VEGF-TRAP PROTEIN VARIANTS AND ANALYSIS THEREOF
20250231141 ยท 2025-07-17
Inventors
- Anu RAMBHADRAN (Tarrytown, NY, US)
- Peng CUI (Tarrytown, NY, US)
- Paul BIGWARFE (Tarrytown, NY, US)
- Michele LASTRO (Tarrytown, NY, US)
- Clare RYAN (Tarrytown, NY, US)
- Junyu MA (Tarrytown, NY, US)
- Kun Lu (Tarrytown, NY, US)
Cpc classification
G01N27/60
PHYSICS
International classification
Abstract
Embodiments of the present disclosure are directed to charge variants of a protein such as vascular endothelial growth factor VEGF-Trap, and methods, systems, devices and kits corresponding to methods for analyzing the same.
Claims
1.-7. (canceled)
8. A kit comprising: a plurality of vascular endothelial growth factor trap (VEGF-Trap) proteins, wherein the plurality of VEGF-Trap proteins comprises charge variant isoforms of a VEGF-Trap protein having SEQ ID NO:1, and one or more capillary tubes configured with a mixture of carrier ampholyte, methylcellulose, and a stabilizing additive.
9. The kit of claim 8, wherein the stabilizing additive is urea.
10. The kit of claim 9, wherein the amount of urea in the mixture comprises about 1 M to about 3 M.
11. The kit of claim 8, wherein the mixture comprises about 0.35% methylcellulose, about 2 M urea, and about 3% carrier ampholyte having a pI of 3 to 10.
12. A method for analyzing charge variant isoforms of a vascular endothelial growth factor trap (VEGF-Trap) protein, the method comprising using the kit of claim 8 in an image capillary isoelectric focusing (iCIEF) assay.
13. A method for analyzing charge variant isoforms of a vascular endothelial growth factor trap (VEGF-Trap) protein, the method comprising: loading a protein sample comprising the VEGF-Trap protein onto a separation capillary tube comprising a mixture of at least a carrier ampholyte, methylcellulose, and urea; applying a first voltage for a first predetermined period of time such that the carrier ampholyte forms a pH gradient within the separation capillary tube; applying a second voltage for a second predetermined period of time to focus the migration of charge variants of the VEGF-Trap protein within the separation capillary tube such that the overall charge of the variants is neutral; and detecting and quantifying charge variants of the VEGF-Trap protein comprising: (i) measuring an absorbance for a plurality of charge variant isoforms; (ii) segregating the plurality of charge variant isoforms into isolated regions comprising at least a first acid/acidic region (R1), a second neutral region (R2) comprising three principal peaks, and a third base/basic region (R3); and (iii) determining a percentage of charge variant isoforms falling within each of regions R1, R2 and R3.
14. The method of claim 13, wherein detection of charge variant isoforms occurs at a wavelength of about 280 nm.
15. The method of claim 13, wherein the concentration of protein loaded onto the separation capillary tube is about 2.0 mg/ml.
16. The method of claim 13, wherein the amount of urea in the mixture comprises about 2 M.
17. The method of claim 13, wherein the mixture includes about 0.35% methylcellulose.
18. The method of claim 13, wherein the first voltage comprises about 1500 V.
19. The method of claim 13, wherein the first predetermined time is about 1 minute.
20. The method of claim 13, wherein the second voltage comprises about 3000 V.
21. The method of claim 13, wherein the second predetermined time is about 7 minutes.
22. The method of claim 13, wherein the concentration of protein loaded onto the capillary tube is between 1.0 and 8.0 mg/ml, or any intervening range.
23. The method of claim 13, wherein the amount of urea in the mixture is greater than 0 M and less than 8 M, or any intervening range.
24. The method of claim 13, wherein the mixture includes between 0.01% and 0.35% methylcellulose, or any intervening range.
25. The method of claim 13, wherein the first voltage is between 1 V and 3000 V, or any intervening range.
26. The method of claim 13, wherein the first predetermined time is between 1 second and 5 minutes, or any intervening range.
27. The method of claim 13, wherein the second voltage is between 1 V and 6000 V, or any intervening range.
28. The method of claim 13, wherein the second predetermined time is between 1 minute and 14 minutes, or any intervening range.
29. The method of claim 13, wherein the mixture includes about 0.35% methylcellulose, about 2 M urea, and about 3% carrier ampholyte having a pI of 3 to 10.
30. The method of claim 13, wherein the capillary tube comprises a fluorocarbon coating.
31. The method of claim 13, wherein the VEGF-Trap protein comprises the sequence of SEQ ID NO: 1.
32. The method of claim 13, wherein: a) the mixture comprises about 2 M urea, about 0.35% methylcellulose, and about 3% ampholyte having a pI of 3-10; b) the first voltage comprises about 1500 V and the first predetermined time is about 1 minute; c) the second voltage comprises about 3000 V and the second predetermined time is about 7 minutes; and d) the VEGF-Trap comprises the sequence of SEQ ID NO: 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
DETAILED DESCRIPTION OF THE INVENTION
[0050] Described herein are methods and systems for charge variant analysis of various proteins such as VEGF Trap. VEGF Trap is a fusion protein comprising the sequence shown in Table 1 Instead of reporting charge variant distribution by grouping bands 3-9 in an isoelectric focusing gel, which is the currently approved method for analyzing VEGF Trap, the methods and systems described here generally use image capillary isoelectric focusing to report charge heterogeneity in terms of percentages of charge variant isoforms, and groups them into three different regions of the electropherogram. This reporting approach may be more sensitive to changes that occur in the isoforms of VEGF Trap samples, as previously mentioned.
TABLE-US-00001 TABLE1 VEGFTrapsequence SEQID Protein Sequence NO VEGF SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSP 1 Trap NITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNAT YKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVV LSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEY PSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGV TRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPG
[0051] The following acronyms are used throughout the present disclosure: [0052] iCIEFImaging Capillary Isoelectric Focusing [0053] IEFIsoelectric Focusing [0054] pIIsoelectric point [0055] RSReference Standard [0056] DSDrug substance [0057] DSIDrug Substance Intermediate [0058] FDSFormulated Drug Substance.
[0059] The methods for analyzing charge variants of VEGF Trap generally include loading a protein sample onto a separation capillary comprising a mixture of at least a carrier ampholyte, methylcellulose, and a stabilizing additive, applying a first voltage for a first predetermined period of time such that the carrier ampholyte forms a pH gradient within the capillary, applying a second voltage for a second predetermined period of time to focus the migration of charge variants of the protein within the capillary such that the overall charge of the variants is neutral, and detecting and quantifying charge variants of the protein.
[0060] The separation capillary may be loaded with VEGF Trap at a concentration ranging from about 0.5 mg/mL to about 2 mg/mL. For example, the separation capillary may be loaded with VEGF Trap at a concentration of about 0.5 mg/mL, about 1.0 mg/mL, about 1.5 mg/mL, or about 2 mg/mL. In some embodiments, the separation capillary is loaded with VEGF Trap at a concentration of about 1.0 mg/mL.
[0061] The amount of methylcellulose in the mixture may range from about 0.01% to about 0.35%. For example, the amount of methylcellulose in the mixture may be about 0.01%, about 0.05%, about 0.10%, about 0.15%, about 0.20%, about 0.25%, about 0.30%, or about 0.35%. In some embodiments, the amount of methylcellulose in the mixture is about 0.35%.
[0062] With respect to the first voltage, it may range from approximately 1 V to approximately 3000 V. For example, the first voltage may be about 1 V, about 100 V, about 500 V, about 1000 V, about 1500 V, about 2000 V, about 2500 V, or about 3000 V. In some embodiments, the first voltage is about 1500 V.
[0063] The second voltage may also range from approximately 1 V to about 3000 V. For example, the second voltage may be about 1 V, about 100 V, about 500 V, about 1000 V, about 1500 V, about 2000 V, about 2500 V, or about 3000 V. In some embodiments, the second voltage is about 3000 V.
[0064] The first predetermined time may range from about 1 second to about 5 minutes. For example, the first predetermined time may be about 1 second, about 10 seconds, about 20 seconds, about 30 seconds, about 40 seconds, about 50 seconds, about 1 minute (60 seconds), about 1.5 minutes (90 seconds), about 2 minutes (120 seconds), about 2.5 minutes (150 seconds), about 3 minutes (180 seconds), about 3.5 minutes (210 seconds), about 4 minutes (240 seconds), about 4.5 minutes (270 seconds), or about 5 minutes (300 seconds). In some embodiments, the first predetermined time is about 1 minute (60 seconds).
[0065] The second predetermined time may range from about 1 minute to about 14 minutes. For example, the second predetermined time may be about 1 minute, about 2 minutes, about 3 minutes, about 4 minutes, about 5 minutes, about 6 minutes, about 7 minutes, about 8 minutes, about 9 minutes, about 10 minutes, about 11 minutes, about 12 minutes, about 13 minutes, or about 14 minutes. In some embodiments, the second predetermined time is about 7 minutes.
[0066] Any suitable additive may be employed in the mixture. In some embodiments, it may be beneficial to use urea as the additive. For example, 2M urea may be beneficial to include in the mixture. Various reagents (ampholytes) may also be included in the mixture, as further detailed below. In one embodiment, VEGF Trap is loaded into a capillary at a concentration of 1.0 mg/mL, and analyzed using an image capillary isoelectric focusing method that employs a mixture of 0.35% methylcellulose, 2M urea, and 3% ampholyte having a pI of 3-10.
[0067] Reagents and Equipment. Table 2 below lists reagents (ampholytes) and equipment used according to some embodiments of the present disclosure. Examples performed utilize an iCE3 (ProteinSimple) charge variant analyzer. Unless otherwise indicated, VEGF-Trap Reference Standard (RSVITV-5), was used as a test article during method development and characterization.
TABLE-US-00002 TABLE 2 Example Reagents and other components used Sample Reagent Pharmalyte 3-10 Servalyt 4-9 Servalyt 2-9 Pharmalyte 5-8 Pharmalyte 8-10.5 Pharmalyte 6.7-7.7 Biolyte 3-10, 40% Urea Methylcellulose pI marker (5.12, 7.05, 7.65) ProteinSimple iCE3
Examples
[0068] Ampholyte screening was initially performed based upon a pI range and source of ampholytes. Four ampholytes, each covering a unique pI range, were procured from three different sources. The ampholytes were analyzed using the following starting: [0069] 2.0 mg/mL protein concentration, [0070] 2 M urea, [0071] 0.35% methylcellulose, [0072] 1 minute of pre-focusing at 1500 V, and [0073] 7 minutes of focusing at 3000 V.
[0074]
[0078] Protein Selected. Ampholytes ranging from pI 3-10 were chosen as the overall profile of the iCIEF electropherogram since they most closely resembled the electropherogram from the currently approved charge variant analysis procedure for VEGF-Trap (see, e.g., IEF image shown in
[0079] Urea optimization. Method optimization, according to some embodiments, also included varying urea concentration (from absence of urea up to 8M).
[0080] Further experiments were conducted using 2 M urea to optimize the ampholyte 3-10 concentration and protein concentration.
[0081] Method Characterization. The overall charge profile and the pattern of peaks obtained using the iCIEF, assay method was comparable to the IEF band profile (as shown in
[0089] Briefly, 4.2 mg of VEGF-Trap RS was fractionated using 12 IPG strips for 32 hours; the individual fractions from each strip corresponding to the same pI range were pooled and quantified after dialysis. From the fractionation, a total of seven fractions (Fractions 4-10) which had sufficient recovery were analyzed using IEF and iCIEF. The fractions were analyzed two ways: Individual analysis of OFFGEL fractions (4-10) using IEF and iCIEF assay methods (see
TABLE-US-00003 TABLE 3 OFF GEL Protein Cone. Volume Recovered fraction No. (mg/mL) (L) 3* 1.229 15 4 1.628 98 5 1.884 104 6 2.909 113 7 3.498 124 8 3.56 124 9 3.326 124 10 2.098 110 11* 1.235 94 12* 2.574 15
[0090] In addition to analyzing the OFFGEL fractions independently using IEF and iCIEF, fractions (5-10) which yielded higher recovery were spiked at a ratio of 1:0.1 (VEGF-Trap RS: Fraction) and analyzed by the two charge variant analysis methods.
[0091] Correlation between the gel based IEF band pattern and the capillary based iCIEF peak pattern was evident from the analysis of OFFGEL fractions. From
[0092] Reporting charge variant distribution using the iCIEF method. The currently approved IEF method for VEGF-Trap charge variant distribution reports the percentage charge variance by grouping bands 3-9 in the IEF gel. The area percentages of bands 3-9 are summed and reported using, e.g., Myoglobin (an independent protein marker) as a guide to identify the band numbers based on the pI of Myoglobin. The current specification acceptance criterion (SPEC) for the IEF method is 82% (Bands 3-9).
[0093] A similar approach was adopted for the new iCIEF assay method where an independent marker from ProteinSimple, pI 7.05 Marker Cat #102226 is spiked into the iCIEF master mix (2 M urea, 0.35% Methyl Cellulose, 3% 3-10 ampholyte). The iCIEF electropherogram of the marker 7.05 spiked into the master mix is shown in
[0094] Rather than report peaks 3-9 like the IEF method, the iCIEF method (according to some embodiments) reports the charge heterogeneity of the VEGF-Trap sample in terms of percentages of charge variant isoforms grouped as Region 1 (Acidic), Region 2 (Neutral) and Region 3 (Basic). The cluster of three principal peaks (Peak numbers 5, 6 and 7) in the VEGF-Trap iCIEF electropherogram that migrate around the neutral pI range and which are the most prominent isoforms will be grouped as Region 2 (Neutral). Among the cluster of three peaks, a distinct isoform corresponding to principal peak 5 that migrates to a specific pI is identified using an independent pI 7.05 marker spiked in the blank injection as shown in
[0095] The reporting approach using the Region 1, 2 and 3 offers an advantage of allowing tighter control over the charge variant isoforms by means of monitoring three regions (Regions 1, 2 and 3) as opposed to the traditional IEF gel based method's grouping of bands 3-9.
[0096] In Table 4 (below), it can be seen that the Region 1, 2 and 3 grouping approach is much more sensitive and indicative of the changes in the charge variant distribution of the VEGF-Trap sample. The IEF method showed a change in overall charge distribution with a decrease of 2% for the bands 3-9 and this change was comparable to the results from the iCIEF assay method when grouped using the 3-9 peak approach. However, it is evident from Table 4 that for the 25 C. accelerated stressed sample of VEGF-Trap, a 5% increase in Region 1 (or acidic variants) and a concomitant decrease of around 5% for Region 3 (Basic variants) was observed using the iCIEF assay. This trend observed in the VEGF-Trap charge distribution in the iCIEF assay is an accurate reflection of the nature of changes to occur in the VEGF-Trap sample based on its structure and complexity of charge pattern attributable to its varying degree of sialylation. The increase in Acidic variants (Region 1-high degree of sialylated species) of VEGF-Trap sample using the iCIEF assay method under accelerated thermal stress is reflective of possible deamidation coupled with aggregation. On the other hand, grouping using the traditional 3-9 bands by the IEF method masks the subtle changes occurring in the VEGF-Trap charge isoforms and leaves little room to control the different charge species making it not as sensitive a method to detect the subtle changes in the charge heterogeneity of VEGF-Trap sample.
[0097] VEGF-Trap has ten glycosylation sites. The glycan chains attached to these sites are branched and each branch may or may not end with the negatively charged sugar monomer, sialic acid. The natural variation in the presence of sialic acid groups at the termini of the glycan chains leads to an ensemble of VEGF-Trap charge variant having a range in net charge. The proportion of these bands varies depending on the abundance of the charged species present. Thus the new reporting approach of grouping the various charge species based on Regions 1 (heavily sialylated), 2 (moderately sialylated) and 3 (least sialylated) makes the iCIEF assay more responsive to the changes that occur in the sialylforms of VEGF-Trap sample.
TABLE-US-00004 TABLE 4 iCIEF IEF iCIEF % % % % 3-9 % 3-9 Stress Condition R1 R2 R3 Bands Peaks VEGF 25 C. 1 month 31.90 43.09 25.01 82.94 87.48 VEGF 25 C. 3 months 33.85 43.28 22.87 82.11 87.86 VEGF 25 C. 6 months 37.25 42.47 20.28 80.42 85.15 Difference (%) 5.35 0.62 4.73 2.52 2.33
[0098] Stability Indicating Ability of the iCIEF assay method. Real time stability samples of VEGF-Trap DP sample (held at 2-8 C.) were analyzed using 7 independent time points spanning a time period of 24 months; Table 5 (below) shows the data corresponding to this study. The historical IEF data for these VEGF-Trap samples is provided for reference and compared to VEGF-Trap iCIEF data from regional grouping and 3-9 peak reporting. At the real time storage condition of 2-8 C. little to no significant change was observed for the VEGF-Trap sample based on historical IEF data, a similar trend was observed when reported using the iCIEF 3-9 peak approach.
TABLE-US-00005 TABLE 5 Real time VEGF-Trap sample analyzed using iCIEF % % % IEF iCIEF Condition Time R1 R2 R3 (% 3-9) (% 3-9) 5 C. 3 months 33.67 46.49 19.84 89.21 85.45 5 C. 6 months 32.90 47.14 19.96 87.09 85.26 5 C. 9 months 33.20 46.99 19.81 88.78 85.23 5 C. 12 months 33.71 47.05 19.24 91.37 85.12 5 C. 15 months 33.71 46.80 19.49 89.92 85.05 5 C. 18 months 33.89 47.00 19.11 88.27 85.25 5 C. 24 months 34.14 46.87 18.99 89.79 85.03
[0099]
[0100] Additional analysis using forcibly degraded VEGF-Trap DS sample was performed using the new iCIEF assay method. For this study, thermally degraded VEGF DS sample diluted and stressed at 45 C. for over a period of 15 days was analyzed at 0, 3, 9 and 15 day time points using the iCIEF method (Regional and 3-9). It is evident from Table 6 (below), that a subtle increase in acidic charge variants (Region 1) is observed for the iCIEF assay method when grouped using the Regional approach as compared to the 3-9 peak reporting at a much earlier time point for the forcibly degraded VEGF-Trap sample. While the % 3-9 reporting showed a 2% change in overall charge distribution across the 3-9 peaks, the Region 1 under the same conditions showed a 7% increase while Region 3 showed a concomitant decrease of 8% with time.
TABLE-US-00006 TABLE 6 Percentage distribution of forcibly degraded VEGF- Trap sample analyzed using iCIEF (thermal stress) iCIEF iCIEF % % % % Stress Condition R1 R2 R3 3-9 Peaks VEGF DS 45 C. Day 0 28.66 44.30 27.04 84.54 VEGF DS 45 C. Day 3 29.47 44.60 25.93 83.90 VEGF DS 45 C. Day 9 31.83 45.88 22.29 83.56 VEGF DS 45 C. Day 15 35.65 45.35 19.00 82.44 Difference (%) 6.99 1.05 8.04 2.10
[0101] Statistical analysis of the % distribution of the three regions for the VEGF-Trap stress sample was performed by comparing against the respective peak percentage for the VEGF non-stressed sample.
[0102] Based on the iCIEF assay method characterization and optimization data, assay parameters were derived and is tabulated in Table 7 (below). These method conditions were assessed for linearity, accuracy, precision and intermediate precision.
TABLE-US-00007 TABLE 7 Critical Method Parameters Derived From Development and Optimization Experiments Urea 2M Methylcellulose 0.35% ampholyte 3-10 3% VEGF-Trap 1.0 mg/mL Pre-focusing 1 min @ 1500 V Focusing 7 min @ 3000 V
[0103] iCIEF Assay Method Qualification. Linearity of iCIEF assay method. Method linearity was evaluated by a single analyst. Sample solutions were prepared using VEGF-Trap reference standard at varying protein concentrations of 0.5 mg/mL, 1.0 mg/mL, 1.5 mg/mL and 2.0 mg/mL. In this experiment, the protein concentration in the sample matrix was varied from 0.5 to 2 mg/mL while keeping other matrix components constant at 3% ampholyte 3-10 and 0.35% methylcellulose. The focusing time was also kept constant at 1+7 minutes. Table 8 summarizes the percentage distribution of Regions 1, 2 and 3 for the VEGF-Trap sample across the linear range of 0.5 to 2.0 mg/mL. The Linearity plot of concentration as a function of Area counts for the VEGF-Trap sample is provided in
TABLE-US-00008 TABLE 8 Linearity of the iCIEF assay method VEGF-Trap RS % % % (mg/mL) R1 R2 R3 0.5 29.51 46.44 24.05 0.5 29.79 46.38 23.84 1 29.66 45.88 24.46 1 30.03 45.94 24.02 1.5 30.27 45.83 23.91 1.5 29.68 45.95 24.37 2 29.54 46.31 24.15 2 29.57 46.26 24.17
[0104] The assay demonstrated acceptable linearity over a protein concentration range of 0.5 mg/mL to 2.0 mg/mL with R2>0.99 based on the regression analysis. In addition, the isoform distribution remained consistent over this same concentration range. This indicates that the assay is capable of providing consistent results in both peak area and isoform distribution over the protein concentration range of 0.5 to 2.0 mg/mL.
[0105] Accuracy of iCIEF assay method. Method accuracy was evaluated based on dilutional proportionality using the linearity data by comparing to Nominal concentration of 1.0 mg/mL. The dilutional recovery based on Linearity data is shown in Table 9 below. Percent recovery was calculated using=(Measured area percentage/Nominal area percentage)100%.
TABLE-US-00009 TABLE 9 Accuracy of the VEGF-Trap iCIEF assay based on dilutional proportionality VEGF- Trap RS % Average % Recovery (mg/mL) % R1 % R2 % R3 % R1 % R2 % R3 0.5 29.65 46.41 23.95 99.35 101.09 98.78 1 29.85 45.91 24.24 Nominal 1.5 29.98 45.89 24.14 100.44 99.96 99.59 2 29.56 46.29 24.16 99.03 100.82 99.67
[0106] The recovery based on dilutional proportionality in the range of 0.5 to 2.0 mg/mL protein concentration for the VEGF-Trap sample was within 98%-101% for the three regions.
[0107] Intermediate Precision Analysis of iCIEF method. Intermediate precision was evaluated by two separate analysts (A, B) using their respective reagent preparations and using two iCE3 charge variant analyzer instruments across four days for the VEGF-Trap RS sample. The results of the analysis are listed in Table 10 below.
TABLE-US-00010 TABLE 10 Results of Intermediate Precision analysis Analyst % Region 1 % Region 2 % Region 3 A 29.44 45.87 24.69 30.53 45.08 24.39 29.71 45.83 24.46 A 29.91 45.98 24.11 29.50 46.18 24.31 29.76 46.14 24.10 B 28.78 46.65 24.57 29.40 46.22 24.38 29.61 45.85 24.54 29.56 46.10 24.34 B 30.01 45.85 24.15 29.50 45.89 24.61 Overall 29.64 45.97 24.39 Average Std Dev 0.42 0.37 0.20 % RSD 1.40 0.80 0.81
[0108] The proposed VEGF-Trap iCIEF test method demonstrated acceptable precision when executed by different analysts using different reagent preparations. The overall % RSD was calculated and was within an RSD of 2% for all three Regions.
[0109] Robustness of iCIEF assay method. Several elements of assay method robustness were evaluated by various experiments. These experiments are listed in Table 11.
TABLE-US-00011 TABLE 11 Summary of Method Robustness Experiments Robustness Experiment Performance Evaluated Prepared solution stability Consistency of isoform distribution over 24 hours compared to time T = O Evaluation other samples of Consistency in overall profile and % ampholyte 3-10 distribution across the three Regions Evidence of stability indication Effect of stress exposure on isoform distribution
[0110] Prepared Solution Stability in machine. Solution stability was evaluated by preparing a sample of reference standard in the sample matrix and analyzing the sample using iCIEF. The sample was stored in the iCE3 instrument after analysis at 10 C. in the matrix consisting of 3% ampholyte 3-10, 0.35% methylcellulose and 2 M urea. The sample was analyzed again approximately 24 hours later. The isoform distribution for each analysis is presented below in Table 12 below.
TABLE-US-00012 TABLE 12 Results of prepared iCIEF sample Stability in machine % % % Sample Name Region 1 Region 2 Region 3 VEGF RS at time 0 injection 1 29.49 45.72 24.80 VEGF RS at time 0 injection 2 29.88 45.62 24.50 VEGF RS at time 24 hours injection 1 29.52 45.92 24.56 VEGF RS at time 24 hours injection 2 29.95 45.74 24.31 % Difference 0.46 0.30 0.49
[0111] The absolute difference between the sample analyzed at T=O and again at T=24 hours was calculated based on the range (Maximum and Minimum) observed at each time point. The absolute difference was equal to or less than 0.5% for the three Regions. This indicates the sample is stable in the matrix for up to 24 hours when stored at 10 C. in the iCE3 Charge Variant analyzer.
[0112] Evaluation of Samples of ampholyte (3-10). Several samples of the 3-10 ampholyte from one source were analyzed. The overall charge variant profile of the VEGF-Trap sample analyzed using different samples were comparable. Minor differences in electropherogram profile in terms of peak pattern were observed in Region 1 for some ampholyte samples however, the percentage distribution were similar and within assay variability. Representative electropherograms from three samples of ampholyte are shown in
ExampleAnalysis of Historical VEGF-Trap Release Samples (DS, FDS and DSI) Using the New iCIEF Assay Method
[0113] In order to further establish the robustness of the iCIEF assay method, a total of 37 unique historical VEGF-Trap samples that are not related in their genealogy were analyzed using iCIEF using two samples of ampholytes. The analysis included, 15 VEGF-Trap DSI (Drug Substance Intermediate, Aqueous buffered solution, pH 6.2, comprising 5 mM sodium phosphate, 5 mM sodium citrate and 100 mM sodium chloride), 10 VEGF-Trap DS samples (Drug substance SPEC C701, Aqueous buffered solution, pH 6.2, containing 10 mM sodium phosphate) and 12 VEGF-Trap FDS samples (Formulated Drug Substance, SPEC C713 Aqueous buffered solution, pH 6.2, comprising 10 mM, Sodium phosphate, 40 mM sodium chloride, 0.03% (w/v) polysorbate 20 and 5% (w/v) sucrose). These VEGF-Trap samples were analyzed using the iCIEF assay method.
[0114] Ampholytes are a mixture of different homologues of amphoteric compounds with a spectrum of isoelectric points between 3 and 10 that help establish the pH gradient under the influence of the electric field. The ampholyte 3-10 used in the iCIEF assay method was purchased from one source which are typically produced in batches. Based on the recommendation from the vendor together with our working knowledge on the iCIEF assay for other proteins, slight variations between the different samples has been observed and is inevitable. Hence, in order to establish the robustness of the new iCIEF assay across the different ampholyte sample, two samples of ampholytes were analyzed. The VEGF samples from DS, DSI and FDS products stage were analyzed using the proposed Regional grouping approach (R1, R2 and R3) and also based on 3-9 peak grouping similar to the IEF assay method.
TABLE-US-00013 TABLE 13 Historical VEGF-Trap DSI, DS and FDS Samples analyzed using iCIEF assay procedure VEGF- Trap DSI % % % % 3 to Sample R1 R2 R3 9 peaks 1 29.7 43.6 26.7 82.7 2 28.5 43.6 28.0 83.5 3 28.0 44.3 27.7 84.2 4 28.1 44.2 27.8 83.9 5 28.7 44.9 26.4 84.6 6 27.6 44.2 28.2 84.0 7 23.7 41.8 34.6 81.7 8 26.8 43.1 30.1 82.9 9 28.5 45.2 26.4 85.0 10 27.2 44.1 28.7 84.0 11 28.5 45.2 26.4 85.0 12 27.9 44.3 27.8 84.4 13 28.0 43.7 28.3 83.7 14 27.8 42.9 29.3 83.3 15 29.2 44.7 26.1 84.3 16 29.0 44.0 27.0 84.2 17 28.9 43.7 27.4 83.8 18 30.6 44.3 25.1 84.1 19 29.7 43.9 26.4 83.8 20 29.9 43.7 26.4 83.3 21 29.1 43.9 27.1 84.1 22 27.1 44.8 28.1 85.3 23 30.4 44.7 24.9 84.8 24 28.3 43.7 28.1 83.2 25 27.3 43.3 29.5 83.2 26 28.0 42.3 29.6 81.8 27 27.2 45.2 27.6 85.8 28 30.1 43.4 26.5 84.1 29 29.2 44.1 26.7 84.0 30 29.8 43.4 26.8 83.3 31 29.7 44.7 25.7 84.6 32 32.3 45.3 22.4 84.5 33 33.4 44.4 22.2 83.8 34 33.6 45.2 21.1 84.5 35 31.0 45.2 23.8 85.3 36 33.8 42.1 24.1 81.3 37 29.2 42.2 28.6 82.2 38 28.2 41.9 29.9 81.8 39 28.7 42.9 28.4 82.8
TABLE-US-00014 TABLE 14 DSI lots analyzed by Pharmalyte Samples VEGF-Trap % % % % 3 to 9 DSI Samples R1 R2 R3 peaks 1 30.2 43.1 26.7 87.9 2 27.8 44.4 27.8 88.8 3 28.0 44.5 27.6 88.9 4 27.9 44.4 27.8 88.7 5 28.8 44.8 26.4 85.3 6 27.5 44.3 28.2 87.1 7 23.7 41.4 34.9 89.7 8 26.9 42.9 30.2 88.4 9 28.5 45.1 26.4 89.3 10 27.6 43.9 28.4 88.7 11 28.3 44.9 26.8 88.3 12 28.1 44.6 27.3 87.8 13 28.2 43.7 28.1 87.8 14 27.6 43.5 28.9 87.9 15 29.3 44.7 26.0 89.2
TABLE-US-00015 TABLE 15 DS lots analyzed by Pharmalyte Samples VEGF Trap % % % % 3 to 9 DS Samples R1 R2 R3 peaks 1 28.8 44.7 26.4 89.3 2 29.4 44.3 26.3 89.2 3 29.2 44.5 26.2 88.9 4 27.3 43.4 29.2 88.2 5 29.6 44.0 26.4 88.9 6 28.3 43.8 27.9 88.8 7 26.7 45.3 28.1 89.8 8 30.2 45.1 24.7 90.1 9 30.5 44.5 25.0 89.3 10 29.1 43.9 27.0 89.3 11 27.9 42.5 29.5 87.5
TABLE-US-00016 TABLE 16 FDS lots analyzed by Pharmalyte Samples VEGF Trap % % % % 3 to 9 FDS Samples R1 R2 R3 peaks 1 27.5 45.0 27.5 90.0 2 30.0 43.5 26.5 88.7 3 29.1 43.7 27.2 89.1 4 30.2 43.0 26.7 88.4 5 29.8 44.6 25.6 89.8 6 32.5 45.4 22.1 90.3 7 33.3 44.7 22.0 89.6 8 33.6 45.4 21.0 90.9 9 30.7 45.5 23.8 90.1 10 34.2 41.7 24.2 87.2 11 29.0 42.4 28.6 87.2 12 28.4 41.3 30.3 86.5 13 28.5 42.5 29.1 87.6
[0115] A Matched Pair analysis (
[0116] However, when the VEGF-Trap data set for DS, DSI and FDS samples was analyzed using the 3-9 peaks grouping approach similar to the IEF assay method, a statistical significant difference is noticed between the some ampholyte samples. For example, between some samples, a mean difference as high as 4.8% when reported in terms of peaks 3-9 for the iCIEF assay method.
[0117] The data from the DSI, DS and FDS sample analysis using the ampholyte samples based on % Regions 1, 2 and 3 grouping makes the iCIEF assay a more robust assay method.
[0118] Accordingly, the iCIEF system, methods and devices presented in this disclosure quantify the charge variant profile of VEGF-Trap drug substance, drug substance intermediate, formulated drug substance, and drug product. Such embodiments may serve to replace the currently approved gel based IEF method for charge heterogeneity analysis of VEGF-Trap.
[0119] The VEGF-Trap charge variants fractionated using OFFGEL 3100 fractionator enabled demonstration of a correlation between the peaks obtained in the capillary based iCIEF assay method to the bands resolved in the gel based IEF assay procedure. By analyzing the OFFEGEL electrophoresed VEGF-Trap fractions individually and through spike in studies a direct comparison of individual iCIEF peaks to IEF bands of the VEGF-Trap charge variants was achieved. The studies confirmed that the new iCIEF assay procedure is capable of resolving all the charge variant isoforms previously resolved using the gel based IEF method with equal and a more precise manner.
[0120] Accordingly, some embodiments of this reporting approach based on percentage distribution of Regions 1, 2 and 3 disclosed herein allow for control over all VEGF-Trap isoforms and makes the assay more sensitive, enabling it to be a robust stability indicating assay.
[0121] Capillary tubes for use with the iCEF methods are also described herein. In general, the iCIEF capillary tube is configured for use in a charge variant analysis of VEGF-Trap and includes a capillary tube configured to receive a protein, and configured with a mixture of carrier ampholyte, methylcellulose, and a stabilizing additive. The capillary tube may also include a fluorocarbon coating.
[0122] In some embodiments, an iCIEF kit configured for use in a charge variant analysis of VEGF-Trap is provided and includes one or more capillary tubes configured to receive a protein, and configured with a mixture of carrier ampholyte, methylcellulose, and a stabilizing additive, wherein the capillary tube includes a fluorocarbon coating.
[0123] While various inventive embodiments have been described and illustrated herein, those of ordinary skill in the art will readily envision a variety of other means and/or structures for performing the function and/or obtaining the results and/or one or more of the advantages described herein, and each of such variations and/or modifications is deemed to be within the scope of the inventive embodiments described herein. More generally, those skilled in the art will readily appreciate that all parameters, amounts, percentages, concentrations, dimensions, materials, and configurations described herein are meant to be an example and that the actual parameters, amounts, percentages, concentrations, dimensions, materials, and/or configurations will depend upon the specific application or applications for which the inventive teachings is/are used. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific inventive embodiments described herein. It is, therefore, to be understood that the foregoing embodiments are presented by way of example only. Inventive embodiments disclosed herein may be practiced otherwise than as specifically described and claimed. Inventive embodiments of the present disclosure also include individual features, system, article, material, kit, and methods described herein. In addition, any combination of two or more such features, systems, articles, materials, kits, and methods are also inventive (if such are not mutually inconsistent). Some embodiments may be distinguishable from the prior art for specifically lacking one or more features/elements/functionality (i.e., claims directed to such embodiments may include negative limitations).
[0124] In addition, as noted, various inventive concepts may be embodied as one or more methods. The acts performed as part of the method may be ordered in any suitable way. Accordingly, embodiments may be constructed in which acts are performed in an order different than illustrated, which may include performing some acts simultaneously, even though shown as sequential acts in illustrative embodiments.
[0125] Any and all references to publications or other documents presented anywhere in the present application, are herein incorporated by reference in their entirety. Moreover, all definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms.