DNA-replication associated (Rep) protein antibody
12534523 · 2026-01-27
Assignee
Inventors
- Harald Zur Hausen (Waldmichelbach, DE)
- Ethel-Michele De Villiers-Zur Hausen (Waldmichelbach, DE)
- Timo BUND (Dossenheim, DE)
- Sebastian Eilebrecht (Eslohe, DE)
Cpc classification
G01N33/53
PHYSICS
G01N33/564
PHYSICS
G01N33/577
PHYSICS
International classification
G01N33/50
PHYSICS
G01N33/53
PHYSICS
G01N33/564
PHYSICS
G01N33/577
PHYSICS
Abstract
Disclosed is a method of diagnosing multiple sclerosis (MS), wherein a blood sample from a patient is incubated with a DNA-replication associated (REP) protein. The present invention relates to a DNA-replication-associated (Rep) protein for use in the diagnosis of multiple sclerosis (MS), wherein (a) Aan increased amount of Rep protein or fragments thereof in the sample as compared to an amount in a control sample; or an increased amount of anti-Rep protein antibodies with antigen in a sample from a subject as compared to an amount in a control sample correlates with a diagnosis of MS, wherein the Rep protein is MSBI1 Rep or MSBI2 Rep.
Claims
1. An anti-Rep antibody produced by hybridoma MSBI1 381-6-2 (DSM ACC3329).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The following detailed description, given by way of example, but not intended to limit the invention solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings.
(2)
(3)
DETAILED DESCRIPTION OF THE INVENTION
(4) The invention provides diagnostic screening assays for the presence of anti-Rep antibodies as pathogenic markers. Samples containing increased amounts of anti-Rep antibodies indicate that the corresponding subject was definitely exposed to Rep-related protein or himself expressed Rep protein during a time period long enough to induce a Rep protein specific immune response. With such screening assays a diagnosis, prognosis and monitoring of MS based on the quantification of anti-Rep antibodies can be conducted. In alternative embodiments Rep protein may be directly detected and quantified in samples by anti-Rep antibodies.
(5) Rep protein as used herein refers to a DNA-replication-associated protein (RepB). The Rep protein may comprise DNA binding activity and could be essential for initiation of replication of episomal/viral DNA molecules. In general Rep protein refers to a Rep protein from the group of the Small Sphinx Genome (Whitley et al., 2014). In particular, the Rep protein is a MSBI1 genome-encoded Rep protein (MSBI1 Rep), a MSBI2 genome-encoded Rep protein (MSBI2 Rep), a CMI1 genome-encoded Rep protein (CMI1 Rep), a CMI2 genome-encoded Rep protein (CMI2 Rep) or CMI3 genome-encoded Rep protein (CMI3 Rep). Preferably, the MSBI1 Rep protein is encoded by MSBI1.176 deposited in the EMBL databank under the acc. no. LK931491 and has the amino acid sequence as depicted in SEQ ID NO:1 or the Rep protein is MSBI2 encoded by MSBI2.176 deposited in the EMBL databank under the acc. no. LK931492 and has the amino acid sequence as depicted in SEQ ID NO:8 (Whitley, Gunst et al. 2014). In another preferred embodiment the CMI1 Rep protein is encoded by CMI1.252 deposited in the EMBL databank under the acc. no. LK931487 and has the amino acid sequence as depicted in SEQ ID NO:10. In another preferred embodiment the CMI2 Rep protein is encoded by CMI2.214 deposited in the EMBL databank under the acc. no. LK931488 and has the amino acid sequence as depicted in SEQ ID NO:11. In another preferred embodiment the CMI3 Rep protein is encoded by CMI3.168 deposited in the EMBL databank under the acc. no. LK931489 and has the amino acid sequence as depicted in SEQ ID NO:12. In a particular preferred embodiment the Rep protein may comprise a N-terminal region conserved among small Sphinx genomes consisting essentially of amino acids from 1 to 229 of SEQ ID NO:1 and a C-terminal variable region specific for MSBI1.176 consisting essentially from amino acids 230 to 324 of SEQ ID NO:1. The N-terminal conserved region may comprise a putative, first DNA binding domain consisting essentially of amino acids from 1 to 136 of SEQ ID NO: 1 and a second putative DNA binding domain consisting essentially of amino acids from 137 to 229 of SEQ ID NO:1.
(6) Rep protein also encompasses fragments and variants of the protein with SEQ ID NO:1 or SEQ ID NO:8 which are capable of binding an anti-Rep antibody specific for Rep protein having the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:8. Preferably, such a fragment is an immunogenic fragment of the protein having the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:8 which encompasses at least one epitope for an anti-Rep protein antibody against the Rep protein of SEQ ID NO:1 or SEQ ID NO:8 and, preferably, may comprise at least 7, 8, 9, 10, 15, 20, 25 or 50 contiguous amino acids. In particular embodiments the fragment may comprise or consists essentially of a domain of the Rep protein, for example, the N-terminal conserved region, the C-terminal variable region, the first or second DNA binding domain. A variant of the protein with SEQ ID NO:1 or SEQ ID NO:8 may comprise one or more amino acid deletions, substitutions or additions compared to SEQ ID NO:1 and has a homology of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:8, wherein the variant is capable of binding an anti-Rep antibody specific for a Rep protein having the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:8. Included within the definition of variant are, for example, polypeptides containing one or more analogues of an amino acid (including, for example, unnatural amino acids, peptide nucleic acid (PNA), etc.), polypeptides with substituted linkages, as well as other modifications known in the art, both naturally occurring and non-naturally occurring. The term Rep protein includes fusion proteins with a heterologous amino acid sequence, with a leader sequence or with a Tag-sequence and the like. In certain embodiments of the invention protein tags are genetically grafted onto the Rep protein described above, for example the Rep protein selected from the group consisting of MSBI1, MSBI2, CMI1, CMI2 or CMI3. In particular at least one protein tag is attached to a polypeptide consisting of an amino acid sequence as depicted in any one of SEQ ID NOs:1-3,8-12,14. Such protein tags may be removable by chemical agents or by enzymatic means. Examples of protein tags are affinity or chromatography tags for purification. For example the Rep protein may be fused to a Tag-sequence, for example, selected from the group consisting of His6-Tag (SEQ ID NO:4), T7-Tag (SEQ ID NO:5), FLAG-Tag (SEQ ID NO:6) and Strep-II-Tag (SEQ ID NO:7). a His-Tag (SEQ ID No:4), a T7-Tag (SEQ ID NO:5), FLAG-Tag (SEQ ID NO:6) or StrepII-Tag (SEQ ID NO:7). Further, fluorescence tags such as green fluorescence protein (GFP) or its variants may be attached to a Rep-protein according to the invention.
(7) In a particular preferred embodiment the MSBI1 genome-encoded Rep protein (MSBI1 Rep) is codon-optimized for the production in human cell lines (e.g. HEK-293, HEK293TT, HEK293T, HEK293FT, HaCaT, HeLa, SiHa, CaSki, HDMEC, L1236, L428, BJAB, MCF7, Colo678, any primary cell lines) as well as bovine (e.g. MAC-T) or murine cell lines (e.g. GT1-7). As regards codon optimization, the nucleotide sequences that encode the antigens can be designed to employ codons that are used in the genes of the subject in which the antigen is to be produced. In a preferred embodiment, the codons used are humanized codons. Such codon usage provides for efficient expression of the antigens in human cells. Any suitable method of codon optimization may be used. Such methods and the selection of such methods are well known to those of skill in the art. According to the present invention, such a codon-optimized variant of the MSBI1 genome-encoded Rep protein (MSBI1 Rep) may comprise or has the sequence as depicted in SEQ ID. No.: 13 and may comprise or has the amino acid sequence as depicted in SEQ ID. No.: 14. In total, a number of 686 nucleotides of the 927 nucleotide MSBI1 Rep gene encoding for the Rep protein (from start to stop codon) were substituted to improve codon usage. A perfect codon usage with optimal adaptation towards e.g. the human codon usage is described by a codon adaptation index (CAI) of 1 indicating that all codons are optimized for human expression. For the original MSBI1-encoded Rep gene, a CAI of 0.67 for the human system was calculated, which is far below the a CAI of 0.8, which is considered as the lower threshold for good codon adaptation. After codon optimization of the MSBI1 rep gene, a CAI of 0.94 was calculated for the optimized DNA indicating an almost optimal codon adaptation for the human system. Especially, a number of 18 very rarely used codons were modified, most of them representing codons coding for leucine with a very low usage frequency (<10%) in the human system. A sequence alignment of the codon-optimized MSBI1 sequence of SEQ ID NO:13 vs. the wild-type MSBI1 sequence of SEQ ID NO:15 is shown in Table A.
(8) TABLE-US-00001 TABLEA Sequencealignmentofthecodon-optimizedMSBI1sequencevs.thewild- typeMSBI1sequence Sequence optimized alignmentofthe ATGAGCGACCTGATCGTGAAAGACAATGCCCTGATGAACGCCTCCTACAACCTGGCACTG codon-optimized original MSBI1sequence ATGAGCGATTTAATAGTAAAAGATAACGCCCTAATGAATGCTAGTTATAACTTAGCTTTG (SEQIDNO:13, ******************************** top)vs.thewild- ********** typeMSBI1 optimized sequence(SEQ GTCGAACAGAGACTGATTCTGCTGGCTATCATCGAGGCAAGGGAGACCGGCAAGGGCATC IDNO:15, original bottom) GTTGAACAGAGGTTAATTCTATTAGCAATCATAGAAGCGAGAGAAACAGGCAAAGGGATT ******************************** *********** optimized AACGCCAATGACCCCCTGACAGTGCACGCCAGCTCCTACATCAACCAGTTTAATGTGGAG original AATGCCAATGATCCTTTAACAGTTCATGCAAGTAGCTATATCAATCAATTTAACGTAGAA ******************************** *********** optimized CGCCACACCGCCTATCAGGCCCTGAAGGACGCCTGCAAGGATCTGTTTGCCCGGCAGTTC original AGGCATACGGCATATCAAGCCCTCAAAGATGCTTGTAAAGACTTGTTTGCCCGTCAATTC ***************************** *************** optimized AGCTACCAGGAGAAGCGGGAGAGAGGCAGGATCAACATCACAAGCAGATGGGTGTCCCAG original AGTTACCAAGAAAAGCGAGAACGAGGACGAATTAATATTACAAGTCGATGGGTTTCGCAA ******************************** *********** optimized ATCGGCTATATGGACGATACCGCCACAGTGGAGATCATCTTTGCACCAGCAGTGGTGCCT original ATTGGCTATATGGACGATACAGCAACCGTTGAGATTATTTTTGCCCCTGCGGTTGTTCCT **************************************** *********** optimized CTGATCACCAGGCTGGAGGAGCAGTTCACACAGTACGACATCGAGCAGATCTCCGGACTG original CTGATTACACGGCTAGAGGAACAGTTCACCCAGTACGATATTGAGCAAATTAGCGGTTTA ********************************** *********** optimized TCTAGCGCCTACGCCGTGCGCATGTATGAGCTGCTGATCTGTTGGCGGTCTACCGGCAAG original TCGAGTGCATATGCTGTTCGTATGTACGAACTGCTGATTTGTTGGCGTAGCACAGGCAAA ***************************** *************** optimized ACACCTATCATCGAGCTGGATGAGTTCCGCAAGCGGATCGGCGTGCTGGACACCGAGTAC original ACACCAATTATTGAGCTAGACGAGTTTAGAAAGCGAATAGGTGTTTTAGATACTGAATAC ********************************* ********** optimized ACCAGAACAGATAACCTGAAGATGAGAGTGATCGAGCTGGCCCTGAAGCAGATCAATGAG original ACTAGAACAGATAATTTAAAGATGCGAGTTATTGAATTAGCCCTAAAACAAATCAACGAA ********************************** *********** optimized CACACCGATATCACAGCCTCTTATGAGCAGCACAAGAAGGGCCGCGTGATCACCGGCTTC original CATACAGACATCACAGCAAGCTATGAACAACACAAAAAAGGGCGAGTGATTACAGGATTC ******************************** ************ optimized AGCTTTAAGTTCAAGCACAAGAAGCAGAACTCTGACAAGACACCAAAGAATAGCGATTCC original TCATTCAAGTTTAAGCACAAGAAACAAAACAGCGATAAAACGCCAAAAAATAGCGATTCT ***************************** **************** optimized TCTCCCCGGATCGTGAAGCACAGCCAGATCCCTACCAACATCGTGAAGCAGCCAGAGAAT original AGCCCACGTATCGTAAAACATAGTCAAATCCCTACCAACATTGTAAAACAGCCTGAAAAC ********************************* *********** optimized GCCAAGATGTCCGACCTGGAGCACAGGGCATCTAGGGTGACAGGCGAGATCATGAGAAAT original GCCAAAATGAGCGATTTAGAACATAGAGCGAGCCGTGTTACAGGGGAAATAATGCGAAAT **************************** ************ optimized AGGCTGAGCGATCGGTTCAAGCAGGGCGACGAGTCCGCCATCGATATGATGAAGAGAATC original CGTCTGTCAGATCGGTTTAAACAAGGCGATGAATCAGCAATCGACATGATGAAACGTATT ******************************** *********** optimized CAGTCCGAGATCATCACCGACGCCATCGCCGATCAGTGGGAATCTAAACTGGAAGAGTTT original CAAAGTGAAATAATAACCGATGCAATAGCAGACCAGTGGGAAAGCAAACTGGAGGAGTTT ****************************** ************** optimizedGGAGTCGTGTTTGGAGCACATCACCATCATCATCACTGA originalGGCGTGGTTTTTTAG------------------------ *********
(9) The Rep protein of the invention, including the Rep fragments and Rep variants as defined above, can be prepared by classical chemical synthesis. The synthesis can be carried out in homogeneous solution or in solid phase. The polypeptides according to this invention can also be prepared by means of recombinant DNA techniques. An example for producing and purification of a Rep protein according to the invention is shown in Example 1.
(10) Subject as used herein refers to a mammalian individual or patient, including murines, cattle, for example bovines, simians and humans. Preferably, the subject is a human patient.
(11) Sample as used herein refers to a biological sample encompassing liquid and solid samples. Liquid samples encompass blood liquids such as, for example, sera, plasma and cerebrospinal fluid (CSF). Solid samples encompass tissue samples such as tissue cultures or biopsy specimen.
(12) Correlates with as used herein refers to an amount, i.e. level or titer, of anti-Rep antibodies and Rep protein, respectively, with a significant correlation with a disease status of, for example, MS. The correlation is determined by detecting the extent of difference in the amount present in a sample from a subject to be tested and a control sample. Control sample means a single sample or an average of various, i.e. more than two, control samples. The control is taken from a healthy individual who has not been diagnosed for MS. Alternatively, the correlation may be theoretically determined by detecting the extent of difference in the amount present in a sample for a subject to be tested with a predetermined cut-off value. A cut-off value is a reference value with statistically significant separation between different disease status, e.g. between healthy and diseased status. The cut-off value can be determined by statistical analysis of a sufficiently large panel of test samples from patients with disease history and samples from healthy test group by statistical tests known in the art.
(13) In certain embodiments a diagnosis, for example of MS, is indicated by an at least 2 fold, 3 fold, 4 fold, 5 fold, 10 fold, 50 fold, 100 fold, 500 fold or 1000 fold increased amount of protein, i.e. Rep protein and anti-Rep-antibodies, respectively, in the sample from the subject as compared to a control sample.
(14) Anti-Rep antibody as used herein refers to an antibody binding at a detectable level to Rep protein in the methods of the invention which affinity is more strongly to the Rep protein of the invention than to a non-Rep protein. Preferably, the antigen affinity for Rep protein is at least 2 fold larger than background binding. In particular the anti-Rep antibody is specific for the MSBI1 Rep having the amino acid sequence of SEQ ID NO:1 or MSBI2 Rep. In particular embodiments the antibody is cross-specific for MSBI1 Rep, MSBI2 Rep, CMI1 Rep, CMI2 Rep and/or CMI3 Rep. In certain embodiments the anti-Rep antibody is cross-specific for for at least two, preferably all, off MSBI1 Rep, MSBI2 Rep, CMI1 Rep, CMI2 Rep and/or CMI3 Rep and binds to an epitope within amino acids from 1 to 136 of SEQ ID NO: 1.
(15) A common feature of all assays is that the Rep protein is contacted with a sample suspected of containing anti-Rep protein antibodies under conditions that permit the Rep protein to bind to any such antibody present in the sample. Such conditions will typically be physiologic temperature, pH and ionic strength using an excess of Rep protein. The incubation of the Rep protein with the sample is followed by detection of immune complexes comprised of the antigen. In certain embodiments either the Rep protein is coupled to a signal generating compound, e.g. detectable label, or an additional binding agent, e.g. secondary anti-human antibody, coupled to a signal generating compound is used for detecting the immune complex.
(16) Anti-Rep antibodies can be detected and quantified in assays based on Rep protein as protein antigen, which serves as target for the mammalian, e.g. human, antibodies suspected in the sample. Preferably, the Rep protein is purified (e.g. see Example 1) and the samples can be, for example, serum or plasma samples. The methods include immobilization of Rep protein on a matrix followed by incubation of the immobilized Rep protein with the samples. Finally, the Rep-bound antibodies of the formed immunological complex between Rep protein and antibodies of the samples are quantified by a detection binding agent coupled to a signal generating compound, e.g. secondary HRP-(horseradish-peroxidase)-coupled detection antibody allowing for HRP-substrate based quantification. This signal generating compound or label is in itself detectable or may be reacted with an additional compound to generate a detectable product.
(17) In other embodiments anti-Rep antibodies are indirectly quantified in that first the antibodies of the sample are immobilized on a matrix, followed by incubation with a defined amount of Rep protein which may be labelled or comprise a Tag protein, wherein the anti-Rep antibodies immobilized and present on the matrix capture the Rep protein from the protein-sample liquid mixture, followed by quantification of the bound Rep protein.
(18) In other embodiments Rep protein can be expressed in cells and these cells are incubated with the sample. Thereafter, anti-Rep antibodies from the sample bound to the Rep protein expressed by cells are detected and quantified.
(19) Design of the immunoassay is subject to a great deal of variation, and many formats are known in the art. Protocols may, for example, use solid supports, or immunoprecipitation. Most assays involve the use of binding agents coupled to signal generating compounds, for example labelled antibody or labelled Rep protein; the labels may be, for example, enzymatic, fluorescent, chemiluminescent, radioactive, or dye molecules. Assays which amplify the signals from the immune complex are also known; examples of which are assays which utilize biotin and avidin or streptavidin, and enzyme-labeled and mediated immunoassays, such as ELISA assays.
(20) The immunoassay may be in a heterogeneous or in a homogeneous format, and of a standard or competitive type. In a heterogeneous format, the polypeptide (Rep protein or anti-Rep antibody) is typically bound to a solid matrix or support or carrier to facilitate separation of the sample from the polypeptide after incubation. Examples of solid supports that can be used are nitrocellulose (e.g., in membrane or microtiter well form), polyvinyl chloride (e.g., in sheets or microtiter wells), polystyrene latex (e.g., in beads or microtiter plates, polyvinylidine fluoride (known as Immunolon), diazotized paper, nylon membranes, activated beads, and Protein A beads. The solid support containing the antigenic polypeptides is typically washed after separating it from the test sample, and prior to detection of bound anti-Rep antibodies. Both standard and competitive formats are known in the art.
(21) In a homogeneous format, the test sample is incubated with the Rep protein in solution. For example, it may be under conditions that will precipitate any Rep protein-antibody complexes which are formed. Both standard and competitive formats for these assays are known in the art.
(22) In a standard format, the amount of anti-Rep antibodies in the antibody-Rep protein complexes is directly monitored. This may be accomplished by determining whether (labelled) anti-xenogeneic (e.g. anti-human) antibodies which recognize an epitope on anti-Rep antibodies will bind due to complex formation. In a competitive format, the amount of anti-Rep antibodies in the sample is deduced by monitoring the competitive effect on the binding of a known amount of labelled antibody (or other competing ligand) in the complex.
(23) Complexes formed which may comprise anti-Rep antibody (or in the case of competitive assays, the amount of competing antibody) are detected by any of a number of known techniques, depending on the format. For example, unlabeled anti-Rep antibodies in the complex may be detected using a conjugate of anti-xenogeneic Ig complexed with a label (e.g. an enzyme label, such as, for example, HRP).
(24) In an immunoprecipitation or agglutination assay format the reaction between the Rep protein and the anti-Rep antibody forms a network that precipitates from the solution or suspension and forms a visible layer or film of precipitate. If no anti-Rep antibody is present in the sample, no visible precipitate is formed.
(25) The solid phase selected can include polymeric or glass beads, nitrocellulose, microparticles, microwells of a reaction tray, test tubes and magnetic beads. The signal generating compound can include an enzyme, a luminescent compound, a chromogen, a radioactive element and a chemiluminescent compound. Examples of enzymes include alkaline phosphatase, horseradish peroxidase (HRP) and beta-galactosidase. Examples of enhancer compounds include biotin, anti-biotin and avidin. Examples of enhancer compounds binding members include biotin, anti-biotin and avidin.
(26) In further embodiments the invention provides methods wherein an increased amount of Rep protein in a sample correlates with a diagnosis or predisposition of a neurodegenerative disease, for example MS, or is used for monitoring the disease, for example MS, or monitoring the treatment of the disease, for example MS. In such embodiments the Rep protein in the sample is detected by anti-Rep antibodies.
(27) Such methods may comprise the steps of detecting the amount of Rep protein in a sample from a subject by anti-Rep antibodies; and correlating the amount of Rep protein detected in the sample from a subject in step (a) as compared to an amount in a control sample with a diagnosis of a neurodegenerative disease, for example MS.
(28) Examples for assays which can be used in such methods for the detection of Rep protein in serum or plasma samples include, but are not limited to immunoprecipitation, immunofluoresence, dot blotting and Western Blot.
(29) For example, a serum sample may be incubated with anti-Rep protein antibodies to capture the Rep protein in the sample, followed by a step of immunoprecipitation of Rep protein and, thereafter, a step of detection by SDS-PAGE and Western Blot.
(30) In a further example, a dot blot membrane may be incubated with serum, followed by the step of a SDS-PAGE and Western Blot.
(31) In a further example, serum dilutions of the sample are loaded on SDS-Page followed by a Western Blot.
(32) In further embodiments Rep protein is detected in tissue samples by immunohistochemical methods or immunofluoresence microscopy.
(33) In certain embodiments anti-Rep antibodies are used for the detection or capturing of the Rep protein in the sample.
(34) The term antibody, preferably, relates to antibodies which consist essentially of pooled polyclonal antibodies with different epitopic specificities, as well as distinct monoclonal antibody preparations. As used herein, the term antibody (Ab) or monoclonal antibody (Mab) is meant to include intact immunoglobulin molecules as well as antibody fragments (such as, for example, Fab and F(ab)2 fragments) which are capable of specifically binding to Rep protein. Fab and F(ab)2 fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding than an intact antibody. Thus, these fragments are preferred, as well as the products of a FAB or other immunoglobulin expression library. Moreover, antibodies useful for the purposes of the present invention include chimeric, single chain, multifunctional (e.g. bispecific) and humanized antibodies or human antibodies.
(35) In certain embodiments the antibody or antigen binding fragment thereof is coupled to a signal generating compound, e.g., carries a detectable label. The antibody or antigen binding fragment thereof can be directly or indirectly detectably labeled, for example, with a radioisotope, a fluorescent compound, a bioluminescent compound, a chemiluminescent compound, a metal chelator or an enzyme. Those of ordinary skill in the art will know of other suitable labels for binding to the antibody, or will be able to ascertain such, using routine experimentation.
(36) Anti-Rep antibodies are, preferably, raised (generated) against a Rep protein having the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:8 or a fragment thereof by methods well known to those skilled in the art.
(37) In certain embodiments anti-Rep antibodies are used in the methods of the invention which are capable of binding to several or all kinds of Rep proteins from the group of the Small Sphinx Genome (anti-Small-Sphinx-like Rep antibody or anti-SSLRep antibody). Such anti-SSLRep antibody binds to an epitope within the conserved N-terminal region of the Rep protein from amino acids 1 to 229 of SEQ ID NO:1. In particular embodiments anti-Rep antibodies of the anti-SSLRep type are used which bind to an epitope within SEQ ID NO:2 (amino acids 32-49 of SEQ ID NO:1) or SEQ ID NO:3 (amino acids 197-216 of SEQ ID NO:1). The peptide fragments of SEQ ID NO:2 and SEQ ID NO:3 are highly conserved among the Rep proteins from the Small Sphinx Genome group and appear to be exposed due to their hydrophilic character. Anti-Rep antibodies of the anti-SSLRep type may be produced by immunization, for example of mice or guinea pig, by peptides consisting essentially of the amino acid sequences as depicted in SEQ ID NOs:2 or 3; or by other immunogenic fragments, preferably which may comprise at least 8-15 amino acids, derived from the conserved N-terminal Rep protein region from amino acids 1 to 229 of SEQ ID NO:1.
(38) In further embodiments anti-Rep antibodies specific for MSBI1 Rep protein are used. Such antibodies may be produced, for example, by immunization of a mammal such as mice or guinea pig with a full-length Rep protein having the amino acid sequence of SEQ ID NO:1.
(39) Preferably, the methods of the invention use anti-Rep antibodies which are capable of detecting Rep protein up to ranges from picogramm to femtogramm in different kinds of body liquids such as, for example, blood, serum, spinal fluid or cerebral fluid.
(40) In the methods of the invention either a specific kind of anti-Rep antibody or a pool of two or more different kinds of anti-Rep antibodies may be used. If a pool of different kinds of anti-Rep antibodies is used, the anti-Rep antibody pool may comprise different anti-Rep antibodies binding to different epitopes within different domains of the Rep protein, e.g. first DNA binding domain (e.g. aa 1-136 of SEQ ID NO:1), second DNA binding domain (e.g. aa 137-229 of SEQ ID NO: 2) and/or variable domain (e.g. aa 230-324 of SEQ ID NO:1), in particular, of MSBI1 Rep protein (SEQ ID NO:1).
(41) In a further embodiment anti-Rep antibodies are used for screening of probes from patients and/or healthy individuals for a Rep protein. The selective detection of a Rep protein in tissues of patients, e.g. of a neurodegenerative disease, is indicative for a causality between the isolated DNA genome of the Rep protein detected in the sample and the disease of the patient from whom the sample was derived.
(42) For the detection of a Rep protein by anti-Rep antibodies methods such as, for example, Western Blot, immunofluoresence microscopy or immunohistochemical methods may be applied.
(43) In certain embodiments anti-Rep antibodies are used which are capable of detecting a Rep protein at certain celluar localisations. For instance the anti-Rep antibody may detect the Rep protein in cytoplasm, nuclear membrane and nucleus or detect speckles in cytoplasm. Examples of such groups of anti-Rep antibodies are shown in Table 1:
(44) TABLE-US-00002 Antibody RepProtein DSMZ Group Localisation Specificity Antibody deposit Group A cytoplasm + MSBI1 + AB01 DSM nuclear small-sphinx-like 523-1-1 ACC3327 membrane (+nucleus) Group B speckles in MSBI1 + AB02 DSM cytoplasm small-sphinx-like 304-4-1 ACC3328 Group C cytoplasm + MSBI1 specific MSBI1 DSM nuclear 381-6-2 ACC3329 membrane (+nucleus) Group D speckles in MSBI1 specific D1: MSBI1 DSM cytoplasm 961-2-2 ACC3330 D2: MSBI1 761-5-1
(45) Anti-Rep antibodies of group A have an epitope within the amino acid sequence depicted in SEQ ID NO:3 (aa 198-217 of SEQ ID NO:1) and are capable of detecting MSBI1 Rep and Rep proteins which may comprise this conserved epitope of the Small Sphinx Genome group (e.g. MSBI2, CMI1, CMI4). In immunofluoresence assays such anti-Rep antibodies detect a specific Rep localisation pattern, wherein the main localisation is homogeneously distributed over the cytoplasm and nuclear membrane; and additional weak and homogeneously distributed localisation is seen in the nucleus. An example of such a group A antibody is antibody AB01 523-1-1 (DSM ACC3327) which was employed in the examples as group A antibody.
(46) Anti-Rep antibodies of group B have an epitope within the amino acid sequence depicted in SEQ ID NO:2 (aa 33-50 of SEQ ID NO:1) and are capable of detecting MSBI1 Rep and Rep proteins which may comprise this conserved epitope of the Small Sphinx Genome group (e.g. MSBI2, CMI1, CMI4). In immunofluoresence assays such anti-Rep antibodies detect specifically speckles (cytoplasmatic aggregations) of the Rep protein (often in the periphery of the nuclear membrane). An example of such a group B antibody is the antibody designated as AB02 304-4-1 (DSM ACC3328) which was employed in the examples as group B antibody.
(47) Anti-Rep antibodies of group C detect specifically a structural epitope of MSBI1 (SEQ ID NO:1). In immunofluoresence assays such anti-Rep antibodies detect a specific Rep localisation pattern, wherein the main localisation is homogeneously distributed over the cytoplasm and nuclear membrane; and additional weak and homogeneously distributed localisation is seen in the nucleus. An example of such a group C antibody is antibody MSBI1 381-6-2 (DSM ACC3329) which was employed in the examples as group C antibody.
(48) Anti-Rep antibodies of group D detect specifically a structural epitope of MSBI1 (SEQ ID NO:1), where antibody MSBI1 961-2-2 designated as D1 detects an epitope depicted in SEQ ID NO:9 (aa 281-287) in the C-terminal domain of MSBI1. Antibody MSBI1 761-5-1 (DSM ACC3328) designated as D2 detects a 3D structural epitope of MSBI1 which is exclusively accessible under in vivo conditions and is not accessible in Western Blots. In immunofluoresence assays such anti-Rep antibodies detect specifically speckles (cytoplasmatic aggregations) of the Rep protein (often in the periphery of the nuclear membrane.
(49) In certain embodiments the anti-Rep antibodies of groups A, B, C or D; or a combination of anti-Rep antibodies of at least two different groups A, B, C or D are used to determine the kind of Rep protein localisation in a probe and if such a Rep protein localisation correlates with a pathogen function. For instance, if speckles are present. In certain embodiments, i.e., methods or kits of the invention, at least one anti-Rep antibody selected from groups A and B is combined with at least one anti-Rep antibody selected from groups C and D. In particular embodiments, i.e., methods or kits of the invention, an anti-Rep antibody of group A is combined with at least one further anti-Rep antibody selected from the groups B, C, and D. For instance, an anti-Rep antibody of group A may be combined with further anti-Rep antibodies of groups C and D. Such combinations of anti-Rep antibodies of different groups increases the distinctness of the diagnostic assessment, in particular for the diagnosis of MS. These groups A, B, C or D antibodies are preferred for use in the diagnosis of MS.
(50) The following antibodies were deposited with the Deutsche Sammlung fr Mikroorganismen und Zellkulturen (DSMZ) [German Collection of Microorganisms and Cell Cultures] on Sep. 28, 2017: antibody AB01 523-1-1 under DSM ACC3327; antibody AB02 304-4-1 under DSM ACC3328; antibody MSBI1 381-6-2 under DSM ACC3329; and antibody MSBI1 761-5-1 under DSM ACC3330.
(51) Antibody MSBI1 961-2-2 has been deposited with DSMZ on Oct. 6, 2017.
(52) In further embodiments a kit for use in the diagnosis of MS is provided. The kit may include material for detecting anti-Rep antibodies and/or Rep protein together with instructions for use of the materials in assays for the diagnosis of MS. The kit may comprise one or more of the following components: a biomarker according to the invention, i.e. Rep protein and anti-Rep antibodies, e.g. antibodies of Table 1, respectively; a signal generating compound, a solid matrix for attaching a capturing agent, a diluent for the samples, a wash buffer. Signal generating compound refers to a detectable label which is either coupled to an additional binding agent capable of binding to the biomarker of the invention or directly coupled with the biomarker of the invention.
(53) Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.
(54) The present invention will be further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.
EXAMPLES
Example 1: MSBI1 Rep Protein Purification
(55) A nucleotide acid molecule encoding full-length Rep open reading frame (ORF) identified within the MSBI1 genome is cloned into an expression plasmid (pEXP5-CT, Invitrogen) enabling protein expression based on an E. coli high yield cell free in vitro translation system (Expressway Cell-Free E. coli Expression System, Invitrogen). The synthesized Rep protein having the amino acid sequence of SEQ ID NO:1 within the in vitro translation reaction is denaturated by adding 20 reaction volumes 8 M urea sample buffer pH 8.0 containing 100 mM NaH2PO4, 10 mM Tris HCl, pH 8.0, 5 mM imidazole. The Rep protein is subsequently purified under denaturating conditions (20 mM imidazole for washing and 300 mM imidazole for protein elution) based on a C-terminal His6-tag fused to the Rep protein. Quality of purification is determined by Coomassie protein staining and Western Blotting with anti-Rep protein antibodies. The Rep protein purity is densitometrically calculated and greater 95%. The purified protein is either directly used for ELISA-based serum screening or subjected to SDS-Page followed by transfer blotting onto nitrocellulose membranes for serum incubation of 1D-size-resolved Rep protein membrane stripes.
Example 2: Generation of Serum Master Plates
(56) Serum samples are first aliquoted to reduce sample freeze-thaw cycles. Then, a master plate is established by generating a 1:1 dilution of serum in PBS pH 7.2 stabilized by 0.02% (w/v) sodium azide final concentration in U-shape 96-well plate. This plate is stable for at least 2 months when stored at 4 C. and handled under sterile conditions and is used as template for further serum dilution (1:20 final dilution) prior to the individual screening experiment.
Example 3: Serum Screening by Serum Incubation of 1D-Size-Resolved Rep Protein Membrane Stripes
(57) For screening assays based on incubation of 1D-resolved Rep protein membrane stripes with serum, 20 g purified Rep protein is loaded onto Sigma Tru-PAGE 4-20% precast gels. The walls separating the gel pockets are removed before gel loading to produce one large pocket and a single pocket for a size marker. After the 1D-size resolved SDS-PAGE, the protein is transfer-blotted onto nitrocellulose membranes using a standard wet/tank transfer blot protocol. After that, the protein on the blot membrane (essentially one band of full-length Rep protein at around 40 kDa running height) is visualized with PonceauS to check transfer quality and to prepare the cutting of membrane stripes of 2 mm width and the height of the full 1D-size-resolved membrane. The stripes are then blocked 1 h with each 500 l serum-free blocking reagent (Genetex Trident universal blocking reagent). After that, serum is characterized based on two different serum dilutions. Serum incubation is performed for 14 h (overnight) at 4 C. on a linear shaking device. After that, the membrane stripes are washed with PBS-T pH7.2 0.1% polyoxyethylene sorbitan monolaurate (Tween 20) for 35 min at room temperature. Detection of Rep-specific bound human IgGs within the sera is done by incubation with an HRP-coupled goat anti-human IgG (H+L) secondary antibody for 1 h at room temperature. After three washes with PBS-T pH7.2 0.1% polyoxyethylene sorbitan monolaurate (Tween-20) for 35 min at room temperature, the stripes of each individual serum incubation are fixed with tape on a plastic foil. The foil is then incubated with ECL substrate (Biorad Clarity) to visualize bound human IgGs on a BioRad WesternBlot detection system. Signals corresponding to the amount of IgGs that specifically bind to the Rep band on the protein membrane are quantified by densitometry.
(58) The quantification of seropositive serum/plasma samples is shown in Table 2: Almost 50% of the serum samples gave very strong signals for both dilutions (1:500 and 1:2000) and only 3 of 21 were totally negative. Of the plasma controls, 7 samples gave intermediate signals at 1:500 dilution (some additional one with very low signals) while at 1:2000 dilution only 3 samples gave a very weak signal, while all the others were seronegative. All quantifications sustain the tendency that MS-serum intensities show at least a 30-fold excess of signal when compared to control plasma intensities.
(59) TABLE-US-00003 TABLE 2 Quantification of seropositive serum/plasma samples. serum dilution number of seropositive samples 1:2000 17 3 1:500 21 8 MS sera control plasma
(60) Sera/plasma with detection of Rep-specific human IgGs were counted according to signal intensity for the serum/plasma dilution of 1:500 and 1:2000 for the MS serum pool and the healthy control plasma pool (each 21 in total). Almost 50% of the serum samples gave very strong signals for both dilutions (1:500 and 1:2000) and only 3 of 21 were totally negative. Of the plasma controls, 7 samples gave intermediate signals at 1:500 dilution (some additional one with very low signals) while at 1:2000 dilution only 3 samples gave a very weak signal, while all the others were seronegative. All quantifications sustain the tendency that MS-serum intensities show at least a 30-fold excess of signal when compared to control plasma intensities.
Example 4: Serum Screening by ELISA
(61) An appropriate amount of purified Rep protein (usually between 50 and 200 ng per well) is added to a 1:1 mixture of 8 M urea pH 8.0 and PBS pH 7.2 predisposed into a Maxisorp 96-well ELISA plate (Fisher Scientific). The protein is allowed to bind to the plate matrix for 14 h at 4 C. on a linear shaking device. Then the plate is washed with PBS-T pH 7.2 0.1% polysorbate (Tween) 20 for 35 min at room temperature followed by blocking for at least 14 h at 4 C. with PBS pH 7.2 1% (w/v) BSA finally containing 0.02% sodium azide. After that the serum is added at a dilution of 1:500 and incubation is performed for 6 h at room temperature. After that, the plate is washed with PBS-T pH 7.2 0.1% polyoxyethylene sorbitan monolaurate (Tween 20) for 35 min at room temperature. Detection of Rep-specific bound human IgGs within the sera is done by incubation with an HRP-coupled goat anti-human IgG (H+L) secondary antibody for 1 h at room temperature. After three washes with PBS-T pH 7.2 0.1% polyoxyethylene sorbitan monolaurate (Tween-20) for 35 min at room temperature, 100 l TMB (3,3,5,5-tetramethylbenzidine, HRP-sensitive) substrate solution is added per well and incubated for 5 min at room temperature. The reaction is stopped by addition of 100 l 8M acetic acid/1M sulfuric acid. Signal intensity is quantified on a Perkin Elmer ELISA compatible device by measuring absorbance at 450 nm.
(62) The result of an example of a quantification of Rep-specific sero-responses based on ELISA screening is shown in
Example 5: Immunofluorescence Analysis
(63) HEK293TT cells (125.000/well) were cultured for 24 h in immunofluorescence 8-well chambers in DMEM 10% FCS (supplemented with 1 Glutamax (Gibco) and 1 non-essential amino acids (Gibco)) followed by DNA transfection with polyethylenimine (PEI) of either the control plasmid ZsGreen1CI (Clontech) expressing the auto-fluorescence marker protein ZsGreen or the same plasmid bearing the full length MSBI1 Rep ORF at the 3-prime end coding for a ZsGreen-Rep fusion protein. 48 hours after DNA transfection, cells were washed with PBS, fixed for 20 min at RT with PBS 4% PFA at RT and permeabilized with PBS 0.5% Triton X-100 for 10 min at RT on a shaking device. Cells were washed with PBS and blocking was performed with PBS 1% BSA for 45 min at RT. Incubation with the mouse monoclonal anti-Rep antibodies (c.f. Table 1) was performed for 1 h at 37 C. in PBS 1% BSA with 1:500 antibody dilutions (controls lacking primary antibodies were included). Cells were washed three times with PBS followed by incubation with PBS 1% BSA for 15 min at RT. Then, incubation with the secondary antibody (AlexaFluor546 goat anti-mouse, 1:500; DNA marker Hoechst 33342, 1:5.000) was performed for 45 min at RT in PBS 1% BSA. Cells were washed three times with PBS 1% BSA and three times with PBS prior to mounting with cover slips (Dako mounting medium). Immunofluorescence images were taken on a Zeiss Cell Observer (20 objective, fixed exposure time for sample and control dublets).
(64) Antibody treatment with group A and C antibodies lead to specific detection of cytoplam+nuclear membrane (+nucleus)-localized target protein without detection of aggregates. In contrast, group B and D antibodies showed specific colocalization with speckled protein and no to weak levels of cytoplasmatic signals. The control incubation of the antibodies on the ZsGreen fusion protein alone did not result in significant signal detection (same exposition times used for visualization of the antibody signals).
Example 6: Immunofluorescence Analysis
(65) HEK293TT cells (125.000/well) were cultured for 24 h in immunofluorescence 8-well chambers in DMEM 10% FCS (supplemented with 1 Glutamax (Gibco) and 1 non-essential amino acids (Gibco)) followed by DNA transfection with polyethylenimine (PEI) of either the control plasmid ZsGreen 1CI (Clontech) expressing the auto-fluorescence marker protein ZsGreen or the same plasmid bearing the full length CMI1 Rep ORF at the 3-prime end coding for a ZsGreen-Rep fusion protein. 48 hours after DNA transfection, cells were washed with PBS, fixed for 20 min at RT with PBS 4% PFA at RT and permeabilized with PBS 0.5% Triton X-100 for 10 min at RT on a shaking device. Cells were washed with PBS and blocking was performed with PBS 1% BSA for 45 min at RT. Incubation with the mouse monoclonal anti-Rep antibodies (Table 1) was performed for 1 h at 37 C. in PBS 1% BSA with 1:500 antibody dilutions (controls lacking primary antibodies were included). Cells were washed three times with PBS followed by incubation with PBS 1% BSA for 15 min at RT. Then, incubation with the secondary antibody (AlexaFluor546 goat anti-mouse, 1:500; DNA marker Hoechst 33342, 1:5.000) was performed for 45 min at RT in PBS 1% BSA. Cells were washed three times with PBS 1% BSA and three times with PBS prior to mounting with cover slips (Dako mounting medium). Immunofluorescence images were taken on a Zeiss Cell Observer (20 objective, fixed exposure time for sample and control dublets).
(66) While the group A antibody specifically detects cytoplasm+nuclear membrane (+nucleus)-localized target protein without detection of aggregates, group B antibody detects speckled target protein with a minimal background of cytoplasmic localized target protein. The MSBI1-specific antibodies of group C and D do not lead to specific detection of signals. Both antibodies D1 and D2 belong to the D group but have slightly different epitope recognition.
Example 7: Immunofluorescence Analysis
(67) HEK293TT cells (125.000/well) were cultured for 24 h in immunofluorescence 8-well chambers in DMEM 10% FCS (supplemented with 1 Glutamax (Gibco) and 1 non-essential amino acids (Gibco)) followed by DNA transfection with polyethylenimine (PEI) of either the control plasmid pcDNA3.1() (Invitrogen) or the same plasmid expressing a codonoptimized variant of the full length MSBI1 Rep ORF (SEQ ID. No.: 13). 48 hours after DNA transfection, cells were washed with PBS, fixed for 20 min at RT with PBS 4% PFA at RT and permeabilized with PBS 0.5% Triton X-100 for 10 min at RT on a shaking device. Cells were washed with PBS and blocking was performed with PBS 1% BSA for 45 min at RT. Incubation with the mouse monoclonal anti-Rep antibodies (Table 1) was performed for 1 h at 37 C. in PBS 1% BSA with 1:500 antibody dilutions (controls lacking primary antibodies were included). Cells were washed three times with PBS followed by incubation with PBS 1% BSA for 15 min at RT. Then, incubation with the secondary antibody (AlexaFluor488 goat anti-mouse, 1:500; DNA marker Hoechst 33342, 1:5.000) was performed for 45 min at RT in PBS 1% BSA. Cells were washed three times with PBS 1% BSA and three times with PBS prior to mounting with cover slips (Dako mounting medium). Immunofluorescence images were taken on a Zeiss Cell Observer (20 objective, fixed exposure time for sample and control dublets).
(68) Antibody treatment with group A and C antibodies lead to specific detection of cytoplam+nuclear membrane (+nucleus)-localized target protein without detection of aggregates. In contrast, group B and D antibodies showed specific colocalization with speckled protein and no to weak levels of cytoplasmatic signals. The control incubation of the antibodies on the ZsGreen fusion protein alone did not result in significant signal detection (same exposition times used for visualization of the antibody signals).
Example 8: Western Blot Analysis
(69) HEK293TT (1.5 Mio/6-well) were cultured for 24 h in 6-well cell culture plates in DMEM 10% FCS (supplemented with 1 Glutamax (Gibco) and 1 non-essential amino acids (Gibco)) followed by DNA transfection with polyethylenimine (PEI) of ZsGreen1CI plasmids coding for overexpression of the full length MSBI1, CMI1 or MSBI2 Rep protein as fusion protein with an N-terminal ZsGreen tag. 48 hours after DNA transfection, cells were washed with PBS, detached by trypsination, washed again with PBS and lysed in SDS-PAGE Lmmli buffer (boil for 5 min at 98 C.). The samples were loaded onto precast 12.5% SDS-PAGE gels with one large pocket. After transferblot, each two stripes of the membrane were cut for individual incubation of the stripes with the different mouse monoclonal antibodies of Table 1 (1:1000 dilution in PBS 5% skim milk) after blocking with PBS 5% skim milk. The stripes were washed three times with PBS 0.1% polyoxyethylene sorbitan monolaurate (Tween 20) and incubated with the HRP-coupled anti-mouse secondary antibody allowing Westernblot analysis of antibodies detecting the different ZsGreen-Rep fusion proteins on a Biorad ChemiDoc device. Positive control detection was performed based on incubation with a ZsGreen antibody (OriGene, 1:2000).
(70) While antibodies of the groups A and B specifically detected all three Rep fusion proteins, including the CMI1 and MSBI2 Rep fusion proteins in addition to the MSBI1 Rep fusion protein, the MSBI1-specific antibodies of group C and D exclusively detect the MSBI1 Rep fusion protein. Antibody D2 was WB-negative most likely due to detection of a 3D structure epitope, which was not prevailed under denaturing condition in SDS-PAGE and was not tested here.
SEQUENCE SUMMARY
(71) TABLE-US-00004 SEQ ID NO SEQUENCE 1 AminoacidsequenceofRepproteinencodedbyMSBI1.176 MSDLIVKDNALMNASYNLALVEQRLILLAIIEARETGKGINANDPLTVHASSYINQFN VERHTAYQALKDACKDLFARQFSYQEKRERGRINITSRWVSQIGYMDDT ATVEIIFAPAVVPLITRLEEQFTQYDIEQISGLSSAYAVRMYELLICWRSTGKTPII ELDEFRKRIGVLDTEYTRTDNLKMRVIELALKQINEHTDITASYEQHKKGRVIT GFSFKFKHKKQNSDKTPKNSDSSPRIVKHSQIPTNIVKQPENAKMSDLEHRASR VTGEIMRNRLSDRFKQGDESAIDMMKRIQSEIITDAIADQWESKLEEFGVVF 2 AminoacidsequenceofReppeptidefragment EARETGKGINANDPLTVH 3 AminoacidsequenceofReppeptidefragment KQINEHTDITASYEOHKKGRT 4 His-Tag(withtwoneutralstufferaminoacids) GAHHHHHH 5 T7-Tag MASMTGGQQMG 6 FLAG-Tag DYKDDDDK 7 Strep-II-Tag WSHPQFEK 8 AminoacidsequenceofRepproteinencodedbyMSBI2.176 MSKLVVKDNALMNASYNLDLVEQRLILLAIIEARESGKGINANDPLTVHA ESYINQFGVHRVTAYQALKDACDNLFARQFSYQSKSEKGNIQNHRSRWVS EIIYIDTEATVKIIFAPAIVPLITRLEEQFTKYDIEQISDLSSAYAIRLY ELLICWRSTGKTPIIGLGEFRNRVGVLDSEYHRIAHLKERVIEHSIKQIN EHTDITATYEQHKKGRTITGFSFKFKQKKPKQAEIATETPKTATNDPDTT KPLTEPQIAKYSMILCKLGSISDLSNFPDYPAFANWIGNILRNPEKADEQ IAKRIFTALKTETDYSKKN 9 MSBI.1specificepitope NRLSDRF 10 AminoacidsequenceofRepproteinencodedbyCMI1.252 MSDLIVKDNALMNASYNLALVEQRLILLAILEARETGKGINANDPLTVHASSYI NQFNVERHTAYQALKDACKDLFARQFSYQEKRERGRINITSRWVSQIGYMDDT ATVEIIFAPAVVPLITRLEEQFTQYDIEQISELSSAYAVRLYELLICWRSTGKTPII DLTEFRKRLGVLDTEYTRTDNLKMRVIELGLKQINEHTDITASYEQHKKGRTIT GFSFKFKQKKKTGAEMPKNSDSSPHIEKPSQIPANIAKQPENAKKDDLGHRASK ITGLIMSNGLADRFKRGDESVIDMMKRIKEEITTDTTADQWENKLEEFGVIFQS 11 AminoacidsequenceofRepproteinencodedbyCMI2.214 MSDLIVKDNALMNASYNLDLVEQRLILLAILEARETGKGINANDPLTVHAESYI NQFGVARQTAYQALKDACKDLFARQFSYQEKRERGRANITSRWVSQIAYIDET ATVEVIFAPAVVPLITRLEEQFTQYDIEQISGLSSAYAVRLYELLICWRSTGKTPV IELAEFRKRLGVLNDEYTRSDNFKKWIIENPIKQINEHTDITASYEQHKKGRTIT GFSFKFKQKKKTEPETPKNSDSSQRIEKPSQIPANIVKQPENANLSDLQHRASKI TGLIMSNRLSDRFKQGDESIMQMMARIQSEITTDSIADQWQSKLEEFGVVF 12 AminoacidsequenceofRepproteinencodedbyCMI3.168 MSDLIVKDNALMNASYNLALVEQRLILLAILEARETGKGINANDPLTVHASSYI NQFNVERHTAYQALKDACKDLFARQFSYQEKRERGRANITSRWVSQIAYIDET ATVEVIFAPAVVPLITRLEEQFTQYDIEQISGLSSAYAVRLYELLICWRTTGKTP VLDLTEFRKRLGVLDTEYTRTDNLKMRVIEQSLKQINKHTDITASYEQHKKGR TITGFSFKFQKKKTEPETPKNNDSGVSKPKTVEIPAEVVKQPKNTNLSDLEKR VRMITGAIAKNNLASRFQHGNESPLDMMKRIQSEITSDETADLWQNKLESMGV VF 13 DNAsequenceMSBI1Repcodon-optimized ATGAGCGACCTGATCGTGAAAGACAATGCCCTGATGAACGCCTCCTACAAC CTGGCACTGGTCGAACAGAGACTGATTCTGCTGGCTATCATCGAGGCAAGG GAGACCGGCAAGGGCATCAACGCCAATGACCCCCTGACAGTGCACGCCAG CTCCTACATCAACCAGTTTAATGTGGAGCGCCACACCGCCTATCAGGCCCT GAAGGACGCCTGCAAGGATCTGTTTGCCCGGCAGTTCAGCTACCAGGAGAA GCGGGAGAGAGGCAGGATCAACATCACAAGCAGATGGGTGTCCCAGATCG GCTATATGGACGATACCGCCACAGTGGAGATCATCTTTGCACCAGCAGTGG TGCCTCTGATCACCAGGCTGGAGGAGCAGTTCACACAGTACGACATCGAGC AGATCTCCGGACTGTCTAGCGCCTACGCCGTGCGCATGTATGACTGCTGA TCTGTTGGCGGTCTACCGGCAAGACACCTATCATCGAGCTGGATGAGTTCC GCAAGCGGATCGGCGTGCTGGACACCGAGTACACCAGAACAGATAACCTG AAGATGAGAGTGATCGAGCTGGCCCTGAAGCAGATCAATGAGCACACCGA TATCACAGCCTCTTATGAGCAGCACAAGAAGGGCCGCGTGATCACCGGCTT CAGCTTTAAGTTCAAGCACAAGAAGCAGAACTCTGACAAGACACCAAAGA ATAGCGATTCCTCTCCCCGGATCGTGAAGCACAGCCAGATCCCTACCAACA TCGTGAAGCAGCCAGAGAATGCCAAGATGTCCGACCTGGAGCACAGGGCA TCTAGGGTGACAGGCGAGATCATGAGAAATAGGCTGAGCGATCGGTTCAA GCAGGGCGACGAGTCCGCCATCGATATGATGAAGAGAATCCAGTCCGAGA TCATCACCGACGCCATCGCCGATCAGTGGGAATCTAAACTGGAAGAGTTTG GAGTCGTGTTTGGAGCACATCACCATCATCATCACTGA 14 ProteinsequenceMSBI1Repcodon-optimized MSDLIVKDNALMNASYNLALVEQRLILLAIIEARETGKGINANDPLTVHASSYI NQFNVERHTAYQALKDACKDLFARQFSYQEKRERGRINITSRWVSQIGYMDDT ATVEIIFAPAVVPLITRLEEQFTQYDIEQISGLSSAYAVRMYELLICWRSTGKTPII ELDEFRKRIGVLDTEYTRTDNLKMRVIELALKQINEHTDITASYEQHKKGRVIT GFSFKFKHKKQNSDKTPKNSDSSPRIVKHSQIPTNIVKQPENAKMSDLEHRASR VTGEIMRNRLSDRFKQGDESAIDMMKRIQSEIITDAIADQWESKLEEFGVVFGA 15 DNAsequenceMSBI1Repwild-type ATGAGCGATTTAATAGTAAAAGATAACGCCCTAATGAATGCTAGTTATAAC TTAGCTTTGGTTGAACAGAGGTTAATTCTATTAGCAATCATAGAAGCGAGA GAAACAGGCAAAGGGATTAATGCCAATGATCCTTTAACAGTTCATGCAAGT AGCTATATCAATCAATTTAACGTAGAAAGGCATACGGCATATCAAGCCCTC AAAGATGCTTGTAAAGACTTGTTTGCCCGTCAATTCAGTTACCAAGAAAAG CGAGAACGAGGACGAATTAATATTACAAGTCGATGGGTTTCGCAAATTGGC TATATGGACGATACAGCAACCGTTGAGATTATTTTTGCCCCTGCGGTTGTTC CTCTGATTACACGGCTAGAGGAACAGTTCACCCAGTACGATATTGAGCAAA TTAGCGGTTTATCGAGTGCATATGCTGTTCGTATGTACGAACTGCTGATTTG TTGGCGTAGCACAGGCAAAACACCAATTATTGAGCTAGACGAGTTTAGAAA GCGAATAGGTGTTTTAGATACTGAATACACTAGAACAGATAATTTAAAGAT GCGAGTTATTGAATTAGCCCTAAAACAAATCAACGAACATACAGACATCAC AGCAAGCTATGAACAACACAAAAAAGGGCGAGTGATTACAGGATTCTCATT CAAGTTTAAGCACAAGAAACAAAACAGCGATAAAACGCCAAAAAATAGCG ATTCTAGCCCACGTATCGTAAAACATAGTCAAATCCCTCCAACATTGTAAA ACAGCCTGAAAACGCCAAAATGAGCGATTTAGAACATAGAGCGAGCCGTG TTACAGGGGAAATAATGCGAAATCGTCTGTCAGATCGGTTTAAACAAGGCG ATGAATCAGCAATCGACATGATGAAACGTATTCAAAGTGAAATAATAACCG ATGCAATAGCAGACCAGTGGGAAAGCAAACTGGAGGAGTTTGGCGTGGTTT TTTAG
REFERENCES
(72) Funk, M., et al. (2014). Isolation of protein-associated circular DNA from healthy cattle serum. Genome Announc 2(4) Giraldo, R., et al. (2011). RepA-WH1 prionoid: a synthetic amyloid proteinopathy in a minimalist host. Prion 5(2): 60-64 Gunst, K., et al. (2014). Isolation of bacterial plasmid-related replication-associated cirular DNA from a serum sample of a multiple sclerosis patient. Genome Announc 2(4). Lamberto, I., et al. (2014). Mycovirus-like DNA virus sequences from cattle serum and human brain and serum samples from multiple sclerosis patients. Genome Announc 2(4). Manuelidis L., 2011. Nuclease resistant circular DNAs co-purify with infectivity in scrapie and CJD. J. Neurovirol. 17:131-145. Torreira, E., et al. (2015). Amyloidogenesis of bacterial prionoid RepA-WH1 recaptiulates dimer to monomer transitions of RepA in DNA replication initiation. Structure 23(1): 183-189 Whitley, C., et al. (2014). Novel replication-competent cirulara DNA molecules from healthy cattle serum and milk and multiple sclerosis-affected human brain tissue. Genome Announc 2(4).
(73) The invention is further described by the following numbered paragraphs: 1. A DNA-replication-associated (Rep) protein for use in the diagnosis of multiple sclerosis (MS), wherein (a) an at least 2-fold increased amount of Rep protein or fragments thereof in a sample from a subject as compared to an amount in a control sample; or an at least 2-fold increased amount of anti-Rep antibodies in a sample from a subject as compared to an amount in a control sample correlates with a diagnosis of MS; and (b) the Rep protein comprises (i) an amino acid sequence as depicted in SEQ ID NO:1; (ii) a fragment of SEQ ID NO:1 which is capable of binding an anti-Rep antibody specific for a protein having the amino acid sequence of SEQ ID NO 1; or (iii) an amino acid sequence having a 90% or more homology to the amino acid sequence of (i) or (ii) and is capable of binding an anti-Rep antibody specific for a protein having an amino acid sequence of SEQ ID NO:1. 2. The Rep protein of paragraph 1, wherein the fragment of SEQ ID NO:1 comprises an epitope within the amino acid sequence consisting of amino acids 1 to 229 of SEQ ID NO:1. 3. The Rep protein of paragraph 1 or 2, wherein an increased amount of Rep protein or fragments thereof or anti-Rep antibodies of at least 5-fold as compared to a control sample indicates MS. 4. The Rep-protein of paragraph 1, wherein the protein is encoded by a polynucleotide acid as depicted in SEQ ID NO:13. 5. An anti-Rep antibody selected from the group consisting of antibody AB01 523-1-1 (DSM ACC3327), antibody AB02 304-4-1 (DSM ACC3328), antibody MSBI1 381-6-2 (DSM ACC3329), antibody MSBI1 761-5-1 (DSM ACC3330) and antibody MSBI1 961-2-2. 6. Use of an anti-Rep antibody of paragraph 5 in a method of any one of paragraphs 1 to 4. 7. A method of diagnosing MS in a subject comprising the steps of (a) incubating a sample from a subject with Rep protein as defined in (b) of paragraph 1; (b) detecting the amount of antibodies in the sample from the subject forming an immunological complex with Rep protein; and (c) correlating an at least 2-fold increased amount of antibody bound to Rep protein in the sample from the subject, as compared to an amount in a control sample, with a diagnosis of MS. 8. The method of paragraph 7, wherein in step (a) the Rep protein is immobilized followed by incubating the immobilized Rep protein with the sample from the subject. 9. The method of paragraph 7, wherein in step (a) the Rep protein is expressed in cells followed by incubating the cells with the sample from the subject. 10. The method of paragraph 8 or 9, wherein in step (b) the amount of antibodies forming an immunological complex with Rep protein is quantified by a detecting binding agent coupled to a signal generating compound. 11. The method of paragraph 7, wherein in step (a) the antibodies in the sample from the subject are immobilized followed by incubating with a defined amount of Rep protein. 12. The method of any one of paragraphs 7 to 11, wherein the sample from the subject is a serum or a plasma sample. 13. A method of diagnosing MS in a patient comprising the steps of (a) detecting the amount of Rep protein in a sample from a subject by anti-Rep antibodies that bind to an epitope comprised by SEQ ID NO:2 or SEQ ID NO:3, and (b) correlating an at least 2-fold increased amount of Rep protein detected in the sample from a subject in step (a) as compared to an amount in a control sample with a diagnosis of MS. 14. The method of paragraph 13, wherein the antibody specific for Rep protein binds to an epitope that is within an amino acid sequence selected from the group consisting of amino acids from 1 to 136, from 137 to 229 and from 230 to 324 of SEQ ID NO:1. 15. The method of paragraph 13 or 14, wherein the sample from a subject is selected from the group consisting of a serum sample, plasma sample or tissue sample. 16. A kit for use in the diagnosis of MS comprising (a) a Rep protein, wherein the Rep protein comprises: (i) an amino acid sequence as depicted in SEQ ID NO:1; (ii) a fragment of SEQ ID NO:1 which is capable of binding an anti-Rep antibody with specificity for a protein having the amino acid sequence of SEQ ID NO: 1; or (iii) an amino acid sequence having a 90% or more homology to the amino acid sequence of (i) or (ii) and is capable of binding an anti-Rep antibody with specificity for a protein having the amino acid sequence of SEQ ID NO:1, (b) an anti-human antibody coupled to a detectable label and capable of binding to anti-Rep antibody with specificity for a protein having the amino acid sequence of SEQ ID NO: 1, and (c) a solid matrix suitable for immobilizing a Rep protein according to (a) or anti-Rep antibodies with specificity for a protein having the amino acid sequence of SEQ ID NO: 1 suspected in a serum or plasma sample. 17. The kit according to paragraph 16 for use in an assay selected from the group consisting of enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), enzyme immune assay (EIA), fluorescence immunoassay (FIA), luminescence immunoassay (LIA) and strip assay.
(74) Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the above paragraphs is not to be limited to particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope of the present invention.