acetyl-CoA), which then enters the tricarboxylic acid cycle (TCA), which in turn generates synthetic precursors, CO.sub.2, and reduced cofactors. The cofactors are then oxidized by donating hydrogen equivalents, via a series of enzymatic steps, to oxygen resulting in the formation of water and ATP. This process of energy formation is known as oxidative phosphorylation.
(64) Xylose Metabolism
(65) Xylose is a five-carbon monosaccharide that can be metabolized into useful products by a variety of organisms. There are two main pathways of xylose metabolism, each unique in the characteristic enzymes they utilize. One pathway is called the Xylose Reductase-Xylitol Dehydrogenase or XR-XDH pathway. Xylose reductase (XR) and xylitol dehydrogenase (XDH) are the two main enzymes used in this method of xylose degradation. XR, encoded by the XYL1 gene, is responsible for the reduction of xylose to xylitol and is aided by cofactors NADH or NADPH. Xylitol is then oxidized to xylulose by XDH, which is expressed through the XYL2 gene, and accomplished exclusively with the cofactor NAD.sup.+. Because of the varying cofactors needed in this pathway and the degree to which they are available for usage, an imbalance can result in an overproduction of xylitol byproduct and an inefficient production of desirable products. Varying expression of the XR and XDH enzyme levels have been tested in the laboratory in the attempt to optimize the efficiency of the xylose metabolism pathway.
(66) The other pathway for xylose metabolism is called the Xylose Isomerase (XI) pathway. Enzyme XI is responsible for direct conversion of xylose into xylulose, and does not proceed via a xylitol intermediate. Both pathways create xylulose, although the enzymes utilized are different. After production of xylulose both the XR-XDH and XI pathways proceed through enzyme xylulokinase (XK), encoded on gene XKSI, to further modify xylulose into xylulose-5-P where it then enters the pentose phosphate pathway for further catabolism.
(67) Apart from the two major pathways mentioned above, xylose can also be catabolized by two oxidative pathways that are called the Weimberg pathway and the Dahms pathway are common in prokaryotic microorganisms. The Weimberg pathway is an oxidative pathway where the D-xylose is oxidized to D-xylono-lactone by a D-xylose dehydrogenase followed by a lactonase to hydrolyze the lactone to D-xylonic acid. A xylonate dehydratase is splitting off a water molecule resulting in 2-keto 3-deoxy-xylonate. A second dehydratase forms the 2-keto glutarate semialdehyde which is subsequently oxidised to 2-ketoglutarate. The Dahms pathway starts as the Weimberg pathway but the 2-keto-3 deoxy-xylonate is split by an aldolase to pyruvate and glycoladehyde.
(68) Studies on flux through the pentose phosphate pathway during xylose metabolism have revealed that limiting the speed of this step may be beneficial to the efficiency of fermentation to ethanol. Modifications to this flux that may improve ethanol production include a) lowering phosphoglucose isomerase activity, b) deleting the GND1 gene, and c) deleting the ZWF1 gene (Jeppsson et al., Appl Environ Microbiol. 68:1604-1609, 2002). Since the pentose phosphate pathway produces additional NADPH during metabolism, limiting this step will help to correct the already evident imbalance between NAD(P)H and NAD.sup.+ cofactors and reduce xylitol byproduct. Another experiment comparing the two xylose metabolizing pathways revealed that the XI pathway was best able to metabolize xylose to produce the greatest ethanol yield, while the XR-XDH pathway reached a much faster rate of ethanol production (Karhumaa et al., Microb Cell Fact. 2007 Feb. 5; 6:5). See also International Publication No. WO2006/009434, incorporated herein by reference in its entirety.
(69) Host Cells
(70) Host cells useful in the present invention include any prokaryotic or eukaryotic cells; for example, microorganisms selected from bacterial, algal, and yeast cells. Among host cells suitable for the present invention are microorganisms, for example, of the genera Clostridium.
(71) In some embodiments, the host cells are microorganisms. In one embodiment the microorganism is a thermotolerant or thermophilic microorganism.
(72) In one embodiment, the host cells can contain antibiotic markers or can contain no antibiotic markers. In another embodiment, the host cells are bacteria selected from the genus Clostridium and other bacteria having characteristics resembling those of Clostridium species.
(73) Cellulolytic and Xylanolytic Microorganisms
(74) Several microorganisms that are reported in the literature to be both cellulolytic and xylanolytic have been characterized by a variety of means, including their ability to grow on microcrystalline cellulose and birchwood xylan as well as a variety of other sugars. Additionally, such organisms may be characterized by other means, including but not limited to, their ability to depolymerize and debranch cellulose and hemicellulose. In one embodiment, cellulolytic the organisms of interest is Clostridium thermocellum.
(75) TABLE 1 summarizes the growth of C. thermocellum on Avicel.
(76) TABLE-US-00001 DSMZ T optimum; pH optimum; Gram Aero- Strain No. or range or range Stain tolerant Utilizes Products Clostridium 1313 55-60 7 positive No cellobiose, acetic acid, thermocellum cellulose lactic acid, ethanol, H.sub.2, CO.sub.2
(77) Certain microorganisms, including, for example, C. thermocellum, cannot metabolize pentose sugars, such as xylose or arabinose, but are able to metabolize hexose sugars. Both xylose and arabinose are abundant sugars in biomass with xylose accounting for approximately 16-20% in soft and hard woods and L-arabinose accounting for approximately 25% in corn fiber. Accordingly, in one embodiment of the invention genetically-modified cellulolytic microorganisms are provided with the ability to metabolize pentose sugars, such as xylose and arabinose, thereby to enhance their use as biocatalysts for fermentation in the biomass-to-acetic acid or lactic acid or ethanol industries. Therefore, in one embodiment, the host cell is a Clostridium thermocellum strain. In another embodiment, the host cell is a Clostridium thermocellum strain selected from the group consisting of DSM 1313, DSM 1237 and DSM 2360.
(78) In some embodiments, the thermotolerant host cell can grow at temperatures above about 30 C., about 31 C., about 32 C., about 33 C., about 34 C., about 35 C., about 36 C., about 37 C., about 38 C., about 39 C., about 40 C., about 41 C. or about 42 C. In some embodiments of the present invention, the thermotolerant host cell can ferment xylose to ethanol and other products at temperatures above about 30 C., about 31 C., about 32 C., about 33 C., about 34 C., about 35 C., about 36 C., about 37 C., about 38 C., about 39 C., about 40 C., about 41 C., about 42 C., or about 43 C., or about 44 C., or about 45 C., or about 50 C.
(79) In some embodiments of the present invention, the thermotolerant host cell can grow at temperatures from about 30 C. to 60 C., about 30 C. to 55 C., about 30 C. to 50 C. about 40 C. to 60 C., about 40 C. to 55 C. or about 40 C. to 50 C. In some embodiments of the present invention, the thermotolerant host cell can ferment xylose to ethanol and other products at temperatures from about 30 C. to 60 C., about 30 C. to 55 C., about 30 C. to 50 C., about 40 C. to 60 C., about 40 C. to 55 C. or about 40 C. to 50 C.
(80) The present invention provides cellulolytic microorganisms expressing enzymes that allow the microorganisms to ferment xylose. When genes encoding enzymes involved in the metabolic pathway of lactate or acetate, including, for example, xylose, arabinose, and/or xylan, are introduced into a microorganism that lacks one or more of these genes, for example, C. thermocellum, one may select transformed strains for growth on xylose or growth on arabinose or growth on xylan. C. thermocellum may lack one or more known genes or enzymes in the xylose to ethanol pathway and/or the arabinose utilization pathway.
(81) In one embodiment, host cells are genetically engineered (transduced or transformed or transfected) with the polynucleotides encoding xylose metabolizing enzymes of this invention which are described in more detail below. In another embodiment, host cells are genetically engineered with the polynucleotides encoding xylanases of this invention The polynucleotides encoding xylose metabolizing enzymes or xylanases can be introduced to the host cell on a vector, which may be, for example, a cloning vector or an expression vector comprising a sequence encoding a heterologous xylose metabolizing enzyme. The host cells can comprise polynucleotides of the invention as integrated copies or plasmid copies.
(82) In certain aspects, the present invention relates to host cells containing the polynucleotide constructs described below. The host cells of the present invention can express one or more heterologous polypeptides expressing xylose metabolizing enzymes. In another embodiment, the host cells of the present invention can express one or more heterologous polypeptides expressing xylanases. In some embodiments, the host cell comprises a combination of polynucleotides that encode heterologous xylose metabolizing enzymes or fragments, variants or derivatives thereof. In other embodiments, the host cell comprises a combination of polynucleotides that encode heterologous xylanases or fragments, variants or derivatives thereof. The host cell can, for example, comprise multiple copies of the same nucleic acid sequence, for example, to increase expression levels, or the host cell can comprise a combination of unique polynucleotides. In other embodiments, the host cell comprises a single polynucleotide that encodes a heterologous xylose metabolizing enzyme or a fragment, variant or derivative thereof. In yet other embodiments, the host cell comprises a single polynucleotide that encodes a heterologous xylanase or a fragment, variant or derivative thereof. In particular, such host cells expressing a single heterologous xylose metabolizing enzyme or a heterologous xylanase can be used in co-culture with other host cells of the invention comprising a polynucleotide that encodes at least one other heterologous xylose metabolizing enzyme or a heterologous xylanase or fragment, variant or derivative thereof. As used herein, co-culture refers to growing two different strains or species of host cells together in the same vessel.
(83) Introduction of a polynucleotide encoding a heterologous xylose metabolizing enzyme or a heterologous xylanase into a host cell can be done by methods known in the art. Introduction of polynucleotides encoding heterologous xylose metabolizing enzymes or heterologous xylanases into, for example yeast host cells, can be effected by lithium acetate transformation, spheroplast transformation, or transformation by electroporation, as described in Current Protocols in Molecular Biology, 13.7.1-13.7.10. Introduction of the construct in other host cells can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation. (Davis, L., et al., Basic Methods in Molecular Biology, (1986)). However, as mentioned above, several species of Clostridium, including Clostridium thermocellum, are difficult to transform with heterologous polynucleotides. An example of transformation of Clostridium thermocellum is disclosed in International Publication No. WO 2010/056450.
(84) In certain embodiments, xylose metabolizing gene donors may include microorganisms that confer to the host cell the ability to metabolize hexose and pentose sugars. In other embodiments, xylanase gene donors may include microorganisms that confer to the host cell the ability to metabolize xylan. In some embodiments, the xylose metabolizing gene donors are Thermoanaerobacterium saccharolyticum, C. cellulolyticum, Caldicellulosiruptor kristjanssonii, C. phytofgrmentans, and C. stercorarium.
(85) In one embodiment, the donors of the xylose metabolizing genes are bacterial species, including, but not limited to, Clostridium cellulolyticum, Thermoanaerobacterium saccharolyticum, C. stercorarium, Caldiscellulosiruptor kristjanssonii, and C. phytokirmentans. These strains are good utilizers of xylose. In one embodiment, Thermoanaerobacterium saccharolyticum is the donor of the xylose metabolizing genes.
(86) Accordingly, in one aspect of the invention, one or more microorganism strains are modified so as to optimize sugar utilization capability by, for example, introducing genes for one or more enzymes required for the production of ethanol from biomass-derived pentoses, e.g., D-xylose or L-arabinose metabolism. Promoters, including the native promoters of C. thermocellum such as triose phosphate isomerase (TPI), GAPDH, and LDH, can be used to express these genes. Once the gene has been cloned, codon optimization can be performed before expression. Cassettes containing, for example, the native promoter, one or more xylanolytic genes and a selectable marker can then be used to transform C. thermocellum and select for xylose growth on medium containing xylose as the sole carbohydrate source.
(87) In certain other embodiments, the host cells of the present invention relate to genetically modified Clostridium organisms, wherein a gene or a particular polynucleotide sequence is partially, substantially, or completely deleted, silenced, inactivated, or down-regulated, which gene or polynucleotide sequence encodes for an enzyme that confers upon the organism the ability to produce organic acids as fermentation products, thereby increasing the ability of the organism to produce lactate or acetate as the major fermentation product.
(88) The gene that confers upon the organism an ability to produce acetic acid as a fermentation product may code for expression of acetate kinase (ACK), phosphotransacetylase (PTA), pyruvate formate lyase (PFL), and/or aldehyde or alcohol dehydrogenase (ADH). The deletion or suppression of the gene(s) or particular polynucleotide sequence(s) that encode for expression of ACK. PTA, PFL, and/or ADH diminishes or eliminates the reaction scheme in the overall glycolytic pathway whereby pyruvate is converted to acetyl CoA and acetyl CoA is converted to acetic acid or ethanol. In certain embodiments, the above-mentioned genes can be disrupted, or partially or fully deleted individually or in concert in the host cell. In one embodiment, the PTA gene is deleted from the host cell. In one aspect, the deletion of the PTA gene results in the host cell fermenting xylose to ethanol as the major end product. In one aspect, the deletion of the PTA gene results in the host cell fermenting xylose to ethanol as the end product, with the virtual elimination of one or more undesirable end products (e.g. end products other than ethanol or carbon dioxide). In another aspect, the deletion of the PTA gene results in the host cell fermenting xylose to ethanol as the end product and producing no undesirable end product. In another embodiment, no, or significantly no lactate or acetate, or both, is produced.
(89) In one embodiment, the host cell of the invention further comprises a deletion of one or more endogenous genes. In one aspect, the deletion of the one or more endogenous gene facilitates the genetic selections of the integration of one or more polynucleotides of the invention into the genome of the host cell. In certain embodiments, the one or more endogenous genes to be deleted may be selected from, but are not limited to, the hypoxanthine phosphoribosyl transferase (HPT) gene and the adenine phosphoribosyl transferase (APT) gene. In one embodiment, the endogenous gene to be deleted is the hypoxanthine phosphoribosyl transferase (HPT) gene. HPT is a transferase enzyme, which catalyzes the conversion of hypoxanthine to ionosine. The enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway.
(90) The transformed host cells or cell cultures, as described above, can be examined for protein content of xylose metabolizing enzymes comprising a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, a transketolase, and a transaldolase protein. These proteins can be recovered and purified from recombinant yeast cell cultures by methods including spheroplast preparation and lysis, cell disruption using glass beads, and cell disruption using liquid nitrogen for example. Additional protein purification methods include ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, gel filtration, and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the mature protein. Finally, high performance liquid chromatography (H PLC) can be employed for final purification steps.
(91) Protein analysis methods include methods such as the traditional Lowry method or the protein assay method according to BioRad's manufacturer's protocol. Using such methods, the protein content of the xylose metabolizing enzymes can be estimated. Additionally, to accurately measure protein concentration, a heterologous xylose metabolizing enzyme can be expressed with a tag, for example a His-tag or HA-tag and purified by standard methods using, for example, antibodies against the tag or a standard nickel resin purification technique or similar approach.
(92) The transformed host cells or cell cultures, as described above, can be further analyzed for hydrolysis of xylose, for a particular type of xylose metabolizing enzyme activity (e.g., by measuring the individual xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase activity) or for total xylose metabolizing enzyme activity. The transformed host cells or cell cultures, can also be analyzed for hydrolysis of xylan, for a particular type of xylanase enzyme activity or for total xylanase enzyme activity.
(93) One aspect of the invention is related to the efficient production of one or more xylose metabolizing enzymes to aid in the digestion of xylose and generation of products such as ethanol. Another aspect of the invention is related to the efficient production of one or more xylanase enzymes to aid in the digestion of xylan and generation of products such as ethanol.
(94) In additional embodiments, the transformed host cells or cell cultures are assayed for ethanol production. Ethanol production can be measured by techniques known to one of ordinary skill in the art, e.g., by a standard HPLC refractive index method.
(95) Heterologous Xylose Metabolizing Enzymes
(96) In one embodiment, the host cells of the invention express one or more heterologous saccharolytic enzymes. In one aspect, the host cells express one or more heterologous cellulolytic enzymes. In another aspect, the host cells express one or more heterologous amylolytic enzymes. In one aspect, the host cells express one or more heterologous pentose sugar hydrolyzing enzymes. In another aspect, the host cells express one or more heterologous xylanases.
(97) Complex biomass feedstocks contain varying amounts of starch, lignocellulosic material, and hexose and pentose sugars. Accordingly, in one embodiment, the host cells of the present invention are constructed to express different saccharolytic enzymes at different levels. In one embodiment, a host cell expresses one or more cellulolytic enzymes at a higher level than one or more amylolytic enzymes and one or more pentose sugar hydrolyzing enzymes. In another embodiment, the host cell expresses one or more amylolytic enzymes at a higher level than one or more cellulolytic enzymes and one or more pentose sugar hydrolyzing enzymes. In yet another embodiment, the host cell expresses one or more pentose sugar hydrolyzing enzymes at a higher level than one or more cellulolytic enzymes and one or more amylolytic enzymes.
(98) In one embodiment, the one or more heterologous pentose sugar hydrolyzing enzymes expressed in a host cell comprise one or more xylose metabolizing enzymes. According to one aspect of the present invention, the expression of heterologous xylose metabolizing enzymes in a host cell can be used advantageously to produce products such as ethanol from the xylose portion of biomass sources. Xylose metabolizing enzymes from a variety of sources can be heterologously expressed to successfully increase efficiency of ethanol production, for example. The xylose metabolizing enzymes can be from fungi, bacteria, plant, protozoan or termite sources. In some embodiments, the xylose metabolizing enzyme is a Thermnnoanaerobacterium saccharolyticum, H. grisea, T. aurantiacus, T. ernersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. hlckowense R. speratus, Thermobfida fusca, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum or Arabidopsis thaliana xylose metabolizing enzyme. In one embodiment, the xylose metabolizing enzyme is a Thermoanaerobacteriumn saccharolyticum xylose metabolizing enzyme. In some embodiments, the xylose metabolizing enzyme of the invention is any xylose metabolizing enzyme known in the art. In a specific embodiment, the xylose metabolizing enzyme of the invention is an enzyme disclosed in Table 7 produced herein. In some embodiments, the xylose metabolizing enzyme is encoded by a nucleic acid sequence at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 1-2. In some embodiments, the xylose metabolizing enzyme has an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to any one of SEQ ID NOs: 3-4. In some embodiments, the xylose metabolizing enzyme of the invention is any xylose metabolizing enzyme suitable for expression in an appropriate host cell.
(99) In some embodiments of the invention, multiple xylose metabolizing enzymes from a single organism are co-expressed in the same host cell. In some embodiments of the invention, multiple xylose metabolizing enzymes from different organisms are co-expressed in the same host cell. In particular, xylose metabolizing enzymes from two, three, four, five, six, seven, eight, nine or more organisms can be co-expressed in the same host cell. Similarly, the invention can encompass co-cultures of microorganism strains, wherein the microorganism strains express different xylose metabolizing enzymes. Co-cultures can include microorganism strains expressing heterologous xylose metabolizing enzymes from the same organism or from different organisms. Co-cultures can include microorganism strains expressing xylose metabolizing enzymes from two, three, four, five, six, seven, eight, nine or more microorganisms.
(100) In some embodiments of the invention, multiple xylanases from a single organism are co-expressed in the same host cell. In some embodiments of the invention, multiple xylanases from different organisms are co-expressed in the same host cell. In particular, xylanases from two, three, four, five, six, seven, eight, nine or more organisms can be co-expressed in the same host cell. Similarly, the invention can encompass co-cultures of microorganism strains, wherein the microorganism strains express different xylanases. Co-cultures can include microorganism strains expressing heterologous xylanases from the same organism or from different organisms. Co-cultures can include microorganism strains expressing xylanases from two, three, four, five, six, seven, eight, nine or more microorganisms. In one embodiment, the xylanase may be of microbial origin, such as of fungal origin (e.g., Trichoderma, Meripilus, Humicola, Aspergillus, Fusarium) or from a bacterium (e.g., Bacillus). In another embodiment, the xylanase is derived from a filamentous fungus, for example from a strain of Aspergillus, such as Aspergillus aculeatus; or a strain of Humicola, such as Humicola lanuginosa. In certain embodiments, the xylanase may be an endo-1,4-beta-xylanase, or an endo-1,4-beta-xylanase of GH10 or GH11. Examples of commercial xylanases include SHEARZYME and BIOFEED WHEAT from Novozymes A/S, Denmark. Tables 2 and 3 below list the xylanases expressed in Thermoanaerobacterium saccharolyticum, and the sources of the xylanases.
(101) TABLE-US-00002 TABLE2 DNAsequencesofxylanasegenesexpressedinThermoanaerobacteriumsaccharolyticum Organism Sequence Clostridium atgctacaaaaaatgaacggaaaggttaaaaagattcttggaattagtatcgcatttcttatgttgatcatggtaat phytofermentans tccaacatcaatcgcaaaagcagcaaccaataagacctatgattttaattcgatgacttatcaatccacatggggag ttacatattctatcagtaatggatcaggaacatttaatttcactggtcaataccgtgaaattaagttcaatcttccg gaaacgctagatatgtctcaatgtactagtgtaacattcaatgcttccagtccaaatggacagattgcatttaagct ttacgatacttctggaaatcaggtggctgtagtgtataactttaattccaatacctcagactgtaccttcgcaccaa atagtacggcaaaggtaaacagtattggaataatggcgcaagggacaaataactactcagcagttgtgaatcgagtt acatttacaatgacaggagggtcttctggcactggttcttcaactttattaaacacttatggaaatatattaaaaaa ctctggaactgctgttaatttaagtcagctgcaaaattcaaatacactaagtgtgattaagacgcaatataatagta tcacattagagaatgaaatgaagccagatgcagttcttggaagttcatcaacattaatgactgttgctcaagcaaaa tcgaatggttattatattccttctagctacacggaaagtacagttccaactcttaaatttagtaccatcgatgcagt tctacagatttgctacaataacgggctaaagcttagaggacatacattagtatggcattcccaaacaccggattggt tctttagaacaggttatagttctagtggatcgtatgttagccaagctgttatggatgcaagaatggaaatgtttatt aggtcttatatgagtcatatttataatggaagctatggaagtgtagtatatgcttgggatgttgtaaatgagtattt gcatgcttctacctctggatggtctcaagtttatggatccaaccttggtaccacaccatcttatgtaaagaaagctt tccagtatgcgtatgattgtcttagcagttttggattaacgaattcagtaaaattgttttataatgattacaacaca tatgaggttacagatcagatcctatcattagtaaattttattaactctggtacgaaactttgcgctggtgttggaat gcagtctcacttaaatacctcctatccttctgtatcggcatataaaacagctatgcagaagttcttgaatgcaggat atgaagtacaggttactgaacttgatgttacgaatacatcagcttccacacaagctacttatgtatatgatttgatg actgctattctttctctaaagaaagcaggtgggaatatcactggtattacatggtggggactatatgatagcgtatc ttggcgtgcctcccaaaatcctttgttattcagtaatttaactactccaaaagaatcttataataaagcgttacaag catttacagatgcaggatat Clostridium atgtttttcaagaaactagttgcactcgcaatggctgttgccattgtcattccaatgaacgttaataacatacaaaa phytofermentans ggttgaggcggaatctacaaatgaagcagtagtatatggtaatctaatttatcacgactttgaagcaagcaccaatg ggtggggaccaagaggtgacaatgcagaggttgtggcacaaagtacagaagaggcatattcagggttacatagttta aaaattagcaaacgcacgcaaacatggcatggtgctacctgcgatttgacaaaggaacttacgattggagaaactta tgtatttggaatttatttaaaatataaaggtagctcttattccaatacacaaaagtttagcttacaatttcagtaca atgatggtgtgaatgatcagtacaaaacaattaagactttagaagtaaccaaagataaatggacattaattcaaggt gagtatacagttccagcagatgccgctaatgcaaaggtctatgtcgaaacagaatataagagttcaccatcaagtca agatctcttagacttttacattgatgatttcactgcaacgccagcaactttaccacagattcaaaaagatattccta gtttaaaggatgtattttcaagttacttctttgttggtggagcggcaactgcaggtgagattgcaccagctccggca aaagatttagtagcgaaacattacaataggttaactcctggtaatgagttaaaaccagactctgtattagattactc tgcaaccatagcctatatggatgcaaatggtggtaatcaagtgaatcctcaggtgaatcttagagctgcgaaaactt tactggaatatgcaagagacaataatataccagtgcgtggacataccttagtatggcatagccagacaccagattgg ttctttaaggtaaactattctcaggattcaaatgcagcgtgggtttccaaggaagtgatgctccaaagactagaaaa ctacatcaaaaatgtgatgcagctgatctcatcaacctatcctacagtaaagttctatgcttgggatgtggtgaatg aagcagtagatccaaatacttctacaggtatgagaaatcctggatcgaataacgtaacatctggtaattctccatgg atgcaaaccataggtgaggaatatattcaaagagcttttgaatacgcaagaaaatatgctccaactggttgtaaact gttttataatgattataacgagtatgaggatagaaagagtacctttatctttaatatcctgaaaggattaaaagata agggcttagtggatggtatgggaatgcagtctcattgggttatggattatccaagtattagtatgtttgagacagct gttcgtaaatataatactttaggattagaattacaactaacggagttagatataaagcagccagacaatagtacatc tgctttagctgctcaggcagacagatataaacttttgataaataaggtcattagtttgaaaaaagagggcatgaaca ttacaggagttatcttctggggtgtaacggataagactagttggttaggtggatatccattattatttgatggaaat tatcaagcaaagtcagcatactattctatcattgatgggattaccccaacagtaacgccatcaataactccaactgt aacaccaaaaccaacgataacacctacagtaacaccaactgtaacgccaaaaccaacgataacacctacagtaacac caactgtaacaccaaagccaacaataactcctaccataacaccaacagtaacgccaaaaccaacaatagctccgaca ccaactcctactacagtaccagtggagggagcaaaaccggtggtagtagtaactacgaaaaacaatgggaacacgat aagccagcaatacacaataaatgcacttggtggaacgattgatttgtcaaaggtatctattgagtttactgccgatg gaatcatcaatcaagagcataatgtttgggtagataacgctgcgttgcaattaacagttgaaccatattacacaccg ttaaatggttatgtttctgggcagttgacgaatcaaaaacttgtggttagcatcagtaagagtacgatgctgtcaga aggaacaggaaagcttgttcttgatttacgatttgctaagaaggattggacggattttggtacgatatccaatgaag tgttaaaggtttactataatggagtcaaagttcaa Clostridium atgtttaaattaaataagaaagtttttgcattagtttctgtaattgcattaggtttttctagcttatttacatcaac phytofermentans tgctcatgcagcaactgattactggcagaattggactgatgggtggaacagtgaacgctaccaatggttctggtggt aactacagtgttaactggacgaattgtggtaattttgttgtaggtaaaggttggggtactggaaatgcatcaagagt tgtaaattacaatgctggtgtattttcaccatctggtaatggttatttaactttctatggttggacgagaaattcac tcattgaatattatgttgttgatagttggggtacttatagaccaactggaactttaaagggtacagtttctagcgat ggtggaacatatgatatttatacaagtacgagaactaatgcaccttccatcgatggtactcagactttccaacaata ctggagtgttagacagtctaagagagctaccggaagtaacgtagcaattacttttagtaaccatgttaatgcttgga agagtaaaggaatgaacttaggaagcagctgggcttatcaagcattatgcgtagaaggatatcaaagcagtggtagt gctaatgtaacggtttgg Clostridium atgggtaaaaaagtaatagctttattaacatgtgttatgctttcgcttacgctgattccgggtatcggcataaaga phytofermentans gcactgcacaagccgctgaaaccaacatctataaagtagattggagcaaatttaatgagggtgacaaaatcagcgg tcccatggagggtttaggtagatcaggcggagcagatatcacggttacgggctcctctaccaaatcattttacata cttaatcgtaaagataactgggatgcacttgatattcagaacgatcttttgaagttagatcgagatgcaacctatg aaatcacagttaccggtcatgttgacagcaatgtagatactaagaatgctagtgtcaagcttggcggtgtaacaag gaaaacgggcgaggatgatggatacccagagttcaaaaaagagaaactacaatcgggcaagagttttgtactaacc tatgaacttaaactttctgatcaaattccggacgcttcaagaaatctgtgggtgctccgtgttcagaccgacgaac caagcggaagtagggccggagatcttgtaccgttctatgtggatgatatcgtgattattcaaacaaaggcatccac tgctcctgtagctgtgactggtgaccttatgtcactttacgaacttaatgcggacaaaactctcaaggttggagaa tcattatcaagtccagctctgaaagtttctggtaatgctaagatagttgttgtagaaggcaccgatggtaccgtgt cattacaactgaaagaccgtgttaataattatgacggtgtagacatccttcgtgatgcactgaaaataaacgataa atttatgtctggtacatacacgattgaggtaaaaggccatgtagaggatggttctgatttaagtaaatcccagttt gttatgggtatgaccgaatctccatggggcgaactcacttcaagagtgacgccaagtagtgacggtagctttgtaa taacttataccaaagcatacaccggaagtgaattgacaggcctaggttatagctaccgagttcagacacctccaag cgttctcacatcgttttatatcgataacattaccgttacggttcagggagctgaagaagaagatgagtcaactgtg gttatacctgaatgggatttaacccttgattccattaaagatgcatacgctgattacttcatgataggtaatatta atggaaccaggtcagtacaggatacagaaaccaccgaaatgtttaagcatcattataatgttgttaccgcagaaaa tgccatgaaaccagggaatatttccaaggtaaaaggcgaatacaattttgacaatgctgataagcttgttacgtgg gctaaagaaaatggtttaaaagtccacggtcatactttagtttggcactctcagtcagctccatggttgactacaa catgcggatggaacaccttaacacgtgcagaagcaagagctaatatggaagattatattaagaacgttgcaggaca ttacgcagggaaggtgatttcatgggatgtattaaatgaagcatttttgccaggtgtatccgaaatccctgctggc tggagggatgtattacgcaaatttgaagataacggaaatggttctccttggtatcaagcctatgaaaacggtgctg ataagagcaagggcgaggatggctctgattatatctatgacgctttcgtgtttacacgtcttgccgctcctgatgc agtgctgtattataacgacttcaatgagacagaggcaggtaagtgtgaagcgatcgccttgatggtggaagaatta aacacaaagtggaagaccgataaacggaacactgagcctgacagattgctcatcgaaggaatcggaatgcaggcac attattggaccggagatttaaaggtttccactgtagaagctagcatcaagcgtttcataaaaacaggtgctaagat cagtttatctgagctggatgttcctcatggcgattacatgacctacaagcaacgtactgactctcctacaaaggaa gaagagaaacttcaggcggatttatacaagcagttgtttgaagtatacaaaaaatatgcggacaacatcgaacgtg tcacctctggggtaaaacagatcctcaaagctggcgtttccaaggttatccattactgtttgataaaaattttgct ccaaaggacgcattctttgctgtaattgatgtagcaaaggaaaaggtagcagaggaaaaggctgttgaaaccatac ctggtaaagatatcccgaaaacaggggaagacagcagtaagcaaatgattttgactgcagtagctattctgattat attggtattcgtaccagttacgatcttaacaaaacgaagagagaagaatataaagaatata Thermobifida atgggtctccccgtctccgtccacaggagtgacacaaaaaaatgagggtgggccgatacatcgccatcacgg fusca ttggggcctccgcgctgctcgtctccggggtggcgccggcggcggcgggtaccgctgccgacgtccgggacg gccgccggcgcggcgtcgcaggccgggcacgatcagaagcaggtaccgctccgcaaggtggcgccgaagggc cttgcgatcggcgtggccgtcgcgggtggtggccaccatctggaccaggagtacccggaccccttcaagtac gacgaggagtaccggggggtgctcgccaagcacttcaactcggtcactcccgagaaccacttgaagtgggac ttcgtgcacccggagcggaaaaagtacaacttcgggcctgctgaccagatcgtcaagtttgcccagagcaac gggcagaaggcgcgcggccacacgctggtctggcacagccagaaccccgactggctcaccaaggggaagttc agcaagaaggagctccgcaagatcctcaaggagcacatcatcacggtggtgggccgctaccggggcaagatc caccagtgggacgtggccaacgagatcttcgacgacaacggtaagctccgcacgaacgagaacatggctgaa gaacttcgggccggagatcatcgccgacgcgttccgctgggcccaccaggccgacccgaaggcgaagctgtt cctcaacgactacggcgccgagggcatcaacaagcgcagcgacgcctacctcaagttcatgaaggagctgcg caagaagggcgtgccggtacacggcttcggcgtgcaggggcacctgagcctggcctacccgttcccgggcga catggcgaagaacctcaagcggttctcggacgccgggttcgaggtcgcggtcaccgaggtcgacgtgcgcat cccgctcaacggcggcgacgccactgaagcccagctcaagacccaggccgactactaccgccgcgccctgga ggcctgcctgagcgtcaagagctgcaactccttcaccctctggggcaccacgaacaagtactcgtgggtgcc ggtgttcttcccggacgagggcgaggcgacgatcttctgggacgacttctcccccaagcccgcgtacaccgc cctgcaggaggccctggcgaaggcccgccgccgc Thermobifida atgaaccatgcccccgccagtctgaagagccggagacgcttccggcccagactgctcatcggcaaggcgttcg fusca ccgcggcactcgtcgcggtcgtcacgatgatccccagtactgccgcccacgcggccgtgacctccaacgagac cgggtaccacgacgggtacttctactcgttctggaccgacgcgcccggaacggtctccatggagctgggccct ggcggaaactacagcacctcctggcggaacaccgggaacttcgtcgccggtaagggatgggccaccggtggcc gccggaccgtgacctactccgccagcttcaacccgtcgggtaacgcctacctgaccctctacgggtggacgcg gaacccgctcgtggagtactacatcgtcgaaagctggggcacctaccggcccaccggtacctacatgggcacg gtgaccaccgacggtggtacctacgacatctacaagaccacgcggtacaacgcgccctccatcgaaggcaccc ggaccttcgaccagtactggagcgtccgccagtccaagcggaccagcggtaccatcaccgcggggaaccactt cgacgcgtgggcccgccacggtatgcacctcggaacccacgactacatgatcatggcgaccgagggctaccag agcagcggatcctccattcgtgacgttgggcaccagcggcggtgacaaccccggtgggggcaacccccccggt ggcggcaacccccccggtggcggtggctgcacggcgacgctgtccgcgggccagcagtggaacgaccgctaca acctcaacgtcaacgtcagcggctccaacaactggaccgtgaccgtgaacgttccgtggccggcgaggatcat cgccacctggaacatccacgccagctacccggactcccagaccttggttgcccggcctaacggcaacggcaac aactggggcatgacgatcatgcacaacggcaactggacgtggcccacggtgtcctgcagcgccaac Clostridium atgaagcgtaaggttaagaagatggcagctatggcaacgagtataattatggctatcatgatcatcctacatag stercorarium tataccagtactcgccgggcgaataatttacgacaatgagacaggcacacatggaggctacgactatgagctct ggaaagactacggaaatacgattatggaacttaacgacggtggtacttttagttgtcaatggagtaatatcggt aatgcactatttagaaaagggagaaaatttaattccgacaaaacctatcaagaattaggagatatagtagttga atatggctgtgattacaatccaaacggaaattcctatttgtgtgtttacggttggacaagaaatccactggttg aatattacattgtagaaagctggggcagctggcgtccacctggagcaacacccaaaggaaccatcacagtggat aggcggtacttatgaatatatgaaactacccgggtaaatcagccttccatcgatggaactgcgacattccaaca catattggagtgttcgtaatccaagagaacaagcggaacaatatctgtcactgaacattttaaacagtgggaaa gaatgggcatgcgaatgggtaagatgtatgaagttgctcttaccgttgaaggttatcagagcagtgggtacgct aatgtatacaagaatgaaatcagaataggtgcaaatccaactcctgccccatctcaaagcccaattagaagaga tgcattttcaataatcgaagcggaagaatataacagcacaaattcctccactttacaagtgattggaacgccaa tataatggcagaggaattggttatatgaaaatggtaataccgtaacttacagcaatatagattttggtagtggt ggcaacagggttctctgcaactgttgcaacgaggttaatacctcaattcaaatccgttctgacagtcctaccgg aactctacttggtaccttatatgtaagttctaccggcagctggaatacatatcaaaccgtatctacaaacatca gcaaaattaccggcgttcatgatattgtattggtattctcaggtccagtcaatgtggacaacttcatatttagc agaagttcaccagtgcctgcacctggtgataacacaagagacgcatattctatcattcaggccgaggattatga cagcagttatggccccaaccttcaaatctttagcttaccaggcggtggcagcgccattggctatattgaaaatg gttattccactacctataataacgttaatttcgccaacggcttaagttctataacagcaagagttgccactcag atctcaacttccattcaggtgagagcaggaggagcaaccggtactttactgtgcatgatattacccttgtcttt tcaggaccagtgaatgtggactacttcgtatttacaccagcaaatgtaaattcagggcctacctcccctgtcgg aggtacaagaagtgcattttccaatattcaagccgaagattatgacagcagttatggtcccaaccttcaaatct ttagcttaccaggtggtggcagcgccattggctatattgaaaatggttattccactacctataaaaatattgat tttggtgacggcgcaacgtccgtaacagcaagagtagctacccagaatgctactaccattcaggtaagattggg aagtccatcgggtacattacttggaacaatttacgtggggtccacaggaagctttgatacttatagggatgtat ccgctaccattagtaatactgcgggtgtaaaagatattgttcttgtattctcaggtcctgttaatgttgactgg tttgtattctcaaaattcaggaacttaagggtatag Clostridium atgaataaattcttaaacaaaaaatggagcttaattttaaccatgggaggtatttttctgatggcgactttatcat stercorarium tgatttttgcaacggggaaaaaggcctttaacgatcaaacttctgctgaagacatcccatcgcttgctgaggcttt cagagactattttccgattggagcggccattgagcctgggtataccacaggccaaatagccgaactgtataagaaa cacgtgaacatgctcgtggcggaaaatgcaatgaaaccggcgtcacttcagccgacggaaggtaattttcagtggg cagacgctgacagaattgtgcagtttgcgaaagaaaacggtatggaactgcgcttccacactcttgtgtggcataa tcagacgccgactggtttttccttggataaagaaggaaaaccaatggtggaggagactgatccacagaagcgtgaa gaaaacaggaaacttctgctgcaacggcttgagaattatattcgtgctgtggttttacgctacaaagacgacataa agtcatgggatgtggtgaatgaggtaattgaacccaatgatcccggcggtatgagaaacagtccttggtatcagat taccggtaccgagtacatcgaagtggcattccgtgcggcaagggaagcgggaggatccgatattaagctttatatc aacgattacaatacagatgaccctgtcaagagagatatactgtatgaattagtgaaaaatttgctggagaagggtg tgccgattgacggggtgggacatcagacacatattgatatttacaatccgcctgtcgagcgaataatagagtctat aaaaaaatttgccggactgggactggacaacataattaccgaactggacatgagcatatattcatggaatgaccgc agcgattacggcgatagtatacccgattatatcctgactttacaggccaaacgttatcaggaactgtttgatgcgt taaaggaaaataaggacattgtaagcgcagtggtgttttggggcatttcggacaaatattcctggttgaacgggtt tcctgtaaaacgtaccaatgccccgctgctgttcgacagaaatttcatgccgaaaccagctttctgggcgatagtt gatccttcacggttgcgggaataa Clostridium atgaatggccgtaatgggggtaaaagacctatagcgagcctgcttgtgctcacacttgcatttttaucauccgg stercorarium taacgaaggcagaaacaacggtttatcatgagacttttgccgaaggaaagggagcggcggtacagtcaggcggg gcgaccattacgcacgttaccggaaaattttttgacggcaacggggacggagcggcactgtacatatccaacag agtgaacaactgggacgctgcagatttcagattcagcgacataggtcttcaggacggaagaatttataaaataa cggtaaagggatatgtggatcccgatgttcatgtaccggagggttcccagatatggcttcagaccgttaacagc tatgggtggtggggcagtaccgacataaaggccggtgaagcctttactctgacgggcgtatataaggtggatac aaccaatgattatgctctgaggattcagtccaatgacaccggagcatttgttccgttttatatcggtgaaatat tgatcaccgaagaaacggttcctcaggatgacagccgaaatgggaataaaactcatgctgagaagttcacaccc ataacctttgaggaccaaaccacaggcggatttacaggcagggcaggaaccgaaattcttacggtaaccgatga ggcaaaccataccgatggcggaagatattcgcttaaagtcgggggaaggaacgacacatggcatggcccggcgt tgggtgtggaaaaatacgtggatcagggttacgaatataaagtggcggtttatgtcaggctgatttcacctgaa agtgcacaactgcaactgtcaacgcaaattggtgaaggcacatcggcaagttacgtaaaccttgcgaaaaagaa tgttgcaatcagtgacggctgggttctgctggaaggtacataccgctacgacaatcttggcggagggtacctga caatatatgtggagagccctgacagccctgaggcatcattttatattgacgacatcaactttgaacccacgggc atgaaatctgaagagattgaaaaaggtttaaaatccttgaaggatgtgtataaggataattttctcaccggcac ggcgatatcattgcgtgacctggaaggtgtaaggtttgagcttctgaaaaaacatttcaatgcggtaactgcgg aaaatgcaatgaagccttccgaattgcagcgtgagaagggaaattttacctttgacggggcagacaggcttgta aacgccgcaataagtgcaggaatgaaagtacacgggcatacgctggtatggcaccagcagacccccgcgtggat gaatattaagttggatagcggaggaaatattgtatacctcagcagggaagaagcgcttgaaaatatgagaaatc atataagaaccgttattgagcattttggcgacaaggttatatcgtgggatgttgtaaacgaagcaatgagcgac aatccttccaatccttccgactggagaggatcactgcgtaaatcgccttggtattatgccattggcgaagacta cgtggaacaggctttccttgccgcgagagaggtgctggatgaacaccccgaatgggatattaagctttactaca acgattacaaccttgataaccagaacaaagctttggctgtttacaacatggtaagagaacttaacgaaaaatac cagaaaactcatccgggaaaactccttatcgacggtataggcatgcagggacattattctgtaaatacaaatcc gaagaatgttgaactgtcactgaagcggtttaccgaactgggtgtggaggtcagcataagcgaactggatatcc gtgcgggcagcaauatcagctcaccgagaaagaggcgaatgcccaggcctacctttacgctcagttgttcaaaa ttttccgtgaatattccgacagtattgcacgggttacgttctggggaatggatgacggtacaagctggagggcg gaagaaagcccgctgctgtttgacaggaccctaaaagccaaacctgcgtattacgctgttgcagatccggacga attcattgagaaatataagcctgaaacaatagaagccaaccgggcatatgcggtttacggcacacctgaaattg acggaaaaaccgatgaagtttggaacaaggcacctgagctgaaaattaacaggtaccagaccgcttggcatggc gccgacggcaccgcaagggttctttacgacgaaaacaacctgtacgttctgatcaaggttaatgacacacagct tgataaaggaagcccaaatccatgggagcaggattcggttgaaatatttatagacgaaaataatgcaaaaacat cattttatgaggaagacgacggccagtacagggttaactttgaaaacgagacatcctttaatccggaaagtata gccggcggttttgaatcggccgcggaagtttcgggaacaaactataccttggaagtgaaaataccgttcaggac cgtgaaacccgtcagcaatatgcaaatcggatttgacgtgcagattaacgacggaaaaaacggagtgcggcaga gcattgcaacatggaatgacccgactggaaatgcatggcaggatacttcggttttcggtattcttactttgaaa tcaaaaaatccggttacccgcggtgaagccattgtaaaaattatgaaggcttatgatatggaaccactggaaaa ctggaacgacaatttctccgatgcttcgggaagctacgcgggatattacccgagagcaaaggaaacgggttttg tcagcggtatcggggacaataagataggtgctgaaattccgcttacccgggaaatgttttttacaatgatttat aatatcgaacgaataacagggaaaatgcaggggatagatatttcagacgcggaacttacacttttcagcgatta taacgacttgtcggagtgggccgaagaggcagttaaggcattggttaaatcaggcaggatcaaaattaacggcg atttattgccgaagcggcttatggacgctgaagaagtggaggcatttttaagattaagataa Bacillus atgattccacgcataaaaaaaacaatttgtgtactattagtatgtttcactatgctgtcagtcatgttagggccagg subtilis cgctactgaagttttggcagcaagtgatgtaacagttaatgtatctgcagagaaacaagtgattcgcggttttggag ggatgaatcatccggcttgggctggggatcttacagcagctcaaagagaaactgcttttggcaatggacagaaccag ttaggattttcaatcttaagaattcatgtagatgaaaatcgaaataattggtataaagaggtggagactgcaaagag tgcggtcaaacacggagcaatcgtttttgcttctccttggaatcctccaagtgatatggttgagacctttaatcgga atggtgacacatcggctaaacggctgaaatacaacaagtacgcagcatacgcgcagcatcttaacgattttgttacc ttcatgaagaataatggtgtgaatctttacgcgatttcggtccaaaacgagcctgattacgctcacgagtggacgtg gtggacgccgcaagaaatacttcgctttatgagagaaaacgccggctcgatcaatgcccgcgtcattgcgcctgagt catttcaatacttgaagaatttgtcggacccgatcttgaacgatccgcaggctcttgccaatatggatattctcgga actcacctgtacggcacccaggtcagccaattcccttatcctcttttcaaacaaaaaggagcggggaaggacctttg gatgacggaagtatactatccaaacagtgataccaactcggcggatcgatggcctgaggcattggatgtttcacagc atattcacaatgcgatggtagagggggactttcaagcttatgtatggtggtacatccgaagatcatatggacctatg aaagaagatggtacgatcagcaaacgcggctacaatatggctcatttctcaaagtttgtgcgtcccggctatgtaag gattgatgcaacgaaaaaccctaatgcgaacgtttacgtgtcagcctataaaggtgacaacaaggtcgttattgttg ccatcaataaaagcaacacaggagtcaaccaaaactttgttttgcagaatggatctgcttcaaacgtatctagatgg atcacgagcagcagcagcaatctacaacctggaacgaatctcactgtatcaggcaatcatttttgggctcatcttcc agctcaaagcgtgacaacatttgttgtaaatcgt Bacillus atgaggaaaaagtgtagcgtatgtttatggattctagttttattattgagctgcttatctgggaagtctgcgtatg subtilis ctgccactagtactacaattgcaaaacatatagggaattcaaatccgcttatcgaccatcatttgggagcggatcc ggttgcgctgacctataacggaagagtctacatctatatgtcaagtgatgactatgaatataatagcaacggaaca attaaagataattcatttgccaatttgaatagagtattcgtcatatcttcagcggatatggtgaactggacagacc acggagccattccggtagcaggtgccaatggagctaatggaggccgtggaattgcaaaatgggcaggtgcgtcatg ggcaccgtcaatcgcagttaaaaaaattaatggcaaggataaattcttcctttatttcgcaaacagcggcggaggt atcggggttctcaccgcagacagcccgattggtccatggaccgacccaatcggaaaaccgctcgtaacgccaagta cgccaggaatgtctggtgttgtatggctttttgatccggcagtatttgtagatgacgacggaaccggttacctgtt gccggcggaggcgttcctggcgtttcaaatccaacgcagggacaatgggccaatcctaaaacggctagagtcataa aattggggcctgatatgacgagtgttgttggaagtgcatctacaattgatgcgcctttcatgtttgaagattcggg attgcacaagtataacggaacatattattactcctattgcatcaatttcggcggcacgcacccggccgataaaccc ccgggtgagatcggctacatgaccagttcaagtcccatgggtccctttacatatagagggcacttcctgaaaaatc cgggtgcatttttcggaggtggcggaaacaaccatcatgctgttttcaattttaaaaacgagtggtatgtggtgta ccatgcgcaaactgtcagttccgctctgttcggggccggcaaaggataccgctctccccatattaataagctggtg cataatgcagatggatctattcaagaggtagcggcaaattatgcaggtgtaacacaaatttccaatttaaacccat ataaccgggtagaagctgaaacgtttgcttggaatggacgcattttgacagagaagtccacagcacccggcgggcc agtaaataatcagcatgtaacaagcattcaaaatggagactggattgctgtaggaaatgcagacttcggagcgggc ggtgccaggtcatttaaagcaaatgtagcatccactttaggcgggaaaatagaagtgcgcctcgacagtgcagacg gtaagcttgttggaactctgaatgtgccttcaacaggcggagcgcaaacgtggagggaaatagaaactgcggtaag cggggcaaccggtgtgcacaaagtattctttgtatttaccggaacaggtacaggaaacttgtttaattttgattac tggcagtttacgcaaaga Bacillus atgtttaagtttaaaaagaatttcttagttggattatcggcagctttaatgagtattagcttgttttcggcaacc subtilis gcctctgcagctagcacagactactggcaaaattggactgatgggggcggtatagtaaacgctgtcaatgggtct ggcgggaattacagtgttaattggtctaataccggaaattttgttgttggtaaaggttggactacaggttcgcca tttaggacgataaactataatgccggagtttgggcgccgaatggcaatggatatttaactttatatggttggacg agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactggaacgtataaaggtact gtaaaaagtgatgggggtacatatgacatatatacaactacacgttataacgcaccttccattgatggcgatcgc actacttttacgcagtactggagtgttcgccagtcgaagagaccaaccggaagcaacgctacaatcactttcagc aatcatgtgaacgcatggaagagccatggaatgaatctgggcagtaattgggcttaccaagtcatggcgacagaa ggatatcaaagtagtggaagttctaacgtaacagtgtgg Bacillus atgaagattaccaatcccgtacttaaaggattcaatcccgatccaagtatttgtagagcaggagaggattattatat subtilis cgctgtatctacatttgagtggtttccgggagtccagatacaccactcaaaagatttagtaaattggcacttagttg cacatccattacagagagtttcacaattagacatgaaaggaaacccaaattcaggtggagtttgggcaccatgttta agctatagtgatgggaagttttggctgatctatacggatgttaaggtagtagatggcgcatggaaagattgtcacaa ttatttagttacttgtgaaacgattaatggtgattggagtgagccgattaaattaaatagctcggggtttgatgctt ctttgttccatgatacggatggaaaaaagtatttattaaatatgttatgggatcaccgtattgatcggcactcattt ggaggaattgttatacaggaatattctgataaagagcaaaaattaatcggtaaaccaaaagttatatttgaaggaac tgatagaaaactgacagaagctccgcatctttatcatatcgggaactattattatttattaactgcagaaggaggaa cacggtacgaacatgctgctacaattgctcgttctgcaaatattgaggggccatatgaagttcatcccgataatcca attttaacgtcatggcatgacccaggaaatccattgcaaaaatgtggtcatgcatccattgttcaaacacatacaga tgagtggtatttagctcatttaacgggacgtcctattcatcctgacgatgattcaatttttcagcagagaggatact gtcctttgggcagagaaacagctattcaaaaactttactggaaagatgaatggccctatgtagtaggtggaaaagaa ggaagcttggaggtagatgcaccttctatacccgaaacaatatttgaagcaacgtacccggaagttgatgaatttga ggattcaacattaaatataaattttcaaactttaaggattccattcacgaatgaattaggttcattgactcaagcgc caaatcatttacgattattcggtcatgaatcattgacctcgacatttactcaggcatttgtagccagacgctggcaa agtctccattttgaagccgaaactgctgttgagttttatccggaaaattttcaacaagccgctgggttggtgaatta ctacaatacagagaactggacggctcttcaagtcacgcatgatgaagaacttgggcgcattcttgaattaacaatat gtgacaacttttctttttcacagccattaaataataaaattgttattcctcgtgaagtaaagtatgtatatttaaga gtaaatattgaaaaggacaaatattattatttctattcttttaacaaagaagattggcacaaaattgacattgcact ggaatcgaaaaaattatcagatgattatatccgtgggggaggattcttcacaggggcctttgtagggatgcaatgcc aagataccagtggtaatcatattccggccgactttagatattttcgttataaagaaaaa Thermo- atgaagagtattgtaaacagagttgtatctatcgttacagctttaataatgatttttgggacatcactgttttcacaa anaerobacter- cacataagggcatttgctgatgacactaatacaaatctggtttctaatggggactttgagacaggcacaattgatggc ium tggattaagcaaggtaatcctacattagaagtaactactgaacaagcaattgggcaatacagtatgaaagttacgggt saccharolyticum agaacacagacatatgaaggacctgcatatagctttttaggaaaaatgcagaaaggtgaatcatataatgtatcgctt aaagttagacttgtttctgaacaaaattcatctaatccttttattaccgtgactatgtttagagaagatgacaatggc aagcattatgatacaatagtttggcaaaaacaagtttctgaagattcatggactactgtaagcgggacttatacatta gattatactggaacattaaaaacattatacatgtatgtagaatcacccgatccaacgctggaatactatattgatgat gttgtagtgacaccacaaaatccaatacaagtaggaaatgtgattaccaatggaacttttgaaaatggaaatacttca ggatgggttggaacaggctcatctgttgttaaggcagtgtatggagtggctcatagcggaggttatagtttattgacg acagggagaacagctaattggaatggtcctagctatgatttgactggcaaaatagtaccaggtcaacaatacaatgtt gatttttgggtgaaatttgttaatggcaatgatacagaacaaataaaggctactgttaaagcgacttctgacaaagac aattatatacaagttaatgattttgcaaatgtaaataaaggcgaatggacagaaataaaaggcagttttactttacct gtggcagattacagcggtgtcagcatctatgtagaatctcaaaatcctactttagagttttacattgatgatttttct gtaataggtgaaatttcaaataatcagattacaatacaaaatgatattccggatttatattcagtattcaaagattat ttccccatcggtgttgcagttgatccgagtagattaaatgatgctgatccacatgctcaattgactgctaaacatttt aatatgcttgttgcagaaaatgccatgaaaccggaaagcttgcagcctacagagggaaactttacctttgataatgct gataagattgttgattatgcaatagcacataatatgaagatgagaggtcatacattgctttggcataatcaggttccg gattggtttttccaggacccatctgatccgtctaaaccagcttcaagggatctgctgcttcaaagattaagaacgcac ataacaactgtgttagatcattttaaaacaaaatacggttctcaaaatccaataatcggatgggatgttgtaaatgag gttcttgatgataatggcaatttaagaaattctaagtggttacaaattataggacctgattatatagaaaaagccttt gaatatgcgcatgaggcagatccatctatgaaattgtttattaatgattacaacatcgaaaataatggcgttaaaaca caggcaatgtatgatttagtgaaaaagttaaaaaatgaaggtgtgcctataaacggaataggcatgcaaatgcacata agcataaattcaaatatagacaatataaaagcttctatagaaaaacttgcatcattaggtgtggaaatacaggtaact gaattagatatgaacatgaatggtgatgtatctaacgacgcattgcttaagcaagcgagattgtataaacaattattt gacttgtttaaagcagaaaaacaatatataactgctgtagttttttggggagtttcagatgatgtaagttggcttagt aagccaaatgctccgctactttttgattcaaagttacaggcaaagccagcatactgggcaattgtagatccaggcaaa gccatacctgacattcaatctgcaaaagctttagaaggatcaccgacgattggtgcaaatgttgatagttcttggaaa cttgtaaaaccattgtatgctaatacttatgtgaaaggaactattggagcaactgctgctgttaaatctatgtgggat actaaaaacttatatttgttagtacaaatttcagacaatactccatctaataatgatggcatcgagatttttgtggat aagaatgacaacaaatctactacctatgaaagtgacgatgaacattatatagttaagagggatggtacagggagttca aatattacaaagtatgtaatgtctaatgctgatggctatgtagcacagatagctattccaattgaagacattagtcct gtgctgaatgataaaattggatttgatatcagaataaatgatgaccaaggcagtggcaatgtaaatgcgataacagtt tggaatgattatacaaacagtcaagatactaatacggcatattttggagatttagtattatcaaaacctgcacagatt gcaacagctatatatggcactcctgttattgacggtaaagtagatggcgtttggaataatgctgaagctatttcgaca aatacatgggtcttgggttcaaatggtgctactgcaacagcaaaaatgatgtgggacgataaatatctttatatattg gcagatgtaacagataacaatttaaataaatccagtgtaaatccttatgaacaggattctgtggaagtttttgtagat cagaataatgataagacaacttattatgaaaatgatgatgggcagtttagagttaactatgataatgaacaaagtttt ggaggaagcactaattcaaatggatttaagtcggcaacaagtcttacacaaaatggatatattgtagaagaagctatt ccttggacgagtattactccgttaaatggtactatcatagggtttgacttgcaagttaacgatgcagatgaaaatggt aagaggacaggtattgtcacatggtgtgatccaagcggaaattcatggcaagatacttctggatttggaaacttgatg cttacaggtaagccatcttggggcagtacaagtaattcgggaactacaagcagtagcagtaatacaagcagtacaata ggtgtaatcacaaagaacggcaacgttattacattgatacttgatgcaggaaaagctaaagaccttatagtaaattca aaggacaagaaagtcgtatttgacataacaacaataggtgaaggacaacagaaagttgtgcagatttctaaggacatt ttagacacaagtgctgccaacggcaaagacatcgtcataaaatcagacaatgcatcgatagcactcacgaaagatgct taatcaaaaccagatacaaaacggtgtcaatgtatcaataaaagacaatggaaagcctacaatgtgacaaattatgtg acgctttctaatgtagtagatataacaataagcggtagcagtgggaatgtagcattggcaaaaccagtagaggtgaca ttaaatatatcaaaagctaacgatccaagaaaagtagcagtttactactacaacccaacaacaaatcaatgggagtac gtagggggtaaagtagacgcatcatctggaacaataacattcaatgcaacgcacttttcacaatatgcagcatttgag tatgacaagacatttaatgacataaaagacaattgggcgaaagacgtaatagaagtattagcatcaaggcatatagta gaaggaatgacagatacacagtatgaaccaaacaagacagtgacgagagcagaatttacagcaatgatactgaggctt ctaaacataaaagaagaagcatacagtggagaatttagcgatgtaaaaagtggagactggtatgcaaacgcgatagaa gcagcatacaaagcagggataatcgaaggtgacggaaagaacgcaaggccaaatgacagcataacaagagaagagatg acagcaatagccatgagggcatacgagatgctgacacagtacaaagaagagaatataggtgcgacaacatttagcgac gacaaatccataagcgattgggcaagaaatgtagtggcaaatgcagcgaaattaggaatagtaaatggtgagccaaat aacgtatttgcacctaaaggaaatgccacaagagcagaagcagcagctatcatatacggcttattagaaaaaacaaat aatctttaa Thermo- atgataagtaaatctttttatgcgcatcacagcgcatttggcgctttctcaagttttgtaatcggtaaatgcggtaa anaerobacter- aggcggtggcgtcgtactaaatgatgttcggccgcctgaaaacaacgtctacattggatacaaaagagatggtgtta ium taagcttgctgccatttattaaagatgatacaaaaaatgctgaagaagagtttacaggagaagtctctacaagcaaa saccharolyticum aaagaaaaaaacataaaaatctttggggaagatgagatagaaagagagttatgctgggcatcagacacttggacagc aggagacttcaaattttccatcatcactccatttggatacgtaaaagatccttcggtgatgaatggagacgaaaaga aacttgcactggcacctgtcatatttgtacagttgacaatggataatactgacagcgataaggatgctgagatgata tttggctttgaaggtccgaaaaggatattatctgagcttacagatggaaaatacttaggaggagtatacggcagaaa atacggttttgctatcaaaaaaagcgatgatgtaagagagctttcaaggcttgatattttgacatcatgggcaaatg acaactatcaaaatcatgggcttggcagagcgccgtctttgatatttaaagtgccgagaggggagaaaaggacatat actgtggcattggcaacgtatcaaagcggcgtcataacaacaggaatcgatgctgaattttactacacatctgtttt taagtcattggaagaagtattatcctttggacttgacaatcaagattattacttaaatttagcaaaggaaagagatg aagagcttaagaaaagcggtttaaatgaatacaggcagtttttattggcacatgcagcccacagttactatgccagc acggagcttttaaagagagacgatggtatgcctctttgggtggtaaacgaaggcgaatacattatgataaatacatt tgatttgacggttgatcatgtcttctgggaaatgaggttccatccttggacgattacaaatacattggatctgtact atgaaaagtacagctacagggatcaagcaggtcttgcctttacgcatgatatgggtgtcgcagatggtttttctaaa gaaggctattcatcttacgagcttccaaacctgactggatgttttagctacatgacacatgaggagcttttgaattg ggttttgacaggttctgtctatgcaataaaaataaatgataaagaatggttaaagaaaaacatgggtgtattcgaag attgtttcgattctcttgtggcaagagataaaaataatgatggaataatggacgttgacagttcaaggtgtgagacg gggtcggaaataacgacttacgatagccttgacgaaagcttgggacaggcgagaaacaatctataccttggtgttaa gacatgggcagcttacgtgatgttgcatggtttgtttaaagaaaatgatcttagtgaaaaggcagaaaaagctttag aaaaggcaagacaggctgctaatactatcgttgccaagtttgacgaagaaaatcagtatatacctgcagtatttgag aatggcaacacatcaaggataatacctgctgtagaggcattggtatatccatatgttgtaggatatactgactttgt aagtgaagatggtgtatttggtgggcttataaaagccttaaagaagcatgtaatgacgattatgaagcctggtatat gcatagatgaagtatctggaggttggaagctttcgtcaaccagcaagaacacatggaatagtaaaattttcttatgc caatatgtgataaaagatgtgcttaatatagactttggagacaaagagattgagtgggacaaagtacacgcaatgtg gcaacaggtgtcttgcagtgaagattgcgctacagatcaggtaaacagcgatacaggtacgccaagaggaagccgct tgtatccgagacttgtgacaagtgtattgtggatgaaatag Thermo- atgattaaagtgatagtgccagatttttccgataagaagttttctgataggtggagatattgtgttggaacaggcag anaerobacter- acttggccttgcgctacaaaaggaatacatcgatacattaaaatatgtgaaagaaaacatagactttaagtatataa ium gaggacatggccttttgtgtgacgatgtaggaatatacagagaagatgtggtaggcgatgaaataaagcctttttac saccharolyticum aattttacctatatagataggatttttgactcatttttagaaatcggaataaggccatttgtggaaatcggatttat gcctaaaagattagcatctggtacacaggcggtattttattgggaggggaatgtcactcctcccaaggattataaaa aggggagaacctcataaaagctgtcgtttcgcatttcatatcaaggtacggaatagatgaagtggcaaaatggccat ttgaaatttggaatgagccgaacttaaaagagttttggaaagatgctgacgagaaggagtattttaagctgtacaag ataactgcaaaggctataaaggaagtaaatgagaatataaaagtaggaggacctgctatatgtggtggtgctgacta ttggatagaagattttttgaatttctgctatgaggaaaatgttcctgtagattttgtgtcgcgacatgcgtatacgt ctaagcaaggcgaatatacgccgcacttaatataccaagagatcatgccgtcggaatacatgctaaacgaatttaaa acggtgagagatatcattaaaaactcgcattttccaaaccttccgtttcacataactgaatacaatacatcttacag tcctcaaaatcctgtacatgatacgccatttaatgctgcctatattgccaggattttaagcgaaggcggagattatg ttgattcattttcttactggacgtttagcgacgttttogaagaaagagatgtgccgcgatcgcaatttcatggagga tttggacttgtggctctaaatatggtaccaaagcctaccttttacacatttaaattttttaatgctatgggagagga aatgtatagagatgagcatatgattgtgacgagaagggatgatggctctgttgcgctcatagcgtggaatgaagtca tggataagactgaaaatccagataaagagtatgaagtccagataccagttggattcaaagatgtgtttattaaaaga caattaattgatgaagaacatggcaatocatggggaacgtggatacacatgggtaggccgaggtatcccagcaaaaa agagataaatacgcttagagaaattgcaaagccggagattatgacaagccatgctgttaccaatgatggatacttaa atctaaagtttaaattaggcaaaaatgcggttgtgctttatgaattgacagaaaggattgacgaatcgagcacatat ataggacttgatgatagcaagataaacggatattga
(102) TABLE-US-00003 TABLE3 ProteinsequencesofxylanasesexpressedinThermoanacrobacterium saccharolyticum Organism Sequence Clostridium mlqkmngkvkkilgisiaflmlimviptsiakaainktydfnsmtyqstwgvtysisngsgtfnftgqyreik phytofermentans fnlpetldmsqetsvtfnasspngqiafklydtsgnqvavvynfnsntsdetfapnstakvnsigimaqgtnn ysavvnrvtftmtggssgtgsstllntygnilknsgtavnlsqlqnsntlsviktqynsitlenemkpdavlgsss tlmtvaqaksngyyipssytestvptlkfstidavlqicynnglklrghtlvwhsqtpdwffrtgysssgsyvsq avmdarmemfirsymshiyngsygsvvyawdvvneylhastsgwsqvygsnlgttpsyvkkafqyayd clssfgltnsvklfyndyntyevtdqilslvnfinsgtklcagvgmqshlntsypsvsayktamqkflnagyev qvteldvtntsastqatyvydlmtailslkkaggnitgitwwglydsvswrasqnpllfsnlttpkesynkalqa ftdagy Clostridium mffkklvalamavaivipmnvnniqkveaestneavvygnliyhdfeastngwgprgdnaevvaqsteea phytofermentans ysglhslkiskrtqtwhgatcdltkeltigetyvfgiylkykgssysntqkfsqfqyndgvndqyktiktlevtk dkwtliqgeytvpadaanakvyveteyksspssqdlldfyiddftatpatlpqiqkdipslkdvfssyffvgga atageiapapakdlvakhynrltpgnelkpdsvldysatiaymdanggnqvnpqvnlraaktlleyardnni pvrghtlvwhsqtpdwffkvnysqdsnaawvskevmlqrlenyiknvmqlisstyptvkfyawdvvnea vdpntstgmrnpgsnnvtsgnspwmqtigecyiqrafeyarkyaptgcklfyndyneyedrkstfifnilkg lkdkglvdgmgmqshwvmdypsismfetavrkyntlglelqlteldikqpdnstsalaaqadryklinkvi slkkegmnitgvifwgvtdktswlggypllfdgnyqaksayysiidgitptvtpsitptvtpkptitptvtptvtp kptitptvtptvtpkptitptitptvtpkptiaptptpttvpvegakpvvvvttknngntisqqytinalggtidlsk vsieftadgiinqehnvwvdnaalqltvepyytplngyvsgqltnqklvvsiskstmlsegtgklvldlrfakk dwtdfgtisnevlkvyyngvkvq Clostridium mfklnkkvfalvsvialgfsslftstahaatdywqnwtdgggtvnatngsggnysvnwtncgnfvvgkgw phytofermentans gtgnasrvvnynagvfspsgngyltfygwtrnslieyyvvdswgtyrptgtlkgtvssdggtydiytstrtnap sidgtqtfqqywsvrqskratgsnvaitfsnhvnawkskgmnlgsswayqalcvegyqssgsanvtvw Clostridium mgkkvialltcvmlsltlipgigikstaqaaetniykvdwskfnegdkisgpmeglgrsggaditvtgsstksf phytofermentans yisnrkdnwdaldiqndllkldrdatyeitvtghvdsnvdtknasvklggvtrktgeddgypefkkeklqsgk sfvltyelklsdqipdasrnlwvlrvqtdepsgsragdlvpfyyddiviiqtkastapvavtgdlmslyelnadk tlkvgeslsspalkvsgnakivvvegtdgtvslqlkdrvnnydgvdilrdalkindkfmsgtytievkghved gsdlsksqfvmgmtespwgeltsrvtpssdgsfvitytkaytgseltglgysyrvqtppsvltsfyidnitvtvq gaeeedestvvipewdltldsikdayadyfmignimepgqiqdtettemfkhhynvvtaenamkpgnisk vkgeynfdnadklvtwakenglkvhghtlvwhsqsapwlttnadgtpltraearnmedyiknvaghyag kviswdvlneaflpgvseipagwrdvlrkfedngngspwyqayengadkskgedgsdyiydafvftrlaa pdavlyyndfneteagkceaialmveelntkwktdkrntepdrlliegigmqahywtgdlkvstveasikrfi ktgakisvseldvphgdymtykqrtdsptkeeeklqadlykqlfevykkyadniervtfwgktdpqswrfq gypllfdknfapkdaffavidvakekvaeekavetipgkdipktgedsskqmiltavailiilvfvpvtiltkrre knikni Thermobifidafusca mglpvsvhrsdtkmrvgryiaitvgasallvsgvapaaagtlptsgtaagaasqaghdqkqvplrkvapkgf aigvavaggghhldqeypdpfkydeeyrgvlakhfnsvtpenhlkwdfvhperkkynfgpadqivkfaqs ngqkvrghtlvwhsqnpdwltkgkfskkelrkilkehiitvvgryrgkihqwdvaneifddngklrtneniw lknfgpeiiadafrwahqadpkaklflndygacginkrsdaylkfmkelrkkgvpvhgfgvqghlslaypf pgdmaknlkrfsdagfevavtevdvriplnggdateaqlktqadyyrraleaclsvkscnsftlwgttnkysw vpvffpdegeatifwddfspkpaytalqealakarrr Thermobifidafusca mnhapaslksrrrfrprlligkafaaalvavvtmipstaahaavtsnetgyhdgyfysfwtdapgtvsmelgp ggnystswrntgnfvagkgwatggrrtvtysasfnpsgnayltlygwtrnplveyyiveswgtyrptgtymg tvttdggtydiykttrynapsiegtrtfdqywsvrqskrtsgitatagnhfdawarhgmhlgthdymimategy qssgssnvtlgtsggdnpgggnppgggnppggggctatlsagqqwndrynlnvnvsgsnnwtvtvnvp wpariiatwnihasypdsqtlvarpngngnnwgmtimhngnwtwptvscsan Clostridium mkrkvkkmaamatsiimaimiilhsipvlagriiydnetgthggydyelwkdygntimelndggtfscqw stercorarium snignalfrkgrkfnsdktyqelgdivveygcdynpngnsylcvygwtrnplveyyiveswgswrppgat pkgtitvdggtyeiyettrvnqpsidgtatfqqywsvrtskrtsgtisvtehfkqwermgmrmgkmyevalt vegyqssgyanvykneiriganptpapsqspirrdafsiicaecynstnsstlqvigtpnngrgigyiengntvt ysnidfgsgatgfsatvatevntsiqirsdsptgtllgtlyvsstgswntyqtvstniskitgvhdivlvfsgpvnv dnfifsrsspvpapgdntrdaysiiqaedydssygpnlqifslpgggsaigyiengysttynnvnfanglssita rvatqistsiqvraggatgllgtiyvpstnswdsyqnvtanlsnitgvhditlvfsgpvnvdyfvftpanvnsg ptspvggtrsafsniqaedydssygpnlqifslpgggsaigyiengysttyknidfgdgatsvtarvatqnattiq vrlgspsgtllgtiyvgstgsfdtyrdvsatisntagvkdivlvfsgpvnvdwfvfskfrnlrv Clostridium mnkflnkkwsliltmggiflmatlslifatgkkafndqtsaedipslaeafrdyfpigaaiepgyttgqiaelyk stercorarium khvnmlvaenamkpaslqptegnfqwadadrivqfakengmelrfhtlvwhnqtptgfsldkegkpmv eetdpqkreenrklllqrlenyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafra areaggsdiklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesikkfaglgldn iiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsavvfwgisdkyswlngfpvkrtna pllfdrnfmpkpafwaivdpsrlre Clostridium mngrnggkrpiasllvltlaflfipvtkaettvyhetfaegkgaavqsggatithvtgkffdgngdgaalyisnr stercorarium vnnwdaadfrfsdiglqdgriykitvkgyvdpdvhvpegsqiwlqtvnsygwwgstdikageaftltgvyk vdttndyalriqsndtgafvpfyigeiliteetvpqddsrngnkthaekftpitfedqttggftgragteiltvtdea nhtdggryslkvggrndtwhgpalgvekyvdqgyeykvavyvrlispesaqlqlstqigegtsasyvnlakk nvaisdgwvllegtyrydnlgggyltiyvespdspeasfyiddinfeptgmkseeiekglkslkdvykdnflt gtaislrdlegvrfellkkhfnavtaenamkpselqrekgnftfdgadrlvnaaisagmkvhghtlvwhqqtp awmnikldsggnivylsreealenmrnhirtviehfgdkviswdvvneamsdnpsnpsdwrgslrkspw yyaigedyveqaflaarevldehpewdiklyyndynldnqnkalavynmvrelnekyqkthpgkllidgig mqghysvntnpknvelslkrftelgvevsiseldiragsnyqltekeanaqaylyaqlfkifreysdsiarvtfw gmddgtswraeespllfdrtlkakpayyavadpdefiekykpetieanrayavygtpeidgktdevwnkap elkinryqtawhgadgtarvlydennlyvlikvndtqldkgspnpweqdsveifidennaktsfyeeddgq yrvnfenetsfnpesiaggfesaaevsgtnytlevkipfrtvkpvsnmqigfdvqindgkngvrqsiatwnd ptgnawqdtsvfgiltlksknpvtrgeaivkimkaydmeplenwndnfsdasgsyagyypraketgfvsgi gdnkigaeipltremfftmiynieritgkmqgidisdaeltlfsdyndlsewaecavkalvksgrikingdllp krlmdaeeveaflrlr Bacillussubtilis miprikkticvllvcftmlsvmlgpgatevlaasdvtvnvsackqvirgfggmnhpawagdltaaqretafg ngqnqlgfsilrihvdenrnnwykevetaksavkhgaivfaspwnppsdmvetfnrngdtsakrlkynky aayaqhlndfvtfmknngvnlyaisvqnepdyahewtwwtpqeilrfmrenagsinarviapesfqylknl sdpilndpqalanmdilgthlygtqvsqfpyplfkqkgagkdlwmtevyypnsdtnsadrwpealdvsqh ihnamvegdfqayvwwyirrsygpmkedgtiskrgynmahfskfvrpgyvridatknpnanvyvsayk gdnkvvivainksntgvnqnfvlqngsasnvsrwitssssnlqpgtnltvsgnhfwahlpaqsvttfvvnr Bacillussubtilis mrkkcsvelwilvlllsclsgksayaatsttiakhignsnplidhhlgadpvaltyngrvyiymssddyeynsn gtikdnsfanlnrvfvissadmvnwtdhgaipvaganganggrgiakwagaswapsiavkkingkdkffl yfansgggigvltadspigpwtdpigkplvtpstpgmsgvvwlfdpavfvdddgtgylyagggvpgvsnp tqgqwanpktarviklgpdmtsvvgsastidapfmfedsglhkyngtyyysycinfggthpadkppgeig ymtssspmgpftyrghflknpgaffggggnnhhavfnfknewyvvyhaqtvssalfgagkgyrsphinkl vhnadgsiqevaanyagvtqisnlnpynrveaetfawngriltekstapggpvnnqhvtsigngdwiavgn adfgaggarsfkanvastlggkievrldsadgklvgtlnvpstggaqtwreietavsgatgvhkvffvftgtgtg nlfnfdywqftqr Bacillussubtilis mfkfkknflvglsaalmsislfsatasaastdywqnwtdgggivnavngsggnysvnwsntgnfvvgkg wttgspfrtinynagvwapngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttryn apsidgdrttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgssnvtv w Bacillussubtilis mkitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsqldmkgnpnsg gvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepiklnssgfdaslfhdtdgkkyll nmlwdhridrhsfggiviqeysdkeqkligkpkvifegtdrklteaphlyhignyyylltacggtryehaatia rsaniegpyevhpdnpiltswhdpgnplqkcghasivqthtdewylahltgrpihpdddsifqqrgycplgr etaiqklywkdewpyvvggkegslevdapsisetifeatypevdefedstlninfqtlripftnelgsltqapnh lrlfghesltstftqafvarrwqslhfeaetavefypenfqqaaglvnyyntenwtalqvthdeelgrilelticdn fsfsqplnnkiviprevkyvylrvniekdkyyyfysfnkedwhkidialeskklsddyirgggfftgafvgm qcqdtsgnhipadfryfrykek Thermoanaerobacterium mksivnrvvsivtalimifgtslfsqhirafaddtntnlvsngdfetgtidgwikqgnptlevtteqaigqysmk saccharolyticum vtgrtqtyegpaysflgkmqkgesynvslkvrlvseqnssnpfitvtmfreddngkhydtivwqkqvseds wttvsgtytldytglktlymyvespdptleyyiddvvvtpqnpiqvgnvitngtfengntsgwvgtgssvvk avygvahsggysllttgrtanwngpsydltgkivpgqqynvdfwvkfvngndteqikatvkatsdkdnyiq vndfanvnkgewteikgsftlpvadysgvsiyvesqnptlefyiddfsvigeisnnqitiqndipdlysvfkdy fpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqptegnftfdnadkivdyaiahnmkmrght llwhnqvpdwffqdpsdpskpasrdlllqrlrthittvldhfktkygsqnpiigwdvvnevlddngnlrnsk wlqiigpdyiekafeyaheadpsmklfindynienngvktqamydlvkklknegvpingigmqmhisin snidnikasieklaslgveiqvteldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvs wlskpnapllfdsklqakpaywaivdpgkaipdiqsakalegsptiganvdsswklvkplyantyvkgtiga taavksmwdtknlyllvqisdntpsnndgieifvdkndnksttyesddehyivkrdgtgssnitkyvmsnad gyvaqiaipiedispvlndkigfdirinddqgsgnvnaitvwndytnsqdtntayfgdlvlskpaqiataiygt pvidgkvdgvwnnaeaistntwvlgsngatatakmmwddkylyiladvtdnnlnkssvnpyeqdsvevf vdqnndkttyyenddgqfrvnydneqsfggstnsngfksatsltqngyiveeaipwtsitplngtiigfdlqvn dadengkrtgivtwedpsgnswqdtsgfgnlmltgkpswgstsnsgttssssntsstigvitkngnvitlilda gkakdlivnskdkkvvfdittigegqqkvvqiskdildtsaangkdiviksdnasialtkdalnqnqiqngvn vsikdngkpnvtnyvtlsnvvditisgssgnvalakpvevtlniskandprkvavyyynpttnqweyvggk vdassgtitfnathfsqyaafeydktfndikdnwakdvievlasrhivegmtdtqyepnktvtraeftamilrll nikeeysgefsdvksgdwyanaieaaykagiiegdgknarpndsitreemtaiamrayemltqykeenig attfsddksisdwarnvvanaaklgivngepnnvfapkgnatracaaaiiygllektnnl Thermoanaerobacterium mglfdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydlyftgvrgarihak saccharolyticum yikpktegkhpalirfhgyssnsgdwndklnyvaagftvvamdvrgqggqsqdvggvtgntlnghiirgld ddadnmlfrhifldtaqlagivmnmpevdedrvgvmgpsqggglslacaaleprvrkvvseypflsdykr vwdldlaknayqeitdyfrlfdprherenevftklgyidvknlakrikgdvlmcvglmdqvcppctvfaayn niqskkdikvypdyghepmrgfgdlamqfmlelns Thermoanaerobacterium misksfyahhsafgafssfvigkcgkgggvvlndvrppennvyigykrdgvisllpfikddtknaeeeftge saccharolyticum vstskkeknikifgedeierelcwasdtwtagdfkfsiitpfgyvkdpsvmngdekklalapvifvqltmdnt dsdkdaemifgfegpkrilseltdgkylggvygrkygfaikksddvrelsrldiltswandnyqnhglgraps lifkvprgekrtytvalatyqsgvittgidaefyytsvfksleevlsfgldnqdyylnlakerdeelkksglneyr qfllahaahsyyastellkrddgmplwvvnegeyimintfdltvdhvfwemrfhpwtitntldlyyekysyr dqaglafthdmgvadgfskegyssyelpnltgcfsymtheellnwvltgsvyaikindkewlkknmgvfe dcfdslvardknndgimdvdssrcetgseittydsldeslgqarnnlylgvktwaayvmlhglfkendlseka ekalekarqaantivakfdeenqyipavfengntsriipavealvypyvvgytdfvsedgvfgglikalkkhv mtimkpgicidevsggwklsstskntwnskiflcqyvikdlvlnidfgdkeiewdkvhamwqqvscsedc atdqvnsdtgtprgsrlyprlvtsvlwmk Thermoanaerobacterium mikvivpdfsdkkfsdrwrycvgtgrlglalqkeyidtlkyvkenidfkyirghgllcddvgiyredvvgdei saccharolyticum kpfynftyidrifdsfleigirpfveigfmpkrlasgtqavfywegnvtppkdykkwenlikavvshfisrygi devakwpfeiwnepnlkefwkdadekeyfklykitakaikevnenikvggpaicggadywiedflnfcye envpvdfvsrhaytskqgcytphliyqcimpscymlnefktvrdiiknshfpnlpfhiteyntsyspqnpvh dtpfnaayiarilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmvpkptfytfkffnamgeem lyrdehmivtrrddgsvaliawnevmdktenpdkeyevqipvgfkdvfikrqlideehgnpwgtwihmg rprypskkeintlreiakpeimtshavtndgylnlkfklgknavvlyelteridesstyiglddskingy
(103) In some embodiments of the invention, multiple xylose transporters from a single organism are co-expressed in the same host cell. In some embodiments of the invention, multiple xylose transporters from different organisms are co-expressed in the same host cell. In particular, xylose transporters from two, three, four, five, six, seven, eight, nine or more organisms can be co-expressed in the same host cell. Similarly, the invention can encompass co-cultures of microorganism strains, wherein the microorganism strains express different xylose transporters. Co-cultures can include microorganism strains expressing heterologous xylose transporters from the same organism or from different organisms. Co-cultures can include microorganism strains expressing xylose transporters from two, three, four, five, six, seven, eight, nine or more microorganisms. In one embodiment, the xylose transporter may be of microbial origin, such as of fungal origin (e.g., Trichoderma, Meripilus, Humicola, Aspergillus, Fusarium) or from a bacterium (e.g., Bacillus). In another embodiment, the xylose transporter is derived from a filamentous fungus, for example from a strain of Aspergillus, or a strain of Humicola. Tables 4 and 5 below list the xylose transporters expressed in Thermoanaerobacterium saccharolyticum, and the sources of the xylose transporters.
(104) TABLE-US-00004 TABLE4 DNAsequencesofxylosetransportergenesexpressedin Thermoanaerobacteriumsaccharolyticum Organism Sequence Thermoanaerobacterium atgggtaaaaatgcaaaaaaagctttgttgtcggtgatacttatacttagtatgttgtttacgttttcggcgtgtgc themosaccharolyticum tacaacaaatcctaatcaatcaaaatctaataatcaaacaagccaaacgaccaatacatctgacaactcaggc aaaattaaaattggctttagttagatactctaaatctagagagatggcaacatgatagagactattttgttcaaa gggctaaagagttaggagctgaigtattagtacagtcagctaatagtgattcacaaacacaatattcgcaatgt caaaatttaatagcgcaaggeataaaagttttagtaataattccacatgatggaagtgcaatagcaccaatcgt tgaagaagctcataaagctggagtaaaggttttagcatacgatagattaattattaacgcagatgtagatgcat acgtgtcgtttgacaatgaaaaagttggtgaattacaagctgaagcaataacaaaactggtaccaaaaggaa attatttcttacttgaaggttcacctacagataataatgctaaattgtttgaacaaggtcaaaagaaggttttacaa ccgttagttgataaaggcgatataaaaatagttggagagcaatgggcgcaagattggcttacacaaaatgctt acaatattatgcaaaatgcactaacagctaataacaataaaattgatgcagtagttgatgcgaatgacagtact gctttaggagcgattagggctttacaagaacaaaatcttgctggaaaagttgcaatatccggtcaagatgctg atctagcaaattgtcagttgattgttgaaggcaaacaatcaatgactgtgtataagccagtaaaggaagaagc aacaaaaggtgctgatgtagcggttgccttagcaaaaaggtgaagacatcaatgcaaacggaaaggtcaata atggaaaaattgacgtaccatctgtattgcttacacctgtagccgtagataagaacaatatggtagatactatca taaaagacggattccatagccttgatgaagtttataaaaatgttcctaaagatcaatggccaaaacaatag Thermoanaerobacterium atggatatgggtgatttcatactagaaatgaaaaatataacaaaggatttttccggtgttaaagctttagacaatg thermosaccharolyticum tgaatttgaaagtcaaaaaaggagaaatacacggactatgtggtgaaaatggtgcgggaaagtcaacactta tgaaaattttaagcggtgtatatccatatggtactttttctggagagataatatttgatggaaaagaattaaaatta aataatattaaagatgcagaagatgcagggataggtataatttatcaggagttgtcattagttaaagaattgtct gtcagtgaaaatatatttattgggaatgagcctaataaaaatgggataattgattttgacaggatgtactatgaa actaaaatcttacttgataaattgaatttgaatattaatcctaatgtaccagtaaagaatttgggcattggacagc aacaattagttgaaattgccaaagctttatctaaaaatgttagcttgttgatattggatgagccaacatcatctctt acagatgctgatgttgagatattgtttaatatattaagacagttaaaagataatggtgttacatgtatatatatatct cataaattaaatgaagtaatggaaataacggatcggataacagttcagagagatggaaaaacaataggttca gaagatacaaaaaatcttacagagagtgaaattataaaaatgatggttgggcgtgaacttacgaatcttttccc aaaagaggaacatcaaattggaaaagaaatattggaagtaaaaaatttcagtgtttatgattcgaaatcatcta gcaaaaaaattgtagacaatgtcagctttactttaaaagaaggtgagatattaggaatagcaggccttattgga gctggaagaactgaacttgtttctagtattttcggatcatatccaggaagacatgaaggtgaaatctatttagaa ggtaaaaaaattaatataagaaatcctgatgaagccttggattatggaattgcaatggttccagaagatagaaa aggtcaagggttaataaatatattatctgtaagagataatatgacattatctaatatagaaagttataaaaataac tttggctcagttgacgtaaataaagaaatagtggatgttaaaaaatatatcgaaatgttgaaaataaaagtttca cattttgacttagcagtaaaaaatttaagcggtggaaatcaacagaaagtggttttggctaaaaatttattaaga aatcctaaaatattgatattagatgaacctactcgtggaattgatgtcggtgcaaaatatgagatatataaattaa tttatgaattggttaaaagcggtatttcaataataatggtatcatcagaactgccagaaataataggattaagtga tagaattgtcgtaatgcatgaaggtaaaaagaagggtgaatttgtcaataaagatgtcacteaagaaatgata atgcaatgtgcgataggaggtaaataa Thermoanaerobacterium atggtgaattcgaaaggttttaaagaaaataatgtatcgataaataaaaaattttcatttaatttaaaattatatacg thermosaccharolyticum atgataatagcattagtcggtatttggattatttttgcaattgctacaaaaggtgactttttaacttctagaaatatgt caaatctttttaggcaaatggtttctacggcggttttagccatagggatggtttttgtaataatagctggtcagatt gatctttcagttggatcgcttttaaggtctgactggtggtatagctgcaattgctaatgtctggtttcatattaatggc atcctttcaataattattgcgttagcgattggtttgattttaggaacgtggaatggctggtgggtagcttataaaa atgttccatcgtttattgtaacgttagcaggcatgctggtatttagaggaatattgattggtataactaatggttat actatagcaccattgagtagtgatttcagtttataggtcaagcttatttaactccagtaagtgggctatttactcgg tataattgtattactagtaggagcctatactatatattcacaaaggaaatcaaaaattaagtatgggttagaagttt caccttttatttagatattgctaaaataatacttatgattgtattgattggactatttgtattcacgctaaattcctata atggaattcctttttcagtattaattttggcgattttagttgcaatatttacttatattgcatcaaagacagtttttggg agaagagtttatgcattaggtggtaatatcgaggctgcaaaattatcaggtatcaatgttaagaagataacactt attttatttgcaattaatggattgcttgcagcagtatcaggcgttgttcttacatcaactttaaatgctggatcaaca tctgcaggtcagaatgcggagatggatgcaatcgcgtcttgtgtaattggtggagcaagccttatgggaggc gttggatcagttattggtgctataataggcgcattagttatggcaagtatcaacaatggaatgagcttacttaatt ccgcaccattttggcaatatgttgttaagggattgatattactattagctgtttatgtagatgtagcctcgaaaaat aaagaataa Thermoanaerobacter atggtaaagtctaaaaaattgttggcatttttcttggttatgatattgacattgtctgttgtattagcaggatgtacta mathranii gttcaaagacaaatgagacgacaaacactacttcaagtaatggttcaagtagcacagaaactaaaaaaataa aaatcggtttttctcttccaacaatgagagaagaaaggtatcaaagagatagagatgcatttgttgaagaagc agaaaaacttggageagaagttttagtacaaggtgcaaataacgatgaaaaccttcagaatagccaagtaga aaaccttatcacccaaggaatagacgtattagttcttgatccacaaaatgctgcttctgcagctaccttggttga aaaagctcatcaagcggggattaaggttatctcttatgacagacttatattaaattctgaaccagacgtgtatat ctcttttgataatgaaagagtaggagttacagggagaattcctcacaaagttggtaccaaagggaacttatt tcatatttgctggctecaactgacaacaatgctacattgttcaaaaaaggagcaatgaaatatattcaacctc ttgttgacaaaggagatataaaaatagcttttgaccaggcaataaaagactgggacccaaatgaggctttaaa acttgctgaaaacgctcttactgctaacaaaaacaaagtggatgctattcttgcacctaacgatggcactgca ggtggtataatacaggccttagcagaacaaaaattggctggtaaagtgccaattacaggtcaagatgcagaa cttgcagcagtgaagaggattggaaggcacacaatcaatgacagtgttcaaagatgtaagagttcttgcta gaaaggctgctcaaattgctgtaatgttagctcaagggaaagaagtaaaagatataccggaaattaataaga ctgtaaacaatcaaaagatagatgttccatcattgttgttgacaccagttgttataacaaaggacaacattgata aagagcttattgacagtggttggtttacaagggaacaagtgtacggtaagtaa Thermoanaerobacter atgagcgagtatattcttgaaatgagaaacataacaaaggaatttcctggagttaaagcattggataatgtaaa ethanolicus tttcaaagttaaaagaggggaaattcacgcgttagtaggagaaaatggagcgggaaagtctaccttgatgaa gatattaagtggtgtttatccttatggaacttataaaggagacataatcatagatggtgaagtgaagcaatttcg aaatattaaagatagtgaaaaaagtggtatagcgattatttatcaggagctcactctggtaaagtatatgacagt aggcgaaaacatatttttaggtgaagagcctgtaaaaggcggaataattgattggatgaaagtttactctgag acttatagacttttgaaagagttgcagattaatgtaaacccctatacaaaagttatgaatttaggaattgggcatc aacaaatggtagaaatagcgaaggctctttcaaaaaaagcgaggattttaatattagatgagcctacttctgca ttgacagaaagcgaaacagaacatcttctcaatattttgaaagatttgaagaaaaatggtgtaacttgtatatac atttctcacaagcttaatgaagtatttgaaattgcagattcaatcactgtattaagagatggcaaaacgataatg acggacaaaaaagaaaatttcacagaaaacaaggtaatttctttaatggtagggcgtgagcttacacagaga ttcccaagagctaagcatacgccaggggaagtggttttcgaggttaaaaattacacagtttatgaccatgaaa taccgggcaagaaaattattgacaatgtaagctttaaagccaggagaggcgagatattaggtattgcaggac ttatgggagcagggaggacagaacttgctgctagtatatttggtgcatttaaaggtagaaaagaaggggaaa tatatttaaatggcaaaaaaattgaaataaacactcccagcgatgcgataaaacatggaattgcctatctttcag aggataggaaaaggtttggccttgtgactttgatggatgtacaagaaaatatagcacttcctaactatgacaga ctatcaaaatttagtattataaataacaatgcaaaaattaaacatgcagaaaagtatgtaaaagagttaaaaata aaaacaccaaccataagacaaagggttgctaatttaagtggaggaaaccagcaaaaagtggttattgcaaa gtggcttatgtcagacccaaaagttttgatactggacgaaccaactagaggaatagatgtgggagctaagttt gaaatatataatctaatgaataaattggttgatatgggcgtgtgtgtaataatgatatcttcagaactgcctgaaa tattgggaatgagtgatagaatactggtaattcatgaaggaaaaatcaatggagaatttccaatagaagaagc agaccaagaaaaaatcatgtactgtgcaactggaggtaaa Thermoanaerobacter atgatggaaagcaaagtgagcaaaacaactgaaaagcgcattttaaatcatttcaagatagatataaggtcat ethanolicus atactatgatattagctttattggggatatggattatttatcaatattgacccatggcgattttctatctccgagaaa cttgtccatgcttgccaggcaaatgtctataacagcaattttagcttcaggtatggttttagttatagttgctgggc atatagacttatctgttggttctgtggcagggtttacaggagctatagctgcaattcttcaggtgatatatcattg ggatacagtgccgacaataatagtgactcttatggctgggcttgctattggagtttggcaaggattttggatag cctatagaaaagtgcctgcttttatagtgaccttaagctcaatgcttgtttttagaggtggaattttattaattacaa aaggtgttactatatctcctttaaaacaggacttcacagtcgtaggacagggatatattcctccattgtttagcgt tattcttgctgtggtggcaggtgttttgtatgtaatcatggaccttaagaatagaaattctcgaattaaatacggct taagtgtgtccagctggggaatagaactggcaaaaattgcaggagtattgattttcatcgctttgtttacaagtg ttatgatatcttatgaaggaattcctgtgccagtattacttgttttggtaattgtgattttgcttacttttgtggctcaa aatacgacttttggacgttatgtttatgcgataggcggaaataaagaagcagcagcttactcaggaataaaca tagctaagacgaacatgacgattttcttgattatgggggttttatcggcaattgcaggtatagttttgacttcaag gttaaatgctgctacaactagtgcaggaaatttgtttgagctggatgctatagcttcggcaattatcggtggaac aagcacgttaggaggagaaggaacagtaccaggagcgattttaggtgctcttattatggctagcatagataat ggcatgagtcttatgaatatagattattctatattgacaattgtaaagggccttgtattagtacttgcagtgtgggt ggatatttcaacaaagaagaggggataa Clostridium atgaaaataaaaatagtaactctgtaatatatatttcgctgcacttagtgggcttttgtttggttatgatactgga beijerinckii gttatttcaggagctattttatttattcaagaacaaatgcaccttgattcatggcagcaaggatgggItgtaagtt ctgtattattaggagctattcttggggctgcaatcattggtcctatgtctgataaatatggccgtataaagctaatt cttacatcggctgttatcttctttgtcggcgcacttggatcagcatttgctccagaaatttggtcattaattatattta gaatcattcttggtgtcgcagttggtgcatcttcagctctaattccaacttatttagctgaattatcaccatctgaa aaacgtggaaccatatcaagtttgtttcagctaatggttatgagcggaattctattggcttatattacgaattatgc attttcagatttatatactggttggcgagtgatgttagggttcgcagctattccagcagcagttcttttaataggtg cacttgtgttaccagaaagtcctagatttttagtaaaagatggacgagcagatgaagcaagaagtatactaga acatatgaataaacatgataaaggtgctgttaattatgaattagctcaaataaaaaaacaagccgagattaaaa gtggtggagttaaagagctatttagcgaatttgtacgcccggcattagtcataggctttggtttggctgtttttca gcagattatgggttgtaacacagttctttattatgcaccaactatatttactgatgttggatttggggtgcaagca gctttactcgctcatattggaattggagtttttaatataataattactgctatagctgtagctattatggataaaattg atcgtaaaaagatgcttatttatggtgctattggaatgggcgtttcgctcttgattatgagtatttcaatgaaattct ctaatggatctttcgttgcctcaatcatatgtgttattgcattaactatttacattgctttcttttcagctacttgggga cctgtaatgtgggtcatggtaggagaagtatttccattaaatattcgcggcttaggtaattcattcagtagtgtaa ttaattggagtgctaatatgatggtatcattgacatttccagtattattgaattactttggtacaggtagtttgtttata ggttatggtgtaatatgttttgcagcaatttggtttgttcagtctaaggtatttgaaacacgtaatcgttcacttgaa gatatagaagctgaacttagatcatataaaggagtagaaaaactccaaaaggatatctgcactcaagatgcta caactaaggcttag Clostridium ttataattttattgattggtcagggatttcctctactaactcaaccaaacaattttctttatcatttttatgtcttatat carboxidivorans ctagttcagccattatatcagctactctttcttctgttaaattatagaatatcatgaatatgagcaatgtaactacaca gacaacagctggcaaaatagatgtcataattaaaattccattcaacgattttgcagtttgagttacattaggaat atatccaacattagctaatatcaatgtaggtataactccccctactgctaatgaaacctttaatccaagagtaata agtgagtacacaactgcggcatgtcttttgccagtattgtactcagcatactcaactgcatccggaatgattga ccacaaactgcccataagtatgccatagccaaatgcagctactgatttagctatcatcattacttgaatttgtga aactggaatgatatataaagctgctgatccaagggcacctaaactcaaaccaagtacaacagtttttttctttttg atatgtctaaaaagcgcaggcacaaaaggaactgccacgactgaaggtaaaacgttcaacatagaaaataa agcaactaaatcttttctatttacgttataagtcatataataaattcctgaagctgattgtatagatgaaaatgcata aacacctacaaacagtaaaaataatatgacacctggctgattatgtgtaatctgattaataaaccctttgaaagt aactggatctaaatgagattttactctgatacgttcatgcaaagtagtataactataaagcaatatggatgcaca aataacagaaagtaaaataatagtcatctgataaccttttgctgaatcacctctgccgaaaacctgtgataaaat aggaataaatagagcaactattacaccacctgactgagcaaacatcattcttatggaatttagcctagttctctc cataggatctgctgtcatgacagttgtacaagatacatatggattaatgatgaaagtatataatgtaagtagtaa attgtacgtagcatatgcccatatcaatttgcccgtatgtcccaaattgggtactgtaaaagtcaaaatacctgc aagtgcaaaaggaacagctccataaataagataacttttgtacttaccatgctttggattcattctctctgcaata atacccatggtagggtcccatatcatatcccatcctctagatataagaaacataacagaaacttctgcagcagt taatccataaacatcagtataataaaatgtcaaaaacattaaaattgactgaaaaactaaattcattccaccatct acaagggaatatcccactacttctttggtaggaagtttataaaagccaggattatcaccacttttttcatacaaat ttattgtttttgcctccat Clostridium atgaataaaaaaatatctccagcactaatttatttctttggagccttcggtggatttatgtttggatatgatattgga acetobutylicum ataattaatggtgctttacctggaattaatgcaacttggcacgtaagttcttggttagaaggatttatcacttctgg attgtttgttggagctatgataggagcctcattaatggcttcactagcagataggtttggtcgtcgtagaatgatt atgtggagtgcaattgtgtttgcacttggtgcattaggttctgccgtttctactagtactaatcttttaatcggtgct cgtgttattttaggagtagctgtaggtggagcttctgctttagttccaatgtatatgggagaaattagccctgctg aaacacgtggaaaactatctggtttaaatcaattaatgataactgttggaatgcttttctcatatggtgtaaattttg cgtttgctggtgcatttgaaggatggcgttggatgcttggaggagctatggtacctgcaatggtactattaattg gaacatttatacttccagagtcaccaagatttttagctagaataggaaagacagaattagcaaaacaagtactt cagactttacgttcaaaggaagaggcagaaactgaatatcaagagattattaattcaaaacatactgaaacag gttcttttggagatttatttgcaaaacaggctttgccagctgtaattgcaggctgtgggttaacacttcttcaaca aattcaaggtgcaaacactattttctactattcatcacaaattttatccaatgtttttggatcagcaaatggtggaa ctattagtactgttggaattggtgtggttctagtattagcaactattgtaactttattggttgtagacaattcaaac gtcgtacattatttatgactggttctattggaatgggcgcatctctattattagttggattaatttatccatactctga agctaaacatgcgtgggcaacttggttagtattcttcttcatatgtttatacgttgttttctatgcatactcttgggc agctactacatggattgttgttggagaattattcccaagtaatgttagaggacttgcaacaggtattgcatcagc agtaaactggtttggtaacattttagttgctttattcttcccagtattacttgaaactgtaggtttatctgtaatcctct tcggttttgctgcaatttgtatcataggatttttatttgcaaaatatgttctttatgaaacaaaaggaaaatctttaga agaaattgagacatatttgtacaatcgttctattggaaaagttagaggattaaatgagtag Clostridium atgataggaagttttaaaattaaaatgagggaaaaaataggctatgcatctggagatttagcaagtaacttgat acetobutylicum atatcaaaccatttcaatttatttgctatttttctatactaacgttttcggcttatctgctggtcaggccggtgtaatgt ttcttgtggtaagatttatcgacgcaattaatgacccaattattggaactttagtcgacaaaaccaatacgcgtttt ggaagatttagaccatacttattatatggagctgctccttttgcagttttagcttttctgtgttttaccactcctaattt ttcagcaacaggtaaattaatttacgcttatgttacttacgtaggcctttcaattacttatacttgtataaatgttcctt atggtgcattgacatcagctattacagatgataatcaggaaattgttagcttgacctcagtaagaatgttttttgct aatctaggcggtgtaatcgtttcctactttgttcctgtactttcggcatatttcacaaaatcatttggtctttcaggtg gttggcaaataactatgagtattctaggtatagcaggtgccttcctattgctattttgtttttcaagtactaaggaa agagtaaaaagcgttaaccaagatcataagattaaattctctgatetctttgaacaattcaaaactaatagacct cttattgtattaagtattttctagtactgatatttggaataaattcaattaatagttcaataggcatatattacattacc tataacgttggtcgtgctgacttagtacaatggtatacggtattagggtctctccctgcatttgtttgtataccact aataccaaaaatcaacagaaaaattggaaaaaagcctttattaattagttctcttttaataacagtgcttggtacc ttatctctgttagtaattccaactcatgcagtagcattaatattagtttctcgtgtgattacatcaataggttcattga ctgccggagcatttatgtggtcattaattccagaaacaattgaatatggtgaatacacaacaggaaaacgttta agcggcttaatttatgctattatcggattctttttcaagtgcggaatggcattaggcggagctgtaccaggaata atactcggtaactttgggtatgtagccaataaaacccaaactcctcatgccctaacgggtatacttctaactgc cacagtcgttcctgccgtactcatgatattagctttaatagatattaccttctacaacttagatgataaaaaatata atcatattatagctactttaaaagaaagagctaaattaaatagaggggagaatttaaatttatga Thermoanaerobacterium atgaaaaattttgaaacaacttggaaagaaaggatcagttatgggcttagacactgcttctaatttagtttatc thermosaccharolyticum agatgattaccacttatttaatgtttttttacactgatgtttttggaataagtgctgcagctgtcggaacacttttttta gtagcaaggatcatcgacgcatttgatggaccattttttggcattctaatagatcatacaaatacaaagtgggg aaaatgcagaccatactttctttggttatcaattccatatggagtattagcaatactagcatttacgactccaagtt ttaatgcttctggtaaattaatttatgcttatgttacatatattcttttaggaattatctactctggaattaatatacca attacatcaattttaccgagtttaacagataatttagaagaaagaaatatattggttagtaccagaatgattttagct acagttggtgctacgattgtcagtgtaggaacgttgcctctagttaaagtattcggcaatggtaatcagcaaaa aggctttatgatgactatgactttgtttgctgtgttagctgttatattattcctagtaacctttttcaatactagagaa aaagtaaacgaagcaaaagatcaatcaattactttaaaagaagaactaaaagcattgaaaggaaatactcctt ggtttatacttttctttgtagcttttataaatttcatagcttttataatgaaagctcaaacgacagtttattatttgaca tataatttaaagatgcctaacttaatcagtatagctttaggattaggctcactgaatgttgtttcattacttatcatgc catttttagcaaagaaaataggaaaaagaaatgtcatgattacgggatttactttttcaatattagcacaatttata ttgtatttatcatcattgacatcaagtgcatttatatttttagtaggcactgtaattgcagcttttggaaatggatttgt tatgggagcaatgttttctatgacagcagatacagttgactacggtgagtggaaatcgggtgttagagctcaa ggacttctttcagctacaccagcttttggggtcaaagcaggaatgggaataggtggggctttagcaggttgg atattatcaattggtaaatatgttccagatcatccgcaaaccttatccgcattaaaagcgatagaaattaactttat ttggctaccgttaattggttttattatcagtgctgtattacttctattctataatttagataaacaacaagaacagatg actaaagaattaaatgaaagaagagctaagttaagcgcatga Thermodesulfobium atggttgagaaaaatttagacgaactaaaactaagcaagcaccacttaaaagcgatgtttgtttcaggaatgg narugense ggttttttactgatgcatatgatctcttcattattggtgtagctttatctttaattgctccggtgtggggacttacaag ttcagaaattgcactccttggtagtagttctctttggctgctttgtttggttcgattttttttggtagatttgcagata attttggtagaaagaagatttatggtttagaagctctgataatgacaattggcgctttaatgtcagcattttcgcc aaaattttgtttcttctcttctcaagattcattttgggtttaggcattggtggagattatcctgttagtgctgttattat gagtgaatattcaaatagatctgatcgagggaaattggttgggttagttttttctatgcaagcacttggtcttataa ttggtcctcttgttgccttaagcttattattgttacacattccacttgactttgcatggcgtttaatgcttgggttagg agcgcttccttcvacttatggttatttatttaaggagaaaattaccagaatctcctcgctatctttcacaaatagttg gcgataaaaaagcagctttaactgcttttgtaaattttactggtaatggtaataagagctatgaaccgatacattt aaatccgaaaattaatcataggttaaaagattttttttcaaacaaacaacatactttgactttatttgggacagctg gtagctggttttgcttgattgggcttattatggtaacacaatttctactccaattgtaatgaatgcaatttgtgata gttcttcttagaactgaagatgatttattctcttgtaatatttgttgttttcgctttaccaggatatattttatcaataa tatttatggatataattggaagaaaatatattcagcttatgggtttggcattatggcattttcatttttattattaggat taatacctgatatagaaagtaatgttacaggatttcttatactttatgggcttagctatctttttactgagtttggacc taatactaccactttgtccttccctcagagcttttcccaaccgaatataggacaacaggtcatggcttgtctgca ggaattgggaaacttggagcctttttggagtgttatttttccctattaccgagtctttttgggactaaatatgaca tttgttattgtttcgattatatgttttatgggaattataaccacgtctgttctgactgaaccaagggaaagagcct cgaagactgttcgtattctaaaatagtaggcaaataa
(105) TABLE-US-00005 TABLE5 Proteinsequencesofxylosetransportersexpressedin Thermoanaerobacteriumsaccharolyticum Organism Sequence Thermoanaerobacterium mgknakkallsvililsmlftfsacattnpnqsksnnqttntsdnsgkikigfsfdtlnlerwqhdrdyf thermosaccharolyticum vqrakelgadvlvqsansdsqtqysqcqnliaqgikvlviiphdgsaiapiveeahkagvkvlaydrlim nadvdayvsfdnekvgelqaeaitklvpkgnyfllegsptdnnaklfeqgqkkvlqplvdkgdikivge qwaqdwltqnaynimqnaltannnkidavvdandstalgairalqeqnlagkvaisgqdadlancqliv egkqsmtvykpvkeeatkgadvavalakgedinangkvnngkidvpsvlltpvavdknnmvdtiik dgfhsldevyknvpkdqwpkq Thermoanaerobacterium mdmgdfilemknitkdfsgvkaldnvnlkvkkgeihglcgengagkstlmkilsgvypygtfsgeiif thermosaccharolyticum dgkelklnnikdaedagigiiyqelslvkelsvsenifignepnkngiidfdrmyyetkilldklnlninpn vpvknlgigqqqlveiakalsknvsllildeptssltdadveilfnilrqlkdngvtciyishklnevmeitdr itvqrdgktigsedtknlteseiikmmvgreltnlfpkeehqigkeilevknfsvydskssskkivdnvsft lkegeilgiagligagrtelvssifgsypgrhegeiylegkkinirnpdealdygiamvpedrkgqglinils vrdnmtlsniesyknnfgsvdvnkeivdvkkyiemlkikvshfdlavknlsggnqqkvvlaknllrnp kilildeptrgidvgakyeiykliyelvksgisiimvsselpeiiglsdrivvmhegkkkgefvnkdvtqe mimqcaiggk Thermoanaerobacterium mvnskgfkennvsinkkfsfnlklytmiialvgiwiifaiatkgdfltsrnmsnlfrqmvstavlaigmv thermosaccharolyticum fviiagqidlsvgsllgltggiaaianvwfhingilsiiialaiglilgtwngwwvayknvpsfivtlagmlv frgiligitngytiaplssdfqfigqayltpvsgyllgiivllvgaytiysqrkskikyglevspfyldiakiilm ivliglfvftlnsyngipfsvlilailvaiftyiasktvfgrrvyalggnieaaklsginvkkitlilfaingllaav sgvvltstlnagstsagqnaemdaiascviggaslmggvgsvigaiigalvmasinngmsllnsapfwq yvvkglilllavyvdvasknke Thermoanaerobacter mvkskkllafflvmiltlsvvlagctssktnettnttssngssstetkkikigfslptmreeryqrdrdafvee mathranii aeklgaevlvqganndenlqnsqvenlitqgidvlvldpqnaasaatlvekahqagikvisydrlilnsep dvyisfdnervgelqgefltklvpkgtyfifagaptdnnatlfkkgamkyiqplvdkgdikiafdqaikd wdpnealklaenaltanknkvdailapndgtaggiiqalaeqklagkvpitgqdaelaavkrivegtqsm tvfkdvrvlarkaaqiavmlaqgkevkdipeinktvnnqkidvpsllltpvvitkdnidkelidsgwftre qvygk Thermoanaerobacter mseyilemrnitkefpgvkaldnvnfkvkrgeihalvgengagkstlmkilsgvypygtykgdiiidge ethanolicus vkqfrnikdseksgiaiiyqeltlvkymtvgeniflgeepvkggiidwmkvysetyrllkelqinvnpyt kvmnlgighqqmveiakalskkarilildeptsaltesetehllnilkdlkkngvtciyishklnevfeiads itvlrdgktimtdkkenftenkvislmvgreltqrfprakhtpgevvfevknytvydheipgkkiidnvsf karrgeilgiaglmgagrtelaasifgafkgrkegeiylngkkieintpsdaikhgiaylsedrkrfglvtlm dvqenialpnydrlskfsiinnnakikhaekyvkelkiktptirqrvanlsggnqqkvviakwlmsdpk vlildeptrgidvgakfeiynlmnklvdmgvcvimisselpeilgmsdrilvihegkingefpieeadqe kimycatggk Thermoanaerobacter mmeskvskttekrilnhfkidirsytmilallgiwiifsilthgdflsprnlsmlarqmsitailasgmvlvi ethanolicus vaghidlsvgsvagftgaiaailqviyhwdtvptiivtlmaglaigvwqgfwiayrkvpafivtlssmlvf rggillitkgvtisplkqdftvvgqgyipplfsvilavvagvlyvimdlknrnsrikyglsvsswgielakia gvlifialftsvmisyegipvpvllvlvivilltfvaqnttfgryvyaiggnkeaaaysginiaktnmtiflim gvlsaiagivltsrlnaattsagnlfeldaiasaiiggtstlggegtvpgailgalimasidngmslmnidysil tivkglvlvlavwvdistkkrg Clostridium mkikisnsviyifaalsgllfgydtgvisgailfiqeqmhldswqqgwvvssvllgailgaaiigpmsdk beijerinckii ygrikliltsaviffvgalgsafapeiwsliifriilgvavgassaliptylaelspsekrgtisslfqlmvmsgil layitnyafsdlytgwrvmlgfaaipaavlligalvlpesprflvkdgradearsilehmnkhdkgavnye laqikkqaeiksggvkelfsefvrpalvigfglavfqqimgcntvlyyaptiftdvgfgvqaallahigigv fniiitaiavaimdkidrkkmliygaigmgvsllimsismkfsngsfvasiicvialtiyiaffsatwgpv mwvmvgevfplnirglgnsfssvinwsanmmvsltfpvllnyfgtgslfigygvicfaaiwfvqskvf etrnrsledieaelrsykgveklqkdictqdattka Clostridium meaktinlyeksgdnpgfyklptkevvgyslvdggmnlvfqsilmfltfyytdvygltaaevsvmflis carboxidivorans rgwdmiwdptmgiiaermnpkhgkyksyliygavpfalagiltftvpnlghtgkliwayatynllltlyt fiinpyvscttvmtadpmetrlnsirmmfaqsggvivalfipilsqvfgrgdsakgyqmtiillsvicasil lysyttlherirvkshldpvtfkgfinqithnqpgvilfllfvgvyafssiqsasgiyymtynvnrkdlvalfs mlnvlpsvvavpfvpalfrhikkkktvvlglslgalgsaalyiipvsqitvmmiaksvaafgygilmgsl wsiipdaveyaeyntgkrhaavvyslitlglkvslavggviptlilanvgyipnvtqtakslngilimtsilp avvevvtllifmifynlteervadimaeldirhkndkenclvelveeipdqsikl Clostridium mnkkispaliyffgafggfmfgydigiingalpginatwhvsswlegfitsglfvgamigaslmasladr acetobutylicum fgrrrmimwsaivfalgalgsavststnlligarvilgvavggasalvpmymgeispaetrgklsglnql mitvgmlfsygvnfafagafegwrwmlggamvpamvlligtfilpesprflarigktelakqvlqtlrsk eeaeteyqeiinskhtetgsfgdlfakqalpaviagcgltllqqiqgantifyyssqilsnvfgsanggtistv gigvvlvlativtllvvdkfkrrtlfmtgsigmgaslllvgliypyseakhawatwlvffficlyvvfyays waattwivvgelfpsnvrglatgiasavnwfgnilvalffpvlletvglsviffgfaaiciigf lfakyvlyetkgksleeietylynrsigkvrglne Clostridium migsfkikmrekigyasgdlasnliyqtisiyllffytnvfglsagqagvmflvvrfidaindpiigtlvdkt acetobutylicum ntrfgrfrpyllygaapfavlaflcfttpnfsatgkliyayvtyvglsitytcinvpygaltsaitddnqeivslt svrmffanlggvivsyfvpvlsayftksfglsggwqitmsilgiagaflllfcfsstkervksvnqdhkikfs dlfeqfktnrplivlsiffvlifginsinssigiyyitynvgradlvqwytvlgslpafvciplipkinrkigkk pllissllitvlgtlsllvipthavalilvsrvitsigsltagafmwslipetieygeyttgkrlsgliyaiigfffkc gmalggavpgiilgnfgyvanktqtphalgilltatvvpavlmilaliditfynlddkkynhiiatlkerak lnrgenlnl Thermoanaerobacterium mknfettwkerisyglsdtasnlvyqmittylmffytdvfgisaaavgtlflvariidafdgpffgilidhtn thermosaccharolyticum tkwgkerpyflwlsipygvlailafttpsfnasgkliyayvtyillgiiysginipitsilpsltdnleernilvst rmilatvgativsvgtlplvkvfgngnqqkgfmmtmtlfavlavilflvtffntrekvneakdqsitlkeel kalkgntpwfilffvafinfiafimkaqttvyyltynlkmpnlisialglgslnvvsllimpflakkigkrnv mitgftfsilaqfilylssltssafiflvgtviaafgngfvmgamfsmtadtvdygewksgvraqgllsatpa fgvkagmgiggalagwilsigkyvpdhpqtlsalkaieinfiwlpligfiisavlllfynldkqqeqmtkel nerraklsa Thermodesulfobium mveknldelklskhhlkamfvsgmgfftdaydlfiigvalsliapvwgltsseiallgsssllaalfgsiffg narugense rfadnfgrkkiyglealimtigalmsafspnflfllfsrfilglgiggdypvsavimseysnrsdrgklvglv fsmqalgliigplvalslllhipldfawrlmlglgalpslmviylrrklpesprylsqivgdkkaaltafvnft gngnksyepihlnpkinhrlkdffsnkqhtltlfgtagswflldwayygntistpivmnaicdssslelkm iyslvifvvfalpgyilsiifmdiigrkyiqlmgfgimafsflllglipdiesnvtgflilyglsylftefgpnttt fvlpselfpteyrttghglsagigklgaffgvlffpitesflglnmtfvivsiicfmgiittsvltepkgksledc syskivgk
(106) In certain embodiments of the invention, the xylose metabolizing enzyme can be a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, a transketolase, and a transaldolase paralog or ortholog. In one particular embodiment, the xylose metabolizing enzyme comprises an amino acid sequence selected from SEQ ID NOs: 3-4. In certain other embodiments, the xylose metabolizing enzyme comprises an amino acid sequence that is at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 3-4. In another embodiment, the source organism for the xylose isomerase includes, but is not limited to, Ciona intestinalis, Thermus thermophilus, Escherichia coli K-12, Cereus pterogonus, Streptonyces corchorusii, Thermus caldophilus, Arthrobacter nicotinae, Pectobacterium atrosepticum, Bacillus licheniformis, Thermoanaerobacterium thermosulurigenes, Thermotoga naepolitana, Lactococcus lactis, Actinoplanes nmissouriensis, Thermoanaerobacterium saccharolvticum, Hordeum vulgare, Bifidobacterium adloescentis, Bacillus sp., Thermus aquaticus, Streptomyces violaceoruber, Geobacillus stearothermophilus, Streptomyces olivochromogenes, Streptomyces albus, and Caldicellulosiruptor sp.
(107) In another embodiment, the source organism for the xylulokinase includes, but is not limited to Pinchia angusta, Arabidopsis thaliana, Geobacillus caldoxylosilyticus, Scheffersomyces stiptis, Lactobacillus pentosus, and Caldicellulosiruptor sp.
(108) As a practical matter, whether any polypeptide is at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to a polypeptide of the present invention can be determined conventionally using known computer programs. Methods for determining percent identity, as discussed in more detail below in relation to polynucleotide identity, are also relevant for evaluating polypeptide sequence identity.
(109) In some particular embodiments of the invention, amino acid and nucleic acid sequences are readily determined for a gene, protein or other element by a accession number upon consulting the proper database, for example Genebank. However, sequences for the genes and proteins of the present invention are also disclosed herein (SEQ ID NOs: 1-4). See Table 6 and Table 7 below.
(110) TABLE-US-00006 TABLE6 DNAsequenceofxyloseisomeraseandxylulokinaseof Thermoanaerobacteriumsaccharolyticum Gene DNAsequence Xyloseisomerase atgaataaatatttgagaacgtatctaaaataaaatatgaaggaccaaaatcaaacaatccttattcttttaa attttacaatccagaagaagtaatcgatggcaagacgatggaggagcatctacgcttttctatagcttactg gcacacttttactgctgatggaacagatcaatttggcaaagctaccatgcaaagaccatggaaccactac acagatcctatggacatagcaaaggcaagggtagaagcagcatttgagtttttgataagataaatgcacc tttcttctgcttccatgacagggatattgcacctgaaggagacactcttagagagacaaacaaaaacttag atacaatagttgccatgataaaggattacttgaagaccagcaagacgaaagttttgtggggcaccgcaaa tctttctccaatccgagatttgtacatggtgcatcaacatcctgcaatgctgatgttttcgcatattctgcagc tcaagttaaaaaagctcttgagattactaaggagcttggcggcgaaaactacgtattctggggtggcaga gaaggatatgaaacacttctcaatacagacatggagtttgagcttgacaactttgcaagatttttgcacatg gctgttgactacgcgaaggaaatcggctttgaaggccagttcttgattgagccgaagccaaaggagcct acgaaacaccaatacgactttgacgtggcaaatgtattggcattcttgagaaaatacggccttgacaaata tttcaaagtgaatatcgaggcaaaccatgcgacattggcattccacgacttccaacatgagctaagatacg ccagaataaacggtgtattaggatcaattgacgcaaatacaggcgatatgcttttaggatgggatacaga ccagttccctacagatatacgcatgacaacgcttgctatgtatgaagtcataaagatgggtggatttgaca aaggcggccttaacttcgatgcaaaagtaagacgtgcttcatttgaaccagaagatcttttcttaggtcatat agccggaatggatgcctttgcaaaaggcttcaaagttgcttacaaacttgtgaaagatggcgtatttgaca agttcatcgaggaaagatacgcaagctacaaagacggcattggcgctgacattgtaagcgggaaagct gacttcaagagccttgaaaagtacgcattagagcacagccagattgtcaacaaatcaggcaggcaaga gctgttagaatcaatcctaaatcagtatttgtttgcagaataatga Xylulokinase atgtattttttagggatagatttagggacatcatcagttaagataatactgatgaatgaaagcggcaatgtgg tatcaagcgtttcaaaagaatatcctgtgtactatccagagccaggctgggctgagcaaaatccagaaga ttggtggaatggcacaagggatggaataagagagattattgcgaaaagcggcgtaaatggcgatgaaat aaagggtgttggcttaagcgggcagatgcatggactggtgcttttagacaaagacaataacgttttaacg ccagccatactttggtgtgaccagaggacacaggaagaatgcgactacatcacagagaaaataggaaa agaaggccttttgaagtacacagggaataaagcattgacaggttttactgcaccaaagatattatgggtaa agaagcaccttaaagacgtatatgaaagaatcgctcatatccttttgccaaaagattatataaggtttaaatt gacaggtgagtacgctacagaagtttcagatgcatcaggtacacttcttttcgatgtggaaaatagaagat ggtcaaaggaaatgatagacatatttgaaataccggaaaaagcccttcctaagtgctacgaatcaacaga tgtcacagggtatgtcaccaaagaggcagcagatttgacagggcttcatgaagggactattgtcgtaggc ggtggtggtgaccaagccagcggcgctgtaggcactggcacggtgaaaagcggcatagtgtccatcg cattaggaacttcaggcgtcgtatttgcatcacaggacaagtacgcagcagatgatgagcttaggcttca ctcattctgccatgcaaacggcaaatggcatgtgatgggtgtcatgctttcggctgcatcatgtcttaaatg gtgggtagatgatgtaaataattacaagaccgatgttatgacatttgatggactcttagaagaagcagaga aggtgaagccaggcagtgatggattgatattcttgccatacctgatgggtgaaaggaccccttacagcga tccttatgcgagaggcagctttgtaggtttaacaattacacacaatagaagccacatgacaagatctatatt agaaggcgtcgcatttggacttagggattcgctggagcttataaaggctttaaatatacctgtaaatgaag ccagggtaagtggtggtggtgctaaaagcaggctttggaggcaaatacttgccgatgtattcaatgtaag gatagacatgataaatgctacagaaggaccttcatttggtgcagcaataatggcgtctgtgggatatggcc tttacaaaaatgtagatgatgcatgcaatagtttaataaaagttacagacagcgtatatccaatcaaagaaa acgtcgaaaagtacaacaaactgtatccaatctacgtgagcttgtattcaaggcttaaaggcgcctttgaa gaaattgggaagttggatttgtaa
(111) TABLE-US-00007 TABLE7 Proteinsequenceofxyloseisomeraseandxylulokinaseof Thermoanaerobacteriumsaccharolyticum Gene Proteinsequence Xyloseisomerase mnkyfenvskikyegpksnnpysfkfynpecvidgktmeehlrfsiaywhtftadgtdqfgkatmqr pwnhytdpmdiakarveaafeffdkinapffefhdrdiapegdtlretnknldtivamikdylktsktk vlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelggenyvfwggregyetllntdmefe ldnfarflhmavdyakeigfegqfliepkpkeptkhqydfdvanvlaftrkygldkyfkvnieanhatl afhdfqhelryaringvlgsidantgdmllgwdtdqfptdirmttlamyevikmggfdkgglnfdakv rrasfepedlflghiagmdafakgfkvayklvkdgvfdkfieeryasykdgigadivsgkadfksleky alehsqivnksgrqellesilnqylfae Xylulokinase myflgidlgtssvkiilmnesgnvvssvskeypvyypepgwaeqnpedwwngtrdgireiiaksgv ngdeikgvglsgqmhglvlldkdnnvltpailwcdqrtqeecdyitekigkegllkytgnkaltgftapk ilwvkkhlkdvyeriahillpkdyirfkltgeyatevsdasgtllfdvenrrwskemidifeipekalpkc yestdvtgyvtkeaadltglhegtivvggggdqasgavgtgtvksgivsialgtsgvvfasqdkyaadd elrlhsfchangkwhvmgvmlsaasclkwwvddynnyktdvmtfdglleeaekvkpgsdgliflp ylmgertpysdpyargsfvgltithnrshmtrsilegvafglrdslelikalnipvnearvsgggaksrlwr qiladvfnvridminategpsfgaaimasvgyglyknvddacnslikvtdsvypikenvekynklypi yvslysrlkgafeeigkldl
(112) Some embodiments of the invention encompass a polypeptide comprising at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, or 500 or more consecutive amino acids of any of SEQ ID NOs: 3-4, or domains, fragments, variants, or derivatives.
(113) In certain aspects of the invention, the polypeptides and polynucleotides of the present invention are provided in an isolated form, e.g., purified to homogeneity.
(114) The present invention also encompasses polypeptides which comprise, or alternatively consist of, an amino acid sequence which is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%. 99% similar to the polypeptide of any of SEQ ID NOs: 3-4 and to portions of such polypeptide with such portion of the polypeptide generally containing at least 30 amino acids and more preferably at least 50 amino acids.
(115) As known in the art similarity between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide.
(116) The present invention further relates to a domain, fragment, variant, derivative, or analog of the polypeptide of any of SEQ ID NOs: 3-4.
(117) Fragments or portions of the polypeptides of the present invention can be employed for producing the corresponding full-length polypeptide by peptide synthesis. Therefore, the fragments can be employed as intermediates for producing the full-length polypeptides.
(118) Fragments of xylose metabolizing enzymes of the invention encompass domains, proteolytic fragments, deletion fragments and fragments of any of the genes which retain any specific biological activity of the xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase proteins. Polypeptide fragments further include any portion of the polypeptide which retains a catalytic activity of the xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase proteins.
(119) Fragments of xylanases of the invention encompass domains, proteolytic fragments, deletion fragments and fragments of any of the genes which retain any specific biological activity of xylanases. Polypeptide fragments further include any portion of the polypeptide which retains a catalytic activity of xylanases.
(120) The variant, derivative or analog of the polypeptide of xylose metabolizing enzymes or xylanases of the invention may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the mature polypeptide for purification of the polypeptide. Such variants, derivatives and analogs are deemed to be within the scope of those skilled in the art from the teachings herein.
(121) The polypeptides of the present invention further include variants of the polypeptides. A variant of the polypeptide can be a conservative variant, or an allelic variant. As used herein, a conservative variant refers to alterations in the amino acid sequence that do not adversely affect the biological functions of the protein. A substitution, insertion or deletion is said to adversely affect the protein when the altered sequence prevents or disrupts a biological function associated with the protein. For example, the overall charge, structure or hydrophobic-hydrophilic properties of the protein can be altered without adversely affecting a biological activity. Accordingly, the amino acid sequence can be altered, for example to render the peptide more hydrophobic or hydrophilic, without adversely affecting the biological activities of the protein.
(122) By an allelic variant is intended alternate forms of a gene occupying a given locus on a chromosome of an organism. Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced using art-known mutagenesis techniques. Allelic variants, though possessing a slightly different amino acid sequence than those recited above, will still have the same or similar biological functions associated with the xylose metabolizing enzymes of the invention. The allelic variants, the conservative substitution variants, and members of the xylose metabolizing enzymes can have an amino acid sequence having at least 75%, at least 80%, at least 90%, at least 95% amino acid sequence identity with the xylose metabolizing enzymes of the invention, and, particularly, with the amino acid sequence set forth in any one of SEQ ID NOs: 3-4. Identity or homology with respect to such sequences is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the known peptides, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. N-terminal, C-terminal or internal extensions, deletions, or insertions into the peptide sequence shall not be construed as affecting homology.
(123) Thus, in one aspect the proteins and peptides of the present invention include molecules comprising the amino acid sequence of SEQ ID NOs: 3-4 or fragments thereof having a consecutive sequence of at least about 3, 4, 5, 6, 10, 15, 20, 25, 30, 35 or more amino acid residues of the xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, or transaldolase polypeptide sequences; amino acid sequence variants of such sequences wherein at least one amino acid residue has been inserted N- or C-terminal to, or within, the disclosed sequence; amino acid sequence variants of the disclosed sequences, or their fragments as defined above, that have been substituted by another residue. Contemplated variants further include those containing predetermined mutations by, e.g., homologous recombination, site-directed or PCR mutagenesis, and the corresponding proteins of other animal species, including but not limited to bacterial, fungal, insect, rabbit, rat, porcine, bovine, ovine, equine and non-human primate species, the alleles or other naturally occurring variants of the family of proteins; and derivatives wherein the protein has been covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid (for example, a detectable moiety such as an enzyme or radioisotope).
(124) Using known methods of protein engineering and recombinant DNA technology, variants may be generated to improve or alter the characteristics of the polypeptides encoding the xylose metabolizing enzymes. For instance, one or more amino acids can be deleted from the N-terminus or C-terminus of the secreted protein without substantial loss of biological function.
(125) Thus, in another aspect the invention further includes xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase polypeptide variants which show substantial biological activity. Such variants include deletions, insertions, inversions, repeats, and substitutions selected according to general rules known in the art so as have little effect on activity.
(126) The skilled artisan is fully aware of amino acid substitutions that are either less likely or not likely to significantly effect protein function (e.g., replacing one aliphatic amino acid with a second aliphatic amino acid), as further described below.
(127) For example, guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie et al., Deciphering the Message in Protein Sequences: Tolerance to Amino Acid Substitutions, Science 247:1306-1310 (1990), wherein the authors indicate that there are two main strategies for studying the tolerance of an amino acid sequence to change.
(128) The first strategy exploits the tolerance of amino acid substitutions by natural selection during the process of evolution. By comparing amino acid sequences in different species, conserved amino acids can be identified. These conserved amino acids are likely important for protein function. In contrast, the amino acid positions where substitutions have been tolerated by natural selection indicates that these positions are not critical for protein function. Thus, positions tolerating amino acid substitution could be modified while still maintaining biological activity of the protein.
(129) The second strategy uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene to identify regions critical for protein function. For example, site directed mutagenesis or alanine-scanning mutagenesis (introduction of single alanine mutations at every residue in the molecule) can be used. (Cunningham and Wells, Science 244:1081-1085 (1989).) The resulting mutant molecules can then be tested for biological activity.
(130) As the authors state, these two strategies have revealed that proteins are often surprisingly tolerant of amino acid substitutions. The authors further indicate which amino acid changes are likely to be permissive at certain amino acid positions in the protein. For example, most buried (within the tertiary structure of the protein) amino acid residues require nonpolar side chains, whereas few features of surface side chains are generally conserved. Moreover, tolerated conservative amino acid substitutions involve replacement of the aliphatic or hydrophobic amino acids Ala. Val, Leu and lie; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gin, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Trp, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly.
(131) The terms derivative and analog refer to a polypeptide differing from the xylose metabolizing enzymes of the invention, but retaining essential properties thereof. Generally, derivatives and analogs are overall closely similar, and, in many regions, identical to the xylose metabolizing enzymes of the invention. The terms derivative and analog when referring to xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase polypeptides include any polypeptides which retain at least some of the activity of the corresponding native polypeptide, e.g., the xylose isomerase activity, or the activity of the its catalytic domain.
(132) Derivatives of the xylose metabolizing enzymes disclosed herein, are polypeptides which have been altered so as to exhibit features not found on the native polypeptide. Derivatives can be covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid (e.g., a detectable moiety such as an enzyme or radioisotope). Examples of derivatives include fusion proteins.
(133) An analog is another form of a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase polypeptide of the present invention. An analog also retains substantially the same biological function or activity as the polypeptide of interest, e.g., functions as a xylose isomerase. An analog includes a proprotein which can be activated by cleavage of the proprotein portion to produce an active mature polypeptide.
(134) The polypeptide of the present invention may be a recombinant polypeptide, a natural polypeptide or a synthetic polypeptide. In some particular embodiments, the polypeptide is a recombinant polypeptide.
(135) Also provided in the present invention are allelic variants, orthologs, and/or species homologs. Procedures known in the art can be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any of SEQ ID NOs: 1-2, or other xylose metabolizing enzymes using information from the sequences disclosed herein or the clones deposited with the ATCC. For example, allelic variants and/or species homologs may be isolated and identified by making suitable probes or primers from the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homolog.
(136) Combinations of Xylose Metabolizing Enzymes or Xylanases
(137) In some embodiments of the present invention, the host cell expresses a combination of heterologous xylose metabolizing enzymes. In other embodiments, the host cell expresses a combination of heterologous xylanases. For example, the host cell can contain at least two heterologous xylose metabolizing enzymes or at least two heterologous xylanases, at least three heterologous xylose metabolizing enzymes or at least three heterologous xylanases, at least four heterologous xylose metabolizing enzymes or at least four heterologous xylanases, at least five heterologous xylose metabolizing enzymes or at least five heterologous xylanases, at least six heterologous xylose metabolizing enzymes or at least six heterologous xylanases, at least seven heterologous xylose metabolizing enzymes or at least seven heterologous xylanases, or at least eight heterologous xylose metabolizing enzymes or at least eight heterologous xylanases. The heterologous xylose metabolizing enzymes in the host cell can be from the same or from different species. In one embodiment, the one or more heterologous xylose metabolizing enzymes are contained in an operon. The heterologous xylanases in the host cell can be from the same or from different species.
(138) Fusion Proteins Comprising Xylose Metabolizing Enzymes or Xylanases
(139) The present invention also encompasses fusion proteins. For example, the fusion proteins can be a fusion of a heterologous xylose metabolizing enzyme and a second peptide. The heterologous xylose metabolizing enzyme and the second peptide can be fused directly or indirectly, for example, through a linker sequence. The fusion protein can comprise for example, a second peptide that is N-terminal to the heterologous xylose metabolizing enzyme and/or a second peptide that is C-terminal to the heterologous xylose metabolizing enzyme. Thus, in certain embodiments, the polypeptide of the present invention comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a heterologous xylose metabolizing enzyme.
(140) In other embodiments, the fusion proteins can be a fusion of a heterologous xylanase and a second peptide. The heterologous xylanase and the second peptide can be fused directly or indirectly, for example, through a linker sequence. The fusion protein can comprise for example, a second peptide that is N-terminal to the heterologous xylanase and/or a second peptide that is C-terminal to the heterologous xylanase. Thus, in certain embodiments, the polypeptide of the present invention comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a heterologous xylanase.
(141) According to one aspect of the present invention, the fusion protein can comprise a first and second polypeptide wherein the first polypeptide comprises a heterologous xylose metabolizing enzyme or a xylanase, and the second polypeptide comprises a signal sequence. According to another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous xylose metabolizing enzyme or a xylanase, and the second polypeptide comprises a polypeptide used to facilitate purification or identification or a reporter peptide. The polypeptide used to facilitate purification or identification or the reporter peptide can be, for example, a HIS-tag, a GST-tag, an HA-tag, a FLAG-tag, or a MYC-tag.
(142) According to another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous xylose metabolizing enzyme or a xylanase, and the second polypeptide comprises a fluorescent protein. In one aspect, the fluorescent protein is used to detect the heterologous xylose metabolizing enzyme fusion protein or the heterologous xylanase fusion protein.
(143) According to yet another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous xylose metabolizing enzyme or a xylanase, and the second polypeptide comprises an anchoring peptide.
(144) According to still another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous xylose metabolizing enzyme or a xylanase, and the second polypeptide comprises a cellulose binding module (CBM).
(145) In certain other embodiments, the first polypeptide and the second polypeptide are fused via a linker sequence. The linker sequence can, in some embodiments, be encoded by a codon-optimized polynucleotide. (Codon-optimized polynucleotides are described in more detail below).
(146) Co-Cultures
(147) In another aspect, the present invention is directed to co-cultures comprising at least two host cells wherein the at least two host cells each comprise one or more isolated polynucleotides encoding one or more xylose metabolizing enzymes. In one embodiment, the co-culture can comprise two or more strains of host cells and the heterologous xylose metabolizing enzymes can be expressed in any combination in the two or more strains of host cells. In one aspect, the at least two host cells express the same xylose metabolizing enzyme. In another aspect, the at least two host cell express different xylose metabolizing enzymes. In yet another aspect, the at least two host cell express at least one common xylose metabolizing enzyme. In one aspect, the xylose metabolizing enzymes are heterologous xylose metabolizing enzymes. In one embodiment, one of the host cells is a Clostridium host cell. In one aspect, one of the host cells is a recombinant Clostridiunm thermocellum host cell.
(148) In other aspects, the present invention is directed to co-cultures comprising at least two host cells wherein the at least two host cells each comprise one or more isolated polynucleotides encoding one or more xylanases. In one embodiment, the co-culture can comprise two or more strains of host cells and the heterologous xylanases can be expressed in any combination in the two or more strains of host cells. In one aspect, the at least two host cells express the same xylanase. In another aspect, the at least two host cell express different xylanase. In yet another aspect, the at least two host cell express at least one common xylanase. In one aspect, the xylanases are heterologous xylanases. In one embodiment, one of the host cells is a Clostridium host cell. In one aspect, one of the host cells is a recombinant Clostridium thermocellum host cell.
(149) The various host cell strains in the co-culture can be present in equal numbers, or one strain or species of host cell can significantly outnumber another second strain or species of host cells. For example, in a co-culture comprising two strains or species of host cells the ratio of one host cell to another can be about 1:1, 1:2, 1:3, 1:4, 1:5, 1:10, 1:100, 1:500 or 1:1000. Similarly, in a co-culture comprising three or more strains or species of host cells, the strains or species of host cells may be present in equal or unequal numbers.
(150) Polynucleotides Encoding Heterologous Xylose Metabolizing Enzymes or Heterologous Xylanases
(151) In another aspect, the present invention includes isolated polynucleotides encoding xylose metabolizing enzymes or xylanases of the present invention. The polynucleotides can encode a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, a transketolase, and a transaldolase.
(152) The present invention also encompasses an isolated polynucleotide comprising a nucleic acid that is at least about 70%, 75%, or at least about 80% identical, at least about 90% to about 95% identical, or at least about 96%, 97%, 98%, 99% or 100% identical to a nucleic acid encoding a xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, a transketolase, and a transaldolase. The present invention further encompasses an isolated polynucleotide comprising a nucleic acid that is at least about 70%, 75%, or at least about 80% identical, at least about 90% to about 95% identical, or at least about 96%, 97%, 98%, 99% or 100% identical to a nucleic acid encoding a xylanase.
(153) The present invention also encompasses variants of the xylose metabolizing enzyme genes or xylanase genes. Variants may contain alterations in the coding regions, non-coding regions, or both. Examples are polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In certain embodiments, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. In further embodiments xylose isomerase, xylulokinase, xylose reductase, xylose dehydrogenase, xylitol dehydrogenase, xylonate dehydratase, transketolase, and transaldolase polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host. In other embodiments, xylanase polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host. Codon-optimized polynucleotides of the present invention are discussed further below.
(154) The present invention also encompasses an isolated polynucleotide encoding a fusion protein. In further embodiments, the first and second polynucleotides are in the same orientation, or the second polynucleotide is in the reverse orientation of the first polynucleotide. In additional embodiments, the first polynucleotide encodes a polypeptide that is either N-terminal or C-terminal to the polypeptide encoded by the second polynucleotide. In certain other embodiments, the first polynucleotide and/or the second polynucleotide are encoded by codon-optimized polynucleotides, for example, polynucleotides codon-optimized for Clostridium thermocellum.
(155) Also provided in the present invention are allelic variants, orthologs, and/or species homologs. Procedures known in the art can be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any of SEQ ID NOs: 1-2, or other xylose metabolizing enzymes using information from the sequences disclosed herein or the clones deposited with the ATCC or otherwise publically available. For example, allelic variants and/or species homologs may be isolated and identified by making suitable probes or primers from the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homolog. Procedures known in the art can also be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any xylanases using information from the sequences disclosed herein or the clones deposited with the ATCC or otherwise publically available.
(156) By a nucleic acid having a nucleotide sequence at least, for example, 95% identical to a reference nucleotide sequence of the present invention, it is intended that the nucleotide sequence of the nucleic acid is identical to the reference sequence except that the nucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the particular polypeptide. In other words, to obtain a nucleic acid having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. In one embodiment, the query sequence may be an entire sequence shown of any of SEQ ID NOs: 1-2, or any fragment or domain specified as described herein.
(157) As a practical matter, whether any particular nucleic acid molecule or polypeptide is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence or polypeptide of the present invention can be determined conventionally using known computer programs. A method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci. (1990) 6:237-245) In a sequence alignment the query and subject sequences are both DNA sequences. An RNA sequence can be compared by converting U's to T's. The result of said global sequence alignment is in percent identity. Preferred parameters used in a FASTDB alignment of DNA sequences to calculate percent identity are: Matrix=Unitary, k-tuple=4, Mismatch Penalty=1, Joining Penalty=30, Randomization Group Length=0, Cutoff Score=1, Gap Penalty=5, Gap Size Penalty 0.05, Window Size=500 or the length of the subject nucleotide sequence, whichever is shorter.
(158) If the subject sequence is shorter than the query sequence because of 5 or 3 deletions, not because of internal deletions, a manual correction must be made to the results. This is because the FASTDB program does not account for 5 and 3 truncations of the subject sequence when calculating percent identity. For subject sequences truncated at the 5 or 3 ends, relative to the query sequence, the percent identity is corrected by calculating the number of bases of the query sequence that are 5 and 3 of the subject sequence, which are not matched/aligned, as a percent of the total bases of the query sequence. Whether a nucleotide is matched/aligned is determined by results of the FASTDB sequence alignment. This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to arrive at a final percent identity score. This corrected score is what is used for the purposes of the present invention. Only bases outside the 5 and 3 bases of the subject sequence, as displayed by the FASTDB alignment, which are not matched/aligned with the query sequence, are calculated for the purposes of manually adjusting the percent identity score.
(159) For example, a 90 base subject sequence is aligned to a 100 base query sequence to determine percent identity. The deletions occur at the 5 end of the subject sequence and therefore, the FASTDB alignment does not show a matched/alignment of the first 10 bases at 5 end. The 10 unpaired bases represent 10% of the sequence (number of bases at the 5 and 3 ends not matched/total number of bases in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 bases were perfectly matched the final percent identity would be 90%. In another example, a 90 base subject sequence is compared with a 100 base query sequence. This time the deletions are internal deletions so that there are no bases on the 5 or 3 of the subject sequence which are not matched/aligned with the query. In this case the percent identity calculated by FASTDB is not manually corrected. Once again, only bases 5 and 3 of the subject sequence which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are to be made for the purposes of the present invention.
(160) Some embodiments of the invention encompass a nucleic acid molecule comprising at least 10, 20, 30, 35, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, or 800 consecutive nucleotides or more of any of SEQ ID NOs: 1-2, or domains, fragments, variants, or derivatives thereof. Other embodiments of the invention encompass a nucleic acid molecule comprising at least 10, 20, 30, 35, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, or 800 consecutive nucleotides or more of any of known xylanases or domains, fragments, variants, or derivatives thereof.
(161) The polynucleotide of the present invention may be in the form of RNA or in the form of DNA, which DNA includes cDNA, genomic DNA, and synthetic DNA. The DNA may be double stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand. In one embodiment, the coding sequence which encodes the mature polypeptide can be identical to the coding sequence encoding SEQ ID NO: 3-4, or may be a different coding sequence which coding sequence, as a result of the redundancy or degeneracy of the genetic code, encodes the same mature polypeptide as the nucleic acid sequences of any one of SEQ ID NOs: 3-4. In another embodiment, the coding sequence which encodes the mature polypeptide can be identical to the coding sequence encoding a known xylanase, or may be a different coding sequence which coding sequence, as a result of the redundancy or degeneracy of the genetic code, encodes the same mature xylanase.
(162) In certain embodiments, the present invention provides an isolated polynucleotide comprising a nucleic acid fragment which encodes at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 95, or at least 100 or more contiguous amino acids of SEQ ID NOs: 1-2. In other embodiments, the present invention provides an isolated polynucleotide comprising a nucleic acid fragment which encodes at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 95, or at least 100 or more contiguous amino acids of a known xylanase.
(163) The polynucleotide encoding for the mature polypeptide of SEQ ID NOs: 3-4 may include: only the coding sequence for the mature polypeptide; the coding sequence of any domain of the mature polypeptide; and the coding sequence for the mature polypeptide (or domain-encoding sequence) together with non coding sequence, such as introns or non-coding sequence 5 and/or 3 of the coding sequence for the mature polypeptide.
(164) Thus, the term polynucleotide encoding a polypeptide encompasses a polynucleotide which includes only sequences encoding for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences.
(165) Due to the degeneracy of the genetic code, one of ordinary skill in the art will immediately recognize that a large portion of the nucleic acid molecules having a sequence at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence of any of SEQ ID NOs: 1-2, or fragments thereof, will encode polypeptides having functional activity. In fact, since degenerate variants of any of these nucleotide sequences encode the same polypeptide, in many instances, this will be clear to the skilled artisan even without performing the above described comparison assay. It will be further recognized in the art that, for such nucleic acid molecules that are not degenerate variants, a reasonable number will also encode a polypeptide having functional activity.
(166) The polynucleotides of the present invention also comprise nucleic acids encoding xylose metabolizing enzyme or domain, fragment, variant, or derivative thereof, fused to a polynucleotide encoding a marker sequence which allows for detection of the polynucleotide of the present invention. In one embodiment of the invention, expression of the marker is independent from expression of the xylose metabolizing enzyme. The polynucleotides of the present invention further comprise nucleic acids encoding xylanases or a domain, fragment, variant, or derivative thereof, fused to a polynucleotide encoding a marker sequence which allows for detection of the polynucleotide of the present invention. In one embodiment of the invention, expression of the marker is independent from expression of the xylanase.
(167) In one embodiment, the one or more polynucleotides of the present invention are stably integrated into the genome of the host cell. In one aspect, the polynucleotides are randomly integrated into the genome of the host cell. In another aspect, multiple copies of polynucleotides are randomly integrated into the genome of the host cell. In one aspect, at least two copies of polynucleotides are randomly integrated into the genome of the host cell.
(168) In another embodiment, the one or more polynucleotides are not integrated into the genome of the host cell. In one aspect, the one or more polynucleotides are present in the host cell in a extrachromosomal plasmid.
(169) In one embodiment, one or more polynucleotides of the present invention are stably integrated at a specific site in the genome of the host cell. In one aspect, the one or more polynucleotides are stably integrated at the site of one or more specific genes in the genome of the host cell. In one embodiment, the one or more specific genes are disrupted as a result of the one or more integration events. In another aspect, the one or more specific genes are deleted as a result of the one or more integration events. In one embodiment, the host cell cannot make the protein product(s) of the one or more specific disrupted genes. In another aspect, the host cell cannot make the protein product(s) of the one or more specific deleted genes. In a preferred embodiment, the one or more polynucleotides are stably integrated at the site of the lactate dehydrogenase gene in the genome of the host cell.
(170) In one embodiment, the start codon of a polynucleotide of the present invention is integrated in frame with the promoter of a specific gene in the genome of the host cell. In another embodiment, the stop codon of a polynucleotide of the invention is integrated in frame with the terminator of a specific gene in the genome of the host cell. In one embodiment, the start codon of a polynucleotides is integrated in frame with the promoter of a specific gene in the genome of the host cell, and the terminator of the same polynucleotide is also integrated in frame with the terminator of the specific gene.
(171) In one embodiment, the one or more polynucleotides are part of an operon. In one aspect, the start codon of the first polynucleotides in the operon is integrated in frame with the promoter of a specific gene in the genome of the host cell. In another aspect, the stop codon of the last polynucleotides in the operon is integrated in frame with the terminator of a specific gene in the genome of the host cell. In one embodiment, the start codon of the first polynucleotide in the operon is integrated in frame with the promoter of a specific gene in the genome of the host cell, and the stop codon of the last polynucleotide in the operon is integrated in frame with the terminator of the specific gene.
(172) Codon Optimized Polynucleotides
(173) The polynucleotides of the invention can be codon-optimized. As used herein the term codon-optimized coding region means a nucleic acid coding region that has been adapted for expression in the cells of a given organism by replacing at least one, or more than one, or a significant number, of codons with one or more codons that are more frequently used in the genes of that organism.
(174) In general, highly expressed genes in an organism are biased towards codons that are recognized by the most abundant tRNA species in that organism. One measure of this bias is the codon adaptation index or CAI, which measures the extent to which the codons used to encode each amino acid in a particular gene are those which occur most frequently in a reference set of highly expressed genes from an organism.
(175) The CAI of codon optimized sequences of the present invention corresponds to between about 0.8 and 1.0, between about 0.8 and 0.9, or about 1.0. A codon optimized sequence may be further modified for expression in a particular organism, depending on that organism's biological constraints. For example, large runs of As or Ts (e.g., runs greater than 3, 4, 5, 6, 7, 8, 9, or 10 consecutive bases) can be removed from the sequences if these are known to effect transcription negatively. Furthermore, specific restriction enzyme sites may be removed for molecular cloning purposes. Examples of such restriction enzyme sites include PacI, AscI, BamHI, BglII, EcoRI and XhoI. Additionally, the DNA sequence can be checked for direct repeats, inverted repeats and mirror repeats with lengths of ten bases or longer, which can be modified manually by replacing codons with second best codons, i.e., codons that occur at the second highest frequency within the particular organism for which the sequence is being optimized.
(176) Deviations in the nucleotide sequence that comprise the codons encoding the amino acids of any polypeptide chain allow for variations in the sequence coding for the gene. Since each codon consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific bases, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codons encode signals ending translation). The genetic code which shows which codons encode which amino acids is reproduced herein as Table 8. As a result, many amino acids are designated by more than one codon. For example, the amino acids alanine and proline are coded for by four triplets, serine and arginine by six, whereas tryptophan and methionine are coded by just one triplet. This degeneracy allows for DNA base composition to vary over a wide range without altering the amino acid sequence of the proteins encoded by the DNA.
(177) TABLE-US-00008 TABLE 8 The Standard Genetic Code T C A G T TTT Phe (F) TCT Ser (S) TAT Tyr (Y) TGT Cys (C) TTC Phe (F) TCC Ser (S) TAC Tyr (Y) TGC TTA Leu (L) TCA Ser (S) TAA Ter TGA Ter TTG Leu (L) TCG Ser (S) TAG Ter TGG Trp (W) C CTT Leu (L) CCT Pro (P) CAT His (H) CGT Arg (R) CTC Leu (L) CCC Pro (P) CAC His (H) CGC Arg (R) CTA Leu (L) CCA Pro (P) CAA Gln (Q) CGA Arg (R) CTG Leu (L) CCG Pro (P) CAG Gln (Q) CGG Arg (R) A ATT Ile (I) ACT Thr (T) AAT Asn (N) AGT Ser (S) ATC Ile (I) ACC Thr (T) AAC Asn (N) AGC Ser (S) ATA Ile (I) ACA Thr (T) AAA Lys (K) AGA Arg (R) ATG Met (M) ACG Thr (T) AAG Lys (K) AGG Arg (R) G GTT Val (V) GCT Ala (A) GAT Asp (D) GGT Gly (G) GTC Val (V) GCC Ala (A) GAC Asp (D) GGC Gly (G) GTA Val (V) GCA Ala (A) GAA Glu (E) GGA Gly (G) GTG Val (V) GCG Ala (A) GAG Glu (E) GGG Gly (G)
(178) Many organisms display a bias for use of particular codons to code for insertion of a particular amino acid in a growing peptide chain. Codon preference or codon bias, differences in codon usage between organisms, is afforded by degeneracy of the genetic code, and is well documented among many organisms. Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
(179) Given the large number of gene sequences available for a wide variety of animal, plant and microbial species, it is possible to calculate the relative frequencies of codon usage. Codon usage tables are readily available, for example, at http://www.kazusa.or.jp/codon/ (visited Dec. 21, 2011), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. Codon usage tabulated from the international DNA sequence databases: status for the year 2000, Nucl. Acids Res. 28:292 (2000). Codon usage tables for Clostridium thermocellum are reproduced below as Table 9. This table uses mRNA nomenclature, and so instead of thymine (T) which is found in DNA, the table uses uracil (U) which is found in RNA. The table has been adapted so that frequencies are calculated for each amino acid, rather than for all 64 codons.
(180) TABLE-US-00009 TABLE 9 Codon Usage Table for Clostridium thermocellum Genes Frequency per Amino Acid Codon Number thousand Phe UUU 33708 31.4 Phe UUC 11609 10.8 Leu UUA 14541 13.6 Leu UUG 22069 20.6 Leu CUU 29310 27.3 Leu CUC 5946 5.5 Leu CUA 3307 3.1 Leu CUG 17685 16.5 Ile AUU 138715 36.1 Ile AUC 12546 11.7 Ile AUA 39530 36.9 Met AUG 26236 24.5 Val GUU 27407 25.6 Val GUC 8318 7.8 Val GUA 22260 20.8 Val GUG 18418 17.2 Ser UCU 8481 7.9 Ser UCC 11589 10.8 Ser UCA 12797 11.9 Ser UCG 6968 6.5 Ser AGU 11506 10.7 Ser AGC 13305 12.4 Pro CCU 11646 10.9 Pro CCC 7085 6.6 Pro CCA 5359 5.0 Pro CCG 12219 11.4 Thr ACU 12643 11.8 Thr ACC 14186 13.2 Thr ACA 17970 16.8 Thr ACG 9132 8.5 Ala GCU 15775 14.7 Ala GCC 16131 15.0 Ala GCA 24707 23.0 Ala GCG 11699 10.9 Tyr UAU 30600 28.5 Tyr UAC 14622 13.6 His CAU 10285 9.6 His CAC 4968 4.6 Gln CAA 11015 10.3 Gln CAG 16436 15.3 Asn AAU 34401 32.1 Asn AAC 23283 21.7 Lys AAA 55999 52.2 Lys AAG 30476 28.4 Asp GAU 35175 32.8 Asp GAC 25798 24.1 Glu GAA 54980 51.3 Glu GAG 26502 24.7 Cys UGU 6020 5.6 Cys UGC 6488 6.0 Trp UGG 9460 8.8 Arg CGU 4135 3.9 Arg CGC 2988 2.8 Arg CGA 1989 1.9 Arg CGG 3581 3.3 Arg AGA 20471 19.1 Arg AGG 13476 12.6 Gly GGU 18094 16.9 Gly GGC 15050 14.0 Gly GGA 29764 27.7 Gly GGG 8599 8.0 Stop UAA 1762 1.6 Stop UAG 633 0.6 Stop UGA 796 0.7
(181) By utilizing this or similar tables, one of ordinary skill in the art can apply the frequencies to any given polypeptide sequence, and produce a nucleic acid fragment of a codon-optimized coding region which encodes the polypeptide, but which uses codons optimal for a given species. Codon-optimized coding regions can be designed by various different methods.
(182) In one method, a codon usage table is used to find the single most frequent codon used for any given amino acid, and that codon is used each time that particular amino acid appears in the polypeptide sequence. For example, referring to Table 9 above, for leucine, the most frequent codon is UUG, which is used 27.2% of the time. Thus all the leucine residues in a given amino acid sequence would be assigned the codon UUG.
(183) In another method, the actual frequencies of the codons are distributed randomly throughout the coding sequence. Thus, using this method for optimization, if a hypothetical polypeptide sequence had 100 leucine residues, referring to Table 9 for frequency of usage in the S. cerevisiae, about 5, or 5% of the leucine codons would be CUC, about 11, or 11% of the leucine codons would be CUG, about 12, or 12% of the leucine codons would be CUU, about 13, or 13% of the leucine codons would be CUA, about 26, or 26% of the leucine codons would be UUA, and about 27, or 27% of the leucine codons would be UUG.
(184) These frequencies would be distributed randomly throughout the leucine codons in the coding region encoding the hypothetical polypeptide. As will be understood by those of ordinary skill in the art, the distribution of codons in the sequence can vary significantly using this method; however, the sequence always encodes the same polypeptide.
(185) When using the methods above, the term about is used precisely to account for fractional percentages of codon frequencies for a given amino acid. As used herein, about is defined as one amino acid more or one amino acid less than the value given. The whole number value of amino acids is rounded up if the fractional frequency of usage is 0.50 or greater, and is rounded down if the fractional frequency of use is 0.49 or less. Using again the example of the frequency of usage of leucine in human genes for a hypothetical polypeptide having 62 leucine residues, the fractional frequency of codon usage would be calculated by multiplying 62 by the frequencies for the various codons. Thus, 7.28 percent of 62 equals 4.51 UUA codons, or about 5, i.e., 4, 5, or 6 UUA codons, 12.66 percent of 62 equals 7.85 UUG codons or about 8, i.e., 7, 8, or 9 UUG codons, 12.87 percent of 62 equals 7.98 CUU codons, or about 8, i.e., 7, 8, or 9 CUU codons, 19.56 percent of 62 equals 12.13 CUC codons or about 12, i.e., 11, 12, or 13 CUC codons, 7.00 percent of 62 equals 4.34 CUA codons or about 4, i.e., 3, 4, or 5 CUA codons, and 40.62 percent of 62 equals 25.19 CUG codons, or about 25, i.e., 24, 25, or 26 CUG codons.
(186) Randomly assigning codons at an optimized frequency to encode a given polypeptide sequence, can be done manually by calculating codon frequencies for each amino acid, and then assigning the codons to the polypeptide sequence randomly. Additionally, various algorithms and computer software programs are readily available to those of ordinary skill in the art. For example, the EditSeq function in the Lasergene Package, available from DNAstar, Inc., Madison, Wis., the backtranslation function in the VectorNTl Suite, available from InforMax, Inc., Bethesda, Md., and the backtranslate function in the GCG-Wisconsin Package, available from Accelrys, Inc., San Diego, Calif. In addition, various resources are publicly available to codon-optimize coding region sequences, e.g., the backtranslation function at http://www.entelechon.com/bioinformatics/backtranslation.php?lang=eng (visited Dec. 18, 2009) and the backtranseq function available at http://emboss.bioinformatics.nl/cgi-bin/emboss/backtranseq (visited Dec. 18, 2009). Constructing a rudimentary algorithm to assign codons based on a given frequency can also easily be accomplished with basic mathematical functions by one of ordinary skill in the art.
(187) A number of options are available for synthesizing codon optimized coding regions designed by any of the methods described above, using standard and routine molecular biological manipulations well known to those of ordinary skill in the art. In one approach, a series of complementary oligonucleotide pairs of 80-90 nucleotides each in length and spanning the length of the desired sequence is synthesized by standard methods. These oligonucleotide pairs are synthesized such that upon annealing, they form double stranded fragments of 80-90 base pairs, containing cohesive ends, e.g., each oligonucleotide in the pair is synthesized to extend 3, 4, 5, 6, 7, 8, 9, 10, or more bases beyond the region that is complementary to the other oligonucleotide in the pair. The single-stranded ends of each pair of oligonucleotides is designed to anneal with the single-stranded end of another pair of oligonucleotides. The oligonucleotide pairs are allowed to anneal, and approximately five to six of these double-stranded fragments are then allowed to anneal together via the cohesive single stranded ends, and then they ligated together and cloned into a standard bacterial cloning vector, for example, a TOPO vector available from Invitrogen Corporation, Carlsbad, Calif. The construct is then sequenced by standard methods. Several of these constructs consisting of 5 to 6 fragments of 80 to 90 base pair fragments ligated together, i.e., fragments of about 500 base pairs, are prepared, such that the entire desired sequence is represented in a series of plasmid constructs. The inserts of these plasmids are then cut with appropriate restriction enzymes and ligated together to form the final construct. The final construct is then cloned into a standard bacterial cloning vector, and sequenced. Additional methods would be immediately apparent to the skilled artisan. In addition, gene synthesis is readily available commercially.
(188) In additional embodiments, a full-length polypeptide sequence is codon-optimized for a given species resulting in a codon-optimized coding region encoding the entire polypeptide, and then nucleic acid fragments of the codon-optimized coding region, which encode fragments, variants, and derivatives of the polypeptide are made from the original codon-optimized coding region. As would be well understood by those of ordinary skill in the art, if codons have been randomly assigned to the full-length coding region based on their frequency of use in a given species, nucleic acid fragments encoding fragments, variants, and derivatives would not necessarily be fully codon optimized for the given species. However, such sequences are still much closer to the codon usage of the desired species than the native codon usage. The advantage of this approach is that synthesizing codon-optimized nucleic acid fragments encoding each fragment, variant, and derivative of a given polypeptide, although routine, would be time consuming and would result in significant expense.
(189) The codon-optimized coding regions can be, for example, versions encoding a xylose metabolizing enzyme of the invention, or domains, fragments, variants, or derivatives thereof.
(190) Codon optimization is carried out for a particular species by methods described herein, for example, in certain embodiments codon-optimized coding regions encoding polypeptides disclosed in the present application or domains, fragments, variants, or derivatives thereof are optimized according to codon usage in bacteria (e.g., Clostridium thermocellum). In certain embodiments described herein, a codon-optimized coding region encoding any of SEQ ID NOs: 3-4 or domain, fragment, variant, or derivative thereof, is optimized according to codon usage in Clostridium. In some embodiments, the sequences are codon-optimized specifically for expression in Clostridium thermocellum. Alternatively, a codon-optimized coding region encoding any of SEQ ID NOs: 3-4 can be optimized according to codon usage in any plant, animal, or microbial species.
(191) Also provided are polynucleotides, vectors, and other expression constructs comprising codon-optimized coding regions encoding polypeptides disclosed herein, or domains, fragments, variants, or derivatives thereof, and various methods of using such polynucleotides, vectors and other expression constructs.
(192) Vectors and Methods of Using Vectors in Host Cells
(193) In another aspect, the present invention relates to vectors which include polynucleotides of the present invention, host cells which are genetically engineered with vectors of the invention and the production of polypeptides of the invention by recombinant techniques.
(194) Host cells are genetically engineered (transduced or transformed or transfected) with the vectors of this invention which may be, for example, a cloning vector or an expression vector. The vector may be, for example, in the form of a plasmid, a viral particle, a phage, etc. The engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes of the present invention. The culture conditions, such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
(195) The polynucleotides of the present invention can be employed for producing polypeptides by recombinant techniques. Thus, for example, the polynucleotide may be included in any one of a variety of expression vectors for expressing a polypeptide. Such vectors include chromosomal, nonchromosomal and synthetic DNA sequences, e.g., derivatives of SV40; bacterial plasmids; and yeast plasmids. However, any other vector may be used as long as it is replicable and viable in the host.
(196) The appropriate DNA sequence can be inserted into the vector by a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art. Such procedures and others are deemed to be within the scope of those skilled in the art.
(197) The DNA sequence in the expression vector is operatively associated with an appropriate expression control sequence(s) (promoter) to direct mRNA synthesis. Any suitable promoter to drive gene expression in the host cells of the invention may be used.
(198) In addition, the expression vectors may contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells such as URA3, HIS3, LEU2, TRPI, LYS2 or ADE2, dihydrofolate reductase, neomycin (G418) resistance or zeocin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in prokaryotic cell culture, e.g., Clostridium thermocellum.
(199) The expression vector may also contain a ribosome binding site for translation initiation and/or a transcription terminator. The vector may also include appropriate sequences for amplifying expression, or may include additional regulatory regions.
(200) The vector containing the appropriate DNA sequence as herein, as well as an appropriate promoter or control sequence, may be employed to transform an appropriate host to permit the host to express the protein.
(201) Thus, in certain aspects, the present invention relates to host cells containing the above-described constructs. The host cell can be a host cell as described elsewhere in the application. The host cell can be, for example, a lower eukaryotic cell, such as a yeast cell, e.g., Saccharomyces cerevisiae or Kluyveromvces, or the host cell can be a prokaryotic cell, such as a bacterial cell, e.g., Clostridium thermocellum.
(202) The selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein. In one embodiment, the vector is integrated into the genome of the host cell. In another embodiment, the vector is present in the host cell as an extrachromosomal plasmid.
(203) To select for foreign DNA that has entered a host it is preferable that the DNA be stably maintained in the organism of interest. With regard to plasmids, there are two processes by which this can occur. One is through the use of replicative plasmids. These plasmids have origins of replication that are recognized by the host and allow the plasmids to replicate as stable, autonomous, extrachromosomal elements that are partitioned during cell division into daughter cells. The second process occurs through the integration of a plasmid onto the chromosome. This predominately happens by homologous recombination and results in the insertion of the entire plasmid, or parts of the plasmid, into the host chromosome. Thus, the plasmid and selectable marker(s) are replicated as an integral piece of the chromosome and segregated into daughter cells. Therefore, to ascertain if plasmid DNA is entering a cell during a transformation event through the use of selectable markers requires the use of a replicative plasmid or the ability to recombine the plasmid onto the chromosome. These qualifiers cannot always be met, especially when handling organisms that do not have a suite of genetic tools.
(204) One way to avoid issues regarding plasmid-associated markers is through the use of transposons. A transposon is a mobile DNA element, defined by mosaic DNA sequences that are recognized by enzymatic machinery referred to as a transposase. The function of the transposase is to randomly insert the transposon DNA into host or target DNA. A selectable marker can be cloned onto a transposon by standard genetic engineering. The resulting DNA fragment can be coupled to the transposase machinery in an in vitro reaction and the complex can be introduced into target cells by electroporation. Stable insertion of the marker onto the chromosome requires only the function of the transposase machinery and alleviates the need for homologous recombination or replicative plasmids.
(205) The random nature associated with the integration of transposons has the added advantage of acting as a form of mutagenesis. Libraries can be created that comprise amalgamations of transposon mutants. These libraries can be used in screens or selections to produce mutants with desired phenotypes. For instance, a transposon library of a CBP organism could be screened for the ability to produce less ethanol, or more lactic acid and/or more acetate.
(206) Methods of Using Host Cells to Produce Ethanol or Other Fermentation Products
(207) Microorganisms produce a diverse array of fermentation products, including organic acids, such as lactate (the salt form of lactic acid), acetate (the salt form of acetic acid), pyruvate, succinate, and butyrate, and neutral products, such as ethanol, butanol, acetone, and butanediol. Fermentive products include biofuels, chemicals, compounds suitable as liquid fuels, gaseous fuels, reagents, chemical feedstocks, chemical additives, processing aids, food additives, and other products. For example, see International Publication No. WO 2010/105194, International Application No. PCT/US2010/046172, and U.S. Provisional Application Nos. 61/331,657 and 61/351,133.
(208) In one aspect, the present invention is directed to use of host cells and co-cultures to produce ethanol or other products from the xylose portion of biomass substrates. Such methods can be accomplished, for example, by contacting a xylose-containing lignocellulosic substrate with a host cell or a co-culture of the present invention. In another aspect, the present invention is directed to use of host cells and co-cultures to produce ethanol or other products from the xylan portion of biomass substrates. Fermentation products include, but are not limited to products such as ethanol, propanol, isoamyl alcohol, butanol, acetate, amino acids, and vitamins.
(209) In one embodiment, the end products of xylose fermentation by the host strain comprise pyruvate, acetate, and ethanol. In another embodiment, the end products of xylose fermentation by the host strain comprises acetate, and ethanol. In one aspect, the ratio of acetate to ethanol formed can be at least about 10:1, at least about 5:1, at least about 2:1, at least about 1:1, at least about 1:2, at least about 1:5, at least about 1:10, at least 1:100, at least 1:1000, or at least 1:10,000. In one embodiment, the end products of xylan fermentation by the host strain contain no detectable acetate. In another embodiment, the end products of xylan fermentation by the host strain comprise ethanol. In one embodiment, the host cell is further engineered in order to increase ethanol production from xylose fermentation by the host cell. In one embodiment, the PTA gene is deleted in order to increase ethanol production from xylose fermentation by the host cell. In one aspect, the deletion of the PTA gene results in ethanol being the major end product of xylose fermentation by the host cell. In another aspect, the deletion of the PTA gene results in the production of ethanol as theend product of xylose fermentation by the host cell, with the virtual elimination of one or more undesirable end products (e.g. end products other than ethanol or carbon dioxide). In another aspect, the deletion of the PTA gene results in the production of ethanol as the end product and the production of no undesirable end product. In another embodiment, no, or significantly no lactate or acetate, or both, is produced.
(210) The production of ethanol can, according to the present invention, be performed at temperatures of at least about 25 C., about 28 C., about 30 C., about 31 C., about 32 C., about 33 C., about 34 C., about 35 C., about 36 C., about 37 C., about 38 C., about 39 C., about 40 C., about 41 C., about 42 C., or about 50 C. In some embodiments of the present invention, the thermotolerant host cell can produce ethanol from a xylose-containing or a xylan-containing cellulosic substrate at temperatures above about 30 C., about 31 C., about 32 C., about 33 C., about 34 C., about 35 C., about 36 C., about 37 C., about 38 C. about 39 C. about 40 C. about 41 C. about 42 C. or about 50 C. In some embodiments of the present invention, the thermotolterant host cell can produce ethanol from a xylose-containing or a xylan-containing cellulosic substrate at temperatures from about 30 C. to 60 C., about 30 C. to 55 C., about 30 C. to 50 C., about 40 C. to 60 C., about 40 C. to 55 C. or about 40 C. to 50 C.
(211) In some embodiments, methods of producing ethanol can comprise contacting a xylose-containing and/or xylan-containing lignocellulosic substrate with a host cell or co-culture of the invention and additionally contacting the xylose-containing lignocellulosic substrate with externally produced xylose metabolizing enzymes and/or xylanases. Exemplary externally produced xylose metabolizing enzymes are commercially available and are known to those of skill in the art. Exemplary externally produced xylanases are also commercially available and are known to those of skill in the art.
(212) In some embodiments, the recombinant host cell of the invention is further selected by growth on a medium containing xylose as the only sugar source for at least 2, 5, 10, 15, 20, or 100 generations to generate a second recombinant host cell which utilizes xylose more efficiently than an otherwise identical cell that has not undergone the selection.
(213) The invention is also directed to methods of reducing the amount of externally produced xylose metabolizing enzymes required to produce a given amount of ethanol from a xylose-containing cellulosic substrate comprising contacting the xylose-containing cellulosic substrate with externally produced xylose metabolizing enzymes and with a host cell or co-culture of the invention. In some embodiments, the same amount of ethanol production can be achieved using at least about 5%. 10%, 15%, 20%, 25%, 30%, or 50% fewer externally produced xylose metabolizing enzymes. In other embodiments, ethanol production can be achieved without the addition of externally produced xylose metabolizing enzymes.
(214) The invention is further directed to methods of reducing the amount of externally produced xylanases required to produce a given amount of ethanol from a xylan-containing cellulosic substrate comprising contacting the xylan-containing cellulosic substrate with externally produced xylanases and with a host cell or co-culture of the invention. In some embodiments, the same amount of ethanol production can be achieved using at least about 5%, 10%, 15%, 20%, 25%, 30%, or 50% fewer externally produced xylanases. In other embodiments, ethanol production can be achieved without the addition of externally produced xylanases.
(215) In some embodiments, the methods comprise producing ethanol at a particular rate. For example, in some embodiments, ethanol is produced at a rate of at least about 0.1 mg per hour per liter, at least about 0.25 mg per hour per liter, at least about 0.5 mg per hour per liter, at least about 0.75 mg per hour per liter, at least about 1.0 mg per hour per liter, at least about 2.0 mg per hour per liter, at least about 5.0 mg per hour per liter, at least about 10 mg per hour per liter, at least about 15 mg per hour per liter, at least about 20.0 mg per hour per liter, at least about 25 mg per hour per liter, at least about 30 mg per hour per liter, at least about 50 mg per hour per liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, or at least about 500 mg per hour per liter.
(216) In some embodiments, the host cells of the present invention can produce ethanol at a rate of at least about 0.1 mg per hour per liter, at least about 0.25 mg per hour per liter, at least about 0.5 mg per hour per liter, at least about 0.75 mg per hour per liter, at least about 1.0 mg per hour per liter, at least about 2.0 mg per hour per liter, at least about 5.0 mg per hour per liter, at least about 10 mg per hour per liter, at least about 15 mg per hour per liter, at least about 20.0 mg per hour per liter, at least about 25 mg per hour per liter, at least about 30 mg per hour per liter, at least about 50 mg per hour per liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, or at least about 500 mg per hour per liter more than a control strain (lacking heterologous xylose metabolizing enzymes) and grown under the same conditions. In some embodiments, the ethanol can be produced in the absence of any externally added xylose metabolizing enzymes.
(217) Ethanol production can be measured using any method known in the art. For example, the quantity of ethanol in fermentation samples can be assessed using HPLC analysis. Many ethanol assay kits are commercially available that use, for example, alcohol oxidase enzyme based assays. Methods of determining ethanol production are within the scope of those skilled in the art from the teachings herein.
(218) The U.S. Department of Energy (DOE) provides a method for calculating theoretical ethanol yield. Accordingly, if the weight percentages are known of C6 sugars (i.e., glucan, galactan, mannan), the theoretical yield of ethanol in gallons per dry ton of total C6 polymers can be determined by applying a conversion factor as follows:
(1.11 pounds of C6 sugar/pound of polymeric sugar)(0.51 pounds of ethanol/pound of sugar)(2000 pounds of ethanol/ton of C6 polymeric sugar)(1 gallon of ethanol/6.55 pounds of ethanol)(1/100%), wherein the factor (1 gallon of ethanol/6.55 pounds of ethanol) is taken as the specific gravity of ethanol at 20 C.
(219) And if the weight percentages are known of C5 sugars (i.e., xylan, arabinan), the theoretical yield of ethanol in gallons per dry ton of total C5 polymers can be determined by applying a conversion factor as follows:
(1.136 pounds of C5 sugar/pound of C5 polymeric sugar)(0.51 pounds of ethanol/pound of sugar)(2000 pounds of ethanol/ton of C5 polymeric sugar)(1 gallon of ethanol/6.55 pounds of ethanol)(1/100%), wherein the factor (1 gallon of ethanol/6.55 pounds of ethanol) is taken as the specific gravity of ethanol at 20 C.:
(220) It follows that by adding the theoretical yield of ethanol in gallons per dry ton of the total C6 polymers to the theoretical yield of ethanol in gallons per dry ton of the total C5 polymers gives the total theoretical yield of ethanol in gallons per dry ton of feedstock.
(221) In one embodiment, the invention provides for a method of making a pentose sugar fermentation product comprising incubating a reaction mixture comprising a biomass comprising one or more pentose sugars and a microorganism capable of fermenting one or more pentose sugars. In one aspect, the microorganism capable of fermenting one or more pentose sugars is a Clostridium species. In one aspect, the Clostridium species is Clostridium thermocellum. In one embodiment, the Clostridium thermocellum is the recombinant Clostridium thermocellum host cell of the invention. In one embodiment, the pentose sugar is xylose. In one embodiment, the xylose fermentation product comprises ethanol, acetate, and/or pyruvate. In one embodiment, the xylose fermentation end product is ethanol.
(222) In one embodiment, the invention provides for a method of fermenting xylose comprising incubating a reaction mixture comprising a biomass comprising one or more pentose sugars and a microorganism capable of fermenting the one or more pentose sugars. In one aspect, the pentose sugar is xylose. In one aspect, the microorganism capable of fermenting one or more pentose sugars is a Clostridium species. In one aspect, the Clostridium species is Clostridium thermocellum. In one embodiment, the Clostridium thermocellum is the recombinant Clostridium thermocellum host cell of the invention.
(223) In yet another embodiment, the invention provides a fermentation broth comprising: a microorganism capable of fermenting one or more pentose sugars and a media. In one aspect, the pentose sugar is xylose. In one aspect, the microorganism capable of fermenting one or more pentose sugars is a Clostridium species. In one aspect, the Clostridium species is Clostridium thermocellum. In one aspect, the Clostridium thermocellum is the recombinant Clostridium thermocellum host cell of the invention. In one embodiment, the media comprises one or more pentose sugars. In one aspect, the pentose sugar is xylose. In one embodiment, the media is capable of supporting the growth of the microorganism capable of fermenting one or more pentose sugars.
EXEMPLIFICATION
(224) The invention now being generally described, it will be more readily understood by reference to the following examples, which are included merely for purposes of illustration of certain aspects and embodiments of the present invention, and are not intended to limit the invention.
Example 1
Creation of ldh::XI/XK (T2) Strain
(225) The present invention provides methods for generating C. thermocellum expressing the enzymes XI and XK. To do this, a molecular cassette was designed to fuse the XI/XK operon with the LDH promoter and terminator sequences on the chromosome of C. thermocellum (
(226) In order to integrate the XI/XK operon on the chromosome, plasmid pMU1793 was designed and built (
Example 2
Growth of ldh::XI/XK (T2) Strain on Xylose
(227) The resulting strain from Example 1 was inoculated in several tubes of CTFUD medium containing xylose concentrations ranging from 5-100 g/l. After 7 days an increase in OD as observed in 10, 20, 50 g/l xylose. These strains were further analyzed by diagnostic PCR and 16S sequencing. Both results indicated the sample was a pure culture of C. thermocellum. End point samples were taken and analyzed by HPLC. After 156 hrs, significant xylose consumption was observed (
Example 3
Xylose Fermentation by the ldh::XI/XK (T2) Strain
(228) C. thermocellum makes ethanol, lactate and acetate as the primary fermentation end products. The T2 ldh::XI/XK strain was observed to produce small amounts of acetate, ethanol and pyruvate (
(229) The ldh::Xi/Xk culture grown in 20 g/l was serially transferred two times in the same medium creating T3 and T4 culture. The OD of these transfers was monitored and analyzed by microscopy. A pattern was observed that begins with no growth in the first 24 hrs post innoculation. After 48 hrs a slight increase in OD was observed and high frequency sporulation was observed (
Example 4
Xylose Fermentation by the ldh::XI/XK (T6) Strain
(230) Serial transfer of the ldh::XI/XK culture was continued for two more generations, thereby creating a T6 strain. Endpoint analysis was done on the T6 culture grown in both 10 and 20 g/l xylose. The results indicated the culture was evolving to make acetate preferentially since a 5:1 acetate to ethanol ratio was observed (
(231) Molecular QC was performed on the T6 strain and again confirmed the strain was a pure culture of C. thermocellum. The T6 strain was inoculated into medium containing 10 g/l avicel to further support that the culture was indeed C. thermocellum. Growth on avicel was rapid, indicating the organism that had been transferred was highly cellulolytic. Interesting, the acetate:ethanol remained at 5:1 even on a cellulose based carbon source (
Example 5
Creation of hpt, ldh:XI/Xdpta Strain
(232) The T6 strain described above was able to grow on xylose, however acetate was still produced. In order to generate a high yielding strain, production of acetate should be eliminated, which can be accomplished by deletion of the PTA gene.
(233) Thus, to create a strain capable of converting xylose into ethanol as the end product, with the virtual elimination of other undesirable end products or with the production of no undesirable end product, it was necessary to delete the PTA gene. Since, the ldh::XI/XK strain evolved to make a 5:1 acetate to ethanol, the unevolved strain was chosen as a background for this mutation. The procedure to delete PTA in the ldh:XI/XK background was as disclosed in Argyros et al., Appl. Environ. Microbiol., 77:8288-8294, 2011. Briefly, the ldh:XiXK strain was transformed with plasmid pMU1817 which has been used previously to delete PTA. The genetic selections were performed as above and a pta, ldh:XI/XK strain was confirmed by diagnostic PCR. This strain was transferred on minimal medium 10 times and frozen down for further analysis.
(234) Additionally, from the resulting strain of Example 1, strain M2236 was constructed. Strain M2236 further contains a deletion of the PTA gene, resulting in a strain that is hpt, ldh:XI/XKpta. A MI570 strain is used as a control strain of C. thermocellum. M1570 has both LDH and PTA deletions but does not contain the T. saccharolyticunm XI/XK genes and is unable to ferment xylose into ethanol.
Example 6
Xylose Fermentation by the hpt, ldh::XU/XKpta Strain
(235) The M1570 (hptldhpta) and M2236 strains were grown in CM3 medium containing xylose as the only sugar source. The concentrations of xylose and ethanol were measured using HPLC at both 24 hrs. and 48 hrs.
INCORPORATION BY REFERENCE
(236) All documents cited herein, including journal articles or abstracts, published or corresponding U.S. or foreign patent applications, issued or foreign patents, or any other documents, are each entirely incorporated by reference herein, including all data, tables, figures, and text presented in the cited documents.
EQUIVALENTS
(237) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.