Sparc assay
12560610 · 2026-02-24
Assignee
Inventors
- Stephanie Nina Kehlet (Frederiksberg, DK)
- Diana Øersnes-Leeming (Klampenborg, DK)
- Morten Karsdal (Kobenhavn Ø, DK)
Cpc classification
G01N33/5758
PHYSICS
G01N33/577
PHYSICS
G01N2800/52
PHYSICS
International classification
G01N33/53
PHYSICS
C07K16/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to an assay for detecting secreted proteome acidic and rich in cysteine (SPARC), and more specifically to its use in evaluating lung cancer.
Claims
1. A monoclonal antibody specifically reactive with an N-terminus amino acid sequence TABLE-US-00043 (SEQIDNO:1) LLARDFEKNY comprising the complementarity-determining regions (CDRs): TABLE-US-00044 CDR-L1: (SEQIDNO.12) RSSQSIVHSNGNTYLE, CDR-L2: (SEQIDNO.13) KVSNRFS, CDR-L3: (SEQIDNO.14) FQGSHVPLT, CDR-H1: (SEQIDNO.15) RNAMS, CDR-H2: (SEQIDNO.16) SISTSDNTYYPDSVKG, and CDR-H3: (SEQIDNO.17) GFDVGAY.
2. A method of immunoassay for detecting and/or monitoring progression of lung cancer in a patient, the method comprising: (i) contacting a patient biofluid sample with a monoclonal antibody specifically reactive with an N-terminus amino acid sequence TABLE-US-00045 (SEQIDNO:1) LLARDFEKNY, wherein the monoclonal antibody comprises the complementarity-determining regions (CDRs): TABLE-US-00046 CDR-L1: (SEQIDNO.12) RSSQSIVHSNGNTYLE, CDR-L2: (SEQIDNO.13) KVSNRFS, CDR-L3: (SEQIDNO.14) FQGSHVPLT, CDR-H1: (SEQIDNO.15) RNAMS, CDR-H2: (SEQIDNO.16) SISTSDNTYYPDSVKG, and CDR-H3: (SEQIDNO.17) GFDVGAY, (ii) determining the amount of binding between said monoclonal antibody and peptides comprising said N-terminus amino acid sequence, and (iii) correlating said amount of binding with values associated with normal healthy subjects and/or values associated with known lung cancer severity and/or values obtained from said patient at a previous time point and/or a predetermined cut-off value.
3. The method as claimed in claim 2, wherein the predetermined cut-off value is at least 9.0 ng/ml.
4. The method of claim 2, wherein the patient biofluid sample is blood, urine, synovial fluid, serum or plasma.
5. The method of claim 2, wherein the immunoassay is a competition assay or a sandwich assay.
6. The method of claim 2, wherein the immunoassay is an enzyme-linked immunosorbent assay or a radioimmunoassay.
7. A method for determining whether a patient is responding positively to a treatment for lung cancer, wherein said method comprises using the method of claim 2 to quantify the amount of peptides comprising the N-terminus amino acid sequence TABLE-US-00047 (SEQIDNO:1) LLARDFEKNY in at least two biological samples, said biological samples having been obtained from said patient at a first time point and at least one subsequent time point during a period of administration of the treatment to said patient, and wherein a reduction in the quantity of peptides comprising the N-terminus amino acid sequence TABLE-US-00048 (SEQIDNO:1) LLARDFEKNY from said first time point to said at least one subsequent time point during the period of treatment is indicative of said patient responding positively to said treatment.
8. A method of immunoassay for detecting and/or monitoring progression of idiopathic pulmonary fibrosis (IPF) in a patient, the method comprising: (i) contacting a patient biofluid sample with a monoclonal antibody specifically reactive with an N-terminus amino acid sequence TABLE-US-00049 (SEQIDNO:1) LLARDFEKNY, wherein the monoclonal antibody comprises the complementarity-determining regions (CDRs): TABLE-US-00050 CDR-L1: (SEQIDNO.12) RSSQSIVHSNGNTYLE, CDR-L2: (SEQIDNO.13) KVSNRFS, CDR-L3: (SEQIDNO.14) FQGSHVPLT, CDR-H1: (SEQIDNO.15) RNAMS, CDR-H2: (SEQIDNO.16) SISTSDNTYYPDSVKG, and CDR-H3: (SEQIDNO.17) GFDVGAY, (ii) determining the amount of binding between said monoclonal antibody and peptides comprising said N-terminus amino acid sequence, and (iii) correlating said amount of binding with values associated with normal healthy subjects and/or values associated with known IPF severity and/or values obtained from said patient at a previous time point and/or a predetermined cut-off value.
9. The method of claim 8, wherein the patient biofluid sample is blood, urine, synovial fluid, serum or plasma.
10. The method of claim 8, wherein the immunoassay is a competition assay or a sandwich assay.
11. The method of claim 8, wherein the immunoassay is an enzyme-linked immunosorbent assay or a radioimmunoassay.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2) TABLE-US-00022 (SEQIDNO:1) LLARDFEKNY,
the elongated peptide
(3) TABLE-US-00023 (ELLARDFEKNY;SEQIDNO:2),
the truncated peptide
(4) TABLE-US-00024 (LARDFEKNY;SEQIDNO:3)
a non-sense peptide
(5) TABLE-US-00025 (VPKDLPPDTT;SEQIDNO:4)
an a non-sense coating peptide
(6) TABLE-US-00026 (VPKDLPPDTT-biotin;SEQIDNO:5);
and (
(7)
(8)
DEFINITIONS
(9) As used herein the term N-terminus refers to the extremity of a polypeptide, i.e. at the N-terminal end of the polypeptide, and is not to be construed as meaning in the general direction thereof.
(10) As used herein the term monoclonal antibody refers to both whole antibodies and to fragments thereof that retain the binding specificity of the whole antibody, such as for example a Fab fragment, F(ab) 2 fragment, single chain Fv fragment, or other such fragments known to those skilled in the art. As is well known, whole antibodies typically have a Y-shaped structure of two identical pairs of polypeptide chains, each pair made up of one light and one heavy chain. The N-terminal regions of each light chain and heavy chain contain the variable region, while the C-terminal portions of each of the heavy and light chains make up the constant region. The variable region comprises three complementarity determining regions (CDRs), which are primarily responsible for antigen recognition. The constant region allows the antibody to recruit cells and molecules of the immune system. Antibody fragments retaining binding specificity comprise at least the CDRs and sufficient parts of the rest of the variable region to retain said binding specificity.
(11) In the present invention, the monoclonal antibody may comprise any constant region known in the art. Human constant light chains are classified as kappa and lambda light chains. Heavy constant chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. The IgG isotype has several subclasses, including, but not limited to IgG1, IgG2, IgG3, and IgG4. The monoclonal antibody may preferably be of the IgG isotype, including any one of IgG1, IgG2, IgG3 or IgG4.
(12) The CDR of an antibody can be determined using methods known in the art such as that described by Kabat et al.sup.19. Antibodies can be generated from B cell clones as described in the examples. The isotype of the antibody can be determined by ELISA specific for human IgM, IgG or IgA isotype, or human IgG1, IgG2, IgG3 or IgG4 subclasses. The amino acid sequence of the antibodies generated can be determined using standard techniques. For example, RNA can be isolated from the cells, and used to generate cDNA by reverse transcription. The cDNA is then subjected to PCR using primers which amplify the heavy and light chains of the antibody. For example primers specific for the leader sequence for all VH (variable heavy chain) sequences can be used together with primers that bind to a sequence located in the constant region of the isotype which has been previously determined. The light chain can be amplified using primers which bind to the 3 end of the Kappa or Lamda chain together with primers which anneal to the V kappa or V lambda leader sequence. The full length heavy and light chains can be generated and sequenced.
(13) As used herein the term ELISA (enzyme-linked immunosorbent assay) refers to an immunoassay in which the target peptide present in a sample (if any) is detected using antibodies linked to an enzyme, such as horseradish peroxidase or alkaline phosphatase. The activity of the enzyme is then assessed by incubation with a substrate generating a measurable product. The presence and/or amount of target peptide in a sample can thereby be detected and/or quantified. ELISA is a technique known to those skilled in the art.
(14) As used herein the term, the term competitive ELISA refers to a competitive enzyme-linked immunosorbent assay. In a competitive ELISA the target peptide present in a sample (if any) competes with known amount of target of peptide (which for example is bound to a fixed substrate or is labelled) for to binding an antibody, and is a technique known to the person skilled in the art.
(15) As used herein the term sandwich immunoassay refers to the use of at least two antibodies for the detection of an antigen in a sample, and is a technique known to the person skilled in the art.
(16) As used herein the term amount of binding refers to the quantification of binding between antibody and biomarker, which said quantification is determined by comparing the measured values of biomarker in the biofluid samples against a calibration curve, wherein the calibration curve is produced using standard samples of known concentration of the biomarker. In the specific assay disclosed herein which measures in biofluids the N-terminus biomarker having the N-terminus amino acid sequence LLARDFEKNY (SEQ ID NO: 1), the calibration curve is produced using standard samples of known concentration of the calibration peptide LLARDFEKNY (SEQ ID NO:1). The values measured in the biofluid samples are compared to the calibration curve to determine the actual quantity of biomarker in the sample. The present invention utilises spectrophotometric analysis to both produce the standard curve and measure the amount of binding in the biofluid samples; in the Examples set out below the method utilises HRP and TMB to produce a measurable colour intensity which is proportional to the amount of binding and which can be read by the spectrophotometer. Of course, any other suitable analytical method could also be used.
(17) As used herein the cut-off value means an amount of binding that is determined statistically to be indicative of a high likelihood of a lung cancer or IPF in a patient, in that a measured value of biomarker in a patient sample that is at or above the statistical cutoff value corresponds to at least a 70% probability, preferably at least an 80% probability, preferably at least an 85% probability, more preferably at least a 90% probability, and most preferably at least a 95% probability of the presence or likelihood of a lung cancer or IPF.
(18) As used herein the term values associated with normal healthy subjects and/or values associated with known disease severity means standardised quantities of SPARC determined by the method described supra for subjects considered to be healthy, i.e. without a lung cancer or IPF and/or standardised quantities of SPARC determined by the method described supra for subjects known to have a lung cancer or IPF of a known severity.
(19) As used herein, SPARC-M ELISA refers to the specific competitive ELISA disclosed herein which quantifies in a sample the amount peptides having the N-terminus amino acid sequence
(20) TABLE-US-00027 (SEQIDNO:1) LLARDFEKNY.
EXAMPLES
(21) The presently disclosed embodiments are described in the following Examples, which are set forth to aid in the understanding of the disclosure, and should not be construed to limit in any way the scope of the disclosure as defined in the claims which follow thereafter. The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the described embodiments, and are not intended to limit the scope of the present disclosure nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
(22) In the following examples, the following materials and methods were employed.
(23) Development of SPARC-M ELISA
(24) Selection of Peptides:
(25) The following cleavage site (1) on SPARC was previously identified by Edman degradation (14): 211HPVELLARDFEKNYNMYIFP.sub.230. To generate an antibody specific for the N-terminal of the cleavage fragment, a sequence of 10 amino acids
(26) TABLE-US-00028 (SEQIDNO:1) .sub.215LLARDFEKNY.sub.224.
(27) The sequence was blasted for homology to other human secreted extracellular matrix proteins using NPS@: Network Protein Sequence Analysis with the UniprotKB/Swiss-prot database (29). Synthetic peptides used for monoclonal antibody production and validation of the ELISA assay were purchased from Genscript (Piscataway, NJ, USA) and shown in Table 1.
(28) TABLE-US-00029 TABLE1 Syntheticpeptidesusedfordevelopmentand validationoftheSPARC-MELISAassay SEQ Peptidename Aminoacidsequence IDNO Standardpeptide LLARDFEKNY 1 Immunogenicpeptide LLARDFEKNY-GGC-KLH 6 Biotinylatedcoating LLARDFEKNY-K-biotin 7 peptide Elongatedpeptide ELLARDFEKNY 2 Truncatedpeptide LARDFEKNY 3 Non-sensestandard VPKDLPPDTT 4 peptide Non-sensecoating VPKDLPPDTT-biotin 5 peptide VonWillebrandfactor LLARDCQDHS 8 (VWF) Glucagon(GCG) LAARDFINWL 9 SPARC-likeprotein1 LLLRDFKKNY 10 (SLP1) ADAMTS15(A15) LLARDQCNLH 11
(29) The target sequence was used as the standard peptide
(30) TABLE-US-00030 (LLARDFEKNY;SEQIDNO:1).
A biotinylated peptide
(31) TABLE-US-00031 (LLARDFEKNY-K-biotin;SEQIDNO:7)
was included as a coating peptide with addition of a lysine residue to the C-terminal end to ensure biotin linking. The specificity of the antibody was tested by including an elongated standard peptide with an additional amino acid added to the N-terminal of the target peptide sequence
(32) TABLE-US-00032 (ELLARDFEKNY;SEQIDNO:2),
a truncated standard peptide with a removal of the first N-terminal amino acid
(33) TABLE-US-00033 (LARDFEKNY;SEQIDNO:3)
as well as a non-sense standard peptide
(34) TABLE-US-00034 (VPKDLPPDTT;SEQIDNO:4)
and a non-sense biotinylated coating peptide
(35) TABLE-US-00035 (VPKDLPPDTT-biotin;SEQIDNO:5)
in the assay validation. Four peptides (Von Willebrand factor, glucagon, SPARC-like protein 1 and ADAMTS15) with one amino acid mismatch compared to the first six amino acids in the target sequence were also included to further test the antibody specificity. The immunogenic peptide
(36) TABLE-US-00036 (LLARDFEKNY-GGC-KLH;SEQIDNO:6)
was generated by covalently cross-linking the standard peptide to Keyhole Limpet Hemocyanin (KLH) carrier protein using Succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate, SMCC (Thermo Scientific, Waltham, MA, USA, cat.no. 22336). Glycine and cysteine residues were added at the C-terminal end to ensure right linking of the carrier protein.
Monoclonal Antibody Production:
(37) Four to six week old Balb/C mice were immunized by subcutaneous injection of 200 L emulsified antigen containing 50 g immunogenic peptide
(38) TABLE-US-00037 (LLARDFEKNY-GGC-KLH;SEQIDNO:6)
mixed with Freund's incomplete adjuvant (Sigma-Aldrich, St. Louis, MO, USA). Consecutive immunizations were performed at 2-week intervals until stable sera titer levels were reached. The mouse with the highest titer rested for four weeks and was then boosted with 50 g immunogenic peptide in 100 L 0.9% NaCl solution intravenously. Hybridoma cells were produced by fusing spleen cells with SP2/0 myeloma cells as previously described (30). The resultant hybridoma cells were then cultured in 96-well microtiter plates and standard limited dilution was used to secure monoclonal growth. The supernatants were screened for reactivity using the biotinylated peptide
(39) TABLE-US-00038 (LLARDFEKNY-K-biotin;SEQIDNO:7)
as coating agent in the competitive immunoassays.
Clone Characterization:
(40) The reactivity of the monoclonal antibody was evaluated by displacement using human serum samples and the standard peptide
(41) TABLE-US-00039 (LLARDFEKNY;SEQIDNO:1)
in a preliminary ELISA using 10 ng/mL biotinylated coating peptide on streptavidin-coated microtiter plates (Roche, Basel, Switzerland, cat. #11940279) and the supernatant from the antibody producing monoclonal hybridoma cells. The clone with the best reactivity towards the standard peptide was purified using protein-G-columns according to the manufacturer's instructions (GE Healthcare Life Sciences, Little Chalfont, UK, cat. #17-0404-01).
(42) The antibody generated was sequenced and the CDRs determined. Total RNA was isolated from the hybridoma cells following the technical manual of RNeasy Plus Micro Kit (QIAGEN, Cat. No.: 74034). Total RNA was then reverse-transcribed into cDNA using either isotype-specific anti-sense primers or universal primers following the technical manual of SMARTScribe Reverse Transcriptase (TaKaRa, Cat. No.: 639536). Antibody fragments of heavy chain and light chain were amplified according to the standard operating procedure (SOP) of rapid amplification of cDNA ends (RACE) of GenScript. Amplified antibody fragments were cloned into a standard cloning vector separately. Colony PCR was performed to screen for clones with inserts of correct sizes. The consensus sequence was provided.
(43) The sequence of the chains are as follows (CDRs in bold; Framework sequence in Italics; Constant region underlined):
(44) TABLE-US-00040 Heavychain:Aminoacidsequence(458aa) (MouseIgG1isotype) (SEQID.NO:22) EVKLVESGGGLVKPGGSLKLSCAASGFTFSRNAMSWVRQTPEKRLEWVA SISTSDNTYYPDSVKGRFTISKDNARNILYLQMSSLRSEDTAMYYCASG FDVGAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGY FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVT CNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTI TLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRS VSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTI PPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDT DGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK. CDR-H1: (SEQIDNo.15) RNAMS CDR-H2: (SEQIDNo.16) SISTSDNTYYPDSVKG CDR-H3: (SEQIDNo.17) GFDVGAY Lightchain:Aminoacidsequence(238aa) (mouseKappaisotype) (SEQID.NO:23) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSP KLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVDTEDLGVYYCFQGSH VPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPK DINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNS YTCEATHKTSTSPIVKSFNRNEC. CDR-L1: (SEQIDNo.12) RSSQSIVHSNGNTYLE CDR-L2: (SEQIDNo.13) KVSNRFS CDR-L3: (SEQIDNo.14) FQGSHVPLT
SPARC-M ELISA Protocol:
(45) Optimal incubation-buffer, -time and -temperature, as well as the optimal concentrations of antibody and coating peptide were determined and the finalized SPARC-M competitive ELISA protocol was as follows:
(46) A 96-well streptavidin-coated microtiter plate was coated with 1.1 ng/ml biotinylated coating peptide dissolved in assay buffer (50 mM Tris-BTB, 4 g/L NaCl, pH 8.0) and incubated for 30 min. at 20 C. in darkness shaking (300 rpm). Twenty L standard peptide or pre-diluted serum (1:4) were added to appropriate wells, followed by the addition of 100 L monoclonal antibody dissolved in assay buffer to a concentration of 14 ng/ml to each well and incubated 1 hour at 20 C. in darkness shaking (300 rpm). One hundred L of goat anti-mouse POD-conjugated IgG antibody (Thermo Scientific, Waltham, MA, USA, cat. #31437) diluted 1:6000 in assay buffer was added to each well and incubated 1 hour at 20 C. in darkness shaking. All incubation steps were followed by five washes in washing buffer (20 mM Tris, 50 mM NaCl, pH 7.2). Finally, 100 L tetramethylbenzidine (TMB) (cat. 438OH, Kem-En-Tec Diagnostics, Denmark) was added to each well and the plate was incubated for 15 minutes at 20 C. in darkness shaking. The enzymatic reaction was stopped by adding 0.18 M H.sub.2SO.sub.4 and absorbance was measured at 450 nm with 650 nm as reference. A calibration curve was plotted using a 4-parameter logistic curve fit. Data were analyzed using the SoftMax Pro v.6.3 software.
(47) Technical Evaluation of the SPARC-M ELISA:
(48) To evaluate the technical performance of the SPARC-M ELISA, the following validation tests were carried out: Inter- and intra-assay variation, linearity, lower limit of detection, upper limit of detection, analyte stability (freeze/thaw and storage) and interference.
(49) The inter- and intra-assay variation was determined by ten independent runs on different days using seven quality control samples covering the detection range, with each run consisting of double-determinations of the samples. The seven quality control samples consisted of: two human serum samples and five samples with standard peptide in buffer. Intra-assay variation was calculated as the mean coefficient of variance (CV %) within plates and the inter-assay variation was calculated as the mean CV % between the ten individual runs analyzed on different days. To assess linearity of the assay, two-fold dilutions of human serum samples were performed and dilution linearity was calculated as a percentage of recovery of the un-diluted sample. The lower limit of detection (LLOD) was determined from 21 measurements using assay buffer as sample and was calculated as the mean+three standard deviations. The upper limit of detection (ULOD) was determined from ten independent runs of the highest standard peptide concentration and was calculated as the mean back-calibration calculation+three standard deviations. Analyte stability was first determined by the effect of repeated freeze/thaw of serum samples by measuring the SPARC-M level in three human serum samples in four freeze/thaw cycles. The freeze/thaw recovery was calculated with the first cycle as reference. Second, analyte stability in relation to storage was determined by a 48 hour study performed at 4 C. or 20 C. The SPARC-M level in three human serum samples was measured after 0 h, 4 h, 24 h and 48 h of storage and recovery was calculated with samples stored at 20 C. as reference. Interference was determined by adding a low/high content of hemoglobin (0.155/0.310 mM), lipemia/lipids (4.83/10.98 mM) and biotin (30/90 ng/ml) to a serum sample of known concentration. Recovery percentage was calculated with the serum sample as reference.
(50) Cleavage of SPARC In Vitro
(51) Recombinant human SPARC (PeproTech, New Jersey, USA, cat. #120-36) was reconstituted to a final concentration of 1000 g/mL in MMP-buffer (50 mM Tris-HCl, 150 mM NaCl, 10 mM CaCl2, 10 uM ZnCl, 0.05% Brij35, pH 7.5). MMP-2, MMP-8, MMP-9 and MMP-13 (Giotto, Firenze, Italy, cat. #G04MP02C, #G04MP08C, #G04MP09C, #G04MP13C) were added 1:10 (1 g MMP and 10 g SPARC). A positive control protein with known cleavage by the above proteases was included. The solutions incubated at 37 C. for 24 h. The reaction was stopped by adding 1 M EDTA to the solutions. MMP-buffer with the different proteases were included as controls. Samples were stored at 80 C. until analysis. The activity of the proteases was confirmed by silverstaining according to the manufacturer's instructions (SilverXpress, Invitrogen, cat. #LC6100) and coomassie blue (data not shown).
(52) Clinical Validation of SPARC-M
(53) Patient serum samples were obtained from the commercial vendor ProteoGenex (Culver City, CA, USA). Cohort 1 consisted of patients with lung cancer, idiopathic pulmonary fibrosis (IPF), chronic obstructive pulmonary disease (COPD) and colonoscopy-negative controls with no symptomatic or chronic disease (Table 2). Cohort 2 included 40 men and women with different stages of lung cancer, and 20 age-matched colonoscopy-negative controls with no symptomatic or chronic disease (Table 2). Appropriate Institutional Review Board/Independent Ethical Committee approved sample collection and all subjects filed informed consent.
(54) TABLE-US-00041 TABLE 2 Clinical sample overview and patients demographics Mean Gender, Mean Tumor Tumor Tumor Tumor Subject age % BMI stage stage stage stage Cohort Samples No. (range) females (range) I II III IV 1 Lung 8 61 13 cancer (47-77) patients 1 IPF 7 73 57 patients (55-81) 1 COPD 8 75 50 patients (69-82) 1 Healthy 6 55 83 controls (44-65) 2 Lung 40 62 50 25 10 10 10 10 cancer (55-66) (16-35) patients 2 Healthy 20 62 50 26 controls (60-65) (22-32)
Statistical Analysis
(55) The level of SPARC-M in serum samples was compared using unpaired, two-tailed Mann-Whitney test and Kruskal-Wallis adjusted for Dunn's multiple comparisons test. Patients were stratified according to their tumor stage and the level of SPARC-M in each group was compared using one-way ANOVA adjusted for Tukey's multiple comparisons test. D'Agostino-Pearson omnibus test was used to assess the normality of the data. The diagnostic power was investigated by the area under the receiver operating characteristics (AUROC).
(56) Graph design and statistical analyses were performed using GraphPad Prism version 7 (GraphPad Software, Inc., CA, USA).
(57) Results
(58) Specificity of the SPARC-M ELISA Assay
(59) The target sequence, LLARDFEKNY (SEQ ID NO:1), was blasted for homology to other human secreted extracellular matrix proteins using NPS@: Network Protein Sequence Analysis with the UniprotKB/Swiss-prot database. The target sequence was found to be unique to human SPARC when compared to other secreted ECM proteins. Allowing one amino acid mismatch, four secreted extracellular matrix proteins, Von Willebrand factor, glucagon, SPARC-like protein 1 and ADAMTS15, were identified with mismatches at the 6.sup.th, 2.sup.nd, 3.sup.rd and 6.sup.th position, respectively (Table 1). There was no reactivity against the sequence of the four peptides (
(60) Technical Evaluation of the SPARC-M ELISA Assay
(61) The technical performance of the SPARC-M ELISA assay was further evaluated according to inter- and intra-assay variation, linearity, lower limit of detection, upper limit of detection, analyte stability (freeze/thaw and storage) and interference. The different validation steps and SPARC-M performance are shown in Table 3.
(62) TABLE-US-00042 TABLE 3 Technical validation data of the SPARC-M ELISA assay Technical validation step SPARC-M performance Detection range (LLOD-ULOD) 2.7-300.7 ng/ml Intra-assay variation 6% Inter-assay variation 10% Dilution of serum samples 1:4 Dilution recovery (1:4 pre-dilution) 96% (77-102%) Freeze/thaw recovery (4 cycles) 92% (86-103%) Analyte stability up to 48 h, 4 C. 88% (84-96%) and 4 h, 20 C. Interference Lipids, low/high 96%/97% Interference Biotin, low/high 96%/98% Interference Hemoglobin, low/high 96%/80% Percentages are reported as mean with range shown in brackets
(63) The measuring range (LLOD to ULOD) of the assay was determined to be 2.7-300.7 ng/ml. The intra- and inter-assay variation was 6% and 10%, respectively. The acceptance criterion was below 10% for the intra-assay variation and below 15% for the inter-assay variation and therefore acceptable. To obtain linearity, human serum needed to be diluted 1:4 and the mean dilution recovery for 1:4 pre-diluted human serum was 96%. The analyte stability was analyzed according to freeze/thaw cycles and storage stability at 4 C. and 20 C. with an acceptance criterion of the recovery within 100%+20%. The analyte recovery in serum was 92% after 4 freeze/thaw cycles. After storage at 4 C. for 48 hours the recovery was 84%. Analyte stability was also tested at 20 C. for 4, 24 and 48 hours. The recovery after 4 hours was 88%. However after 24 hours the analyte could not be recovered within the acceptance range (50% recovery). These data indicate that the analyte in serum is stable at 4 C. up to 48 hours, however upon analysis serum samples should not be stored above 20 C. for more than four hours. No interference was detected from either low or high contents of biotin, lipids or hemoglobin with recoveries ranging from 80-98%. The acceptance criterion was a recovery within 100%+20%.
(64) Degradation of SPARC by Collagenases (MMP-8 and MMP-13)
(65) To further evaluate the specificity of the antibody and to investigate which proteases generate SPARC-M, different gelatinases (MMP-2 and MMP-9) and collagenases (MMP-8 and MMP-13) were incubated with recombinant full-length SPARC. As shown in
(66) These results indicate that the antibody is specific for the cleavage site and that collagenases compared to gelatinases have a higher preference for SPARC at this specific site.
(67) Clinical Evaluation of SPARC-M
(68) To investigate whether SPARC-M had clinical disease relevance and biomarker potential, SPARC-M was measured in patients with different fibrotic lung disorders and healthy controls. Cohort 1 consisted of patients with lung cancer, IPF, COPD and healthy controls. As shown in
(69) To examine if the level of SPARC-M was different in patients with metastasis (high tumor burden) compared to patients with localized tumors, patients from cohort 2 were stratified according to their tumor stage (stage I-IV). No significant difference was observed between the tumor stages, however an increasing trend of SPARC-M was observed with increasing tumor stage (
CONCLUSION
(70) The present study describes the development and biological validation of a competitive ELISA assay quantifying a fragment of SPARC in serum. The main findings of this study were: 1) the investigated fragment was detectable in serum and significantly elevated in lung cancer patients compared to healthy controls, 2) the assay was technically robust and specific towards a unique MMP-8/MMP-13 degraded fragment of SPARC, SPARC-M, and 3) the assay shows potential for use in evaluating IPF.
(71) In this specification, unless expressly otherwise indicated, the word or is used in the sense of an operator that returns a true value when either or both of the stated conditions is met, as opposed to the operator exclusive or which requires that only one of the conditions is met. The word comprising is used in the sense of including rather than in to mean consisting of. All prior teachings acknowledged above are hereby incorporated by reference.
REFERENCES
(72) 1. Lane T F and Sage E H. The biology of SPARC, a protein that modulates cell-matrix interactions. FASEB J. 1994; 8:163-73. 2. Bradshaw A D. The role of SPARC in extracellular matrix assembly. Journal of Cell Communication and Signaling. 2009; 3:239-46. 3. Brekken R A and Sage E H. SPARC, a matricellular protein: at the crossroads of cell-matrix. Matrix Biology. 2000; 19:569-80. 4. Chiodoni et al. Matricellular proteins: From homeostasis to inflammation, cancer, and metastasis. Cancer and Metastasis Reviews. 2010; 29:295-307. 5. Yan Q, Sage E H. SPARC, a Matricellular Glycoprotein with Important Biological Functions. J Histochem Cytochem. 1999; 47:1495-505. doi: 10.1177/002215549904701201. 6. Emerson R O, Sage E H, Ghosh J G, Clark J I. Chaperone-like activity revealed in the matricellular protein SPARC. J Cell Biochem. 2006; 98:701-5. 7. Rosset E M, Bradshaw A D. SPARC/osteonectin in mineralized tissue. Matrix Biology. 2016; 52-54:78-87. 8. Bradshaw A D, Baicu C F, Rentz T J, Van Laer A O, Boggs J, Lacy J M, et al. Pressure overload-induced alterations in fibrillar collagen content and myocardial diastolic function: Role of secreted protein acidic and rich in cysteine (SPARC) in post-synthetic procollagen processing. Circulation. 2009; 119:269-80. 9. Bradshaw A D, Puolakkainen P, Dasgupta J, Davidson J M, Wight T N, Sage E H. SPARC-null mice display abnormalities in the dermis characterized by decreased collagen fibril diameter and reduced tensile strength. J Invest Dermatol. 2003; 120:949-55. 10. Delany A M, Amling M, Priemel M, Howe C, Baron R, Canalis E. Osteopenia and decreased bone formation in osteonectin-deficient mice. J Clin Invest. 2000; 105:915-23. 11. Rentz T J, Poobalarahi F, Bornstein P, Sage E H, Bradshaw A D. SPARC regulates processing of procollagen I and collagen fibrillogenesis in dermal fibroblasts. J Biol Chem. 2007; 282:22062-71. 12. Trombetta-eSilva J. The Function of SPARC as a Mediator of Fibrosis. Open Rheumatol J. 2012; 6:146-55. 13. Trombetta J M, Bradshaw A D, Johnson R H. SPARC/Osteonectin Functions to Maintain Homeostasis of the Collagenous Extracellular Matrix in the Periodontal Ligament. J Histochem Cytochem. 2010; 58:871-9. doi: 10.1369/jhc.2010.956144. 14. Sasaki T, Ghring W, Mann K, Maurer P, Hohenester E, Knuper V, et al. Limited cleavage of extracellular matrix protein BM-40 by matrix metalloproteinases increases its affinity for collagens. J Biol Chem. 1997; 272:9237-43. 15. Sasaki T, Miosge N, Timpl R. Immunochemical and tissue analysis of protease generated neoepitopes of BM-40 (osteonectin, SPARC) which are correlated to a higher affinity binding to collagens. Matrix Biol. 1999; 18:499-508. 16. Gilles C, Bassuk J a, Pulyaeva H, Sage E H, Foidart J M, Thompson E W. SPARC/osteonectin induces matrix metalloproteinase 2 activation in human breast cancer cell lines. Cancer Res. 1998; 58:5529-36. 17. Jacob K, Webber M, Benayahu D, Kleinman H K. Osteonectin promotes prostate cancer cell migration and invasion: A possible mechanism for metastasis to bone. Cancer Res. 1999; 59:4453-7. 18. Tremble P M, Lane T F, Sage E H, Werb Z. SPARC, a secreted protein associated with morphogenesis and tissue remodeling, induces expression of metalloproteinases in fibroblasts through a novel extracellular matrix-dependent pathway. J Cell Biol. 1993; 121:1433-44. 19. Sangaletti S, Tripodo C, Cappetti B, Casalini P, Chiodoni C, Piconese S, et al. SPARC oppositely regulates inflammation and fibrosis in bleomycin-induced lung damage. Am J Pathol. 2011; 179:3000-10. 20. Strandjord T P, Madtes D K, Weiss D J, Sage E H. Collagen accumulation is decreased in SPARC-null mice with bleomycin-induced pulmonary fibrosis. Am J Physiol. 1999; 277 3 Pt 1: L628-35. http://www.ncbi.nlm.nih.gov/pubmed/10484471. 21. Wang J-C, Lai S, Guo X, Zhang X, de Crombrugghe B, Sonnylal S, et al. Attenuation of fibrosis in vitro and in vivo with SPARC siRNA. Arthritis Res Ther. 2010; 12:1-9. 22. Pichler R H, Hugo C, Shankland S J, Reed M J, Bassuk J A, Andoh T F, et al. SPARC is expressed in renal interstitial fibrosis and in renal vascular injury. Kidney Int. 1996; 50:1978-89. 23. Camino A M, Atorrasagasti C, Maccio D, Prada F, Salvatierra E, Rizzo M, et al. Adenovirus-mediated inhibition of SPARC attenuates liver fibrosis in rats. J Gene Med. 2008; 10:993-1004. 24. Neuzillet C, Tijeras-Raballand A, Cros J, Faivre S, Hammel P, Raymond E. Stromal expression of SPARC in pancreatic adenocarcinoma. Cancer and Metastasis Reviews. 2013; 32:585-602. 25. Wong S L I, Sukkar M B. The SPARC protein: an overview of its role in lung cancer and pulmonary fibrosis and its potential role in chronic airways disease. Br J Pharmacol. 2017; 174:3-14. 26. Frizell E, Liu S L, Abraham A, Ozaki I, Eghbali M, Helene Sage E, et al. Expression of SPARC in normal and fibrotic livers. Hepatology. 1995; 21:847-54. 27. Kuhn C, Mason R J. Immunolocalization of SPARC, tenascin, and thrombospondin in pulmonary fibrosis. Am J Pathol. 1995; 147:1759-69. 28. Leeming D, He Y, Veidal S, Nguyen Q, Larsen D, Koizumi M, et al. A novel marker for assessment of liver matrix remodeling: An enzyme-linked immunosorbent assay (ELISA) detecting a MMP generated type I collagen neo-epitope (C1M). Biomarkers. 2011; 16:616-28. doi: 10.3109/1354750X.2011.620628. 29. Combet C, Blanchet C, Geourjon C, Delage G. NPS@: network protein sequence analysis. Trends Biochem Sci. 2000; 25:147-50. www.ncbi.nlm.nih.gov/pubmed/10694887. Accessed 27 May 2016. 30. Gefter M L, Margulies D H, Scharff M D. A simple method for polyethylene glycol-promoted hybridization of mouse myeloma cells. Somatic Cell Genet. 1977; 3:231-6.