Compound Library and Method for Producing Compound Library
20260049343 ยท 2026-02-19
Inventors
- Hiroaki Suga (Tokyo, JP)
- Yuki Goto (Tokyo, JP)
- Hiroyasu Onaka (Tokyo, JP)
- Alexander Vinogradov (Tokyo, JP)
Cpc classification
C40B40/10
CHEMISTRY; METALLURGY
C12P17/185
CHEMISTRY; METALLURGY
G01N33/53
PHYSICS
C12P17/188
CHEMISTRY; METALLURGY
International classification
Abstract
Disclosed is a method for producing a compound library comprising two or more cyclic compounds represented by the formula (I), comprising a step of allowing a macrocyclase in vitro to act on two or more peptides represented by the formula (II): LP-X(Xa).sub.m-YZ (II) wherein X represents a group represented by the formula (1), Y is a peptide residue consisting of four amino acids and/or analogs thereof and contains a group represented by the formula (2) (wherein R.sup.1 and B.sup.1 are as defined above, and R.sup.3 represents a hydrogen or a hydrocarbon group), and LP is present or absent and, when present, represents a peptide residue consisting of 1 to 100 amino acids and/or analogs thereof, and forming the nitrogen-containing 6-membered ring A while eliminating LP, if present, to form the two or more cyclic compounds represented by the formula (I).
Claims
1-28. (canceled)
29. A method for producing a compound library comprising two or more cyclic compounds represented by the formula (I): ##STR00047## wherein m number of X.sub.a, and X.sub.b and X.sub.c each independently represent an amino acid residue selected from the group consisting of any amino acids and analogs thereof, Z is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, m is an integer selected from 2 to 40, ring A is a nitrogen-containing 6-membered ring optionally having a substituent, B.sup.1 is an oxygen atom, a sulfur atom, or a NH group, and R.sup.1 is a hydrogen atom or a hydrocarbon group, the method comprising: producing a mRNA library encoding precursor peptides represented by the formula (III): ##STR00048## wherein X is serine or threonine, or an analog thereof, Y is a peptide consisting of four amino acids represented by Y(10)-Y.sup.1(11)-Y.sup.1(12)-Y(13)- and/or analogs thereof, wherein Y(10) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, Y(11) is serine, cysteine, threonine or diaminopropionic acid, or an analog thereof, Y(12) is serine or threonine, or an analog thereof, and Y(13) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, m number of Xa, m and Z are the same as defined as m number of Xa, m and Z, respectively, in the formula (I), and LP is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof; expressing the precursor peptides by a cell-free translation system with the mRNA library to produce a first peptide library; forming an azole ring on at least Y(11) in the precursor peptides with an azole ring-forming enzyme; converting at least X and Y(12) in the precursor peptides to -unsaturated amino acid residues with an ,-unsaturated amino acid-forming enzyme in the presence of co-substrate tRNA.sup.Glu for glutamylation and aminoacylation enzyme GluRS; and forming a nitrogen-containing 6-membered ring with a macrocyclase while eliminating LP, if present.
30. The production method according to claim 29, wherein Y(10) is serine or threonine, or an analog thereof, and Y(13) is serine, cysteine, threonine or diaminopropionic acid, or an analog thereof.
31. The production method according to claim 29, wherein Y(11) is serine, cysteine or threonine, or an analog thereof, and Y(12) is serine or threonine, or an analog thereof
32. The production method according to claim 29, wherein Y(10) is serine or threonine, or an analog thereof, Y(11) is serine, cysteine or threonine, or an analog thereof, Y(12) is serine, and Y(13) is serine, cysteine or threonine, or an analog thereof.
33. The production method according to claim 29, wherein in (Xa).sub.m in the formula (III), amino acid residue Xa(1) adjacent to X is an amino acid other than an acidic amino acid or an analog thereof.
34. The production method according to claim 29, wherein in (Xa).sub.m in the formula (III), amino acid residue Xa(m) at m-th position is an amino acid other than an acidic amino acid or an analog thereof.
35. The production method according to claim 29, wherein in (Xa).sub.m in the formula (III), amino acid residue Xa(m1) at (m1)-th position is an amino acid other than an acidic amino acid and a basic amino acid or an analog thereof.
36. The production method according to claim 29, wherein the azole ring-forming enzyme comprises LazD, LazF and LazF, and/or an enzyme having homology with any of them.
37. The production method according to claim 29, wherein the ,-unsaturated amino acid-forming enzyme comprises LazB and LazF, and/or an enzyme having homology with any of them.
38. The production method according to claim 29, wherein the macrocyclase comprises LazC and/or an enzyme having homology with LazC.
39. The production method according to claim 29, wherein the cosubstrate tRNA.sup.Glu for glutamylation reaction is actinomycete-derived tRNA.sup.Glu and the aminoacylation enzyme GluRS is actinomycete-derived GluRS.
40. A method for producing a compound library comprising two or more cyclic compounds represented by the formula (I): ##STR00049## wherein m number of X.sub.a, and X.sub.b and X.sub.c each independently represent an amino acid residue selected from the group consisting of any amino acids and analogs thereof, Z is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, m is an integer selected from 2 to 40, ring A is a nitrogen-containing 6-membered ring optionally having a substituent, B.sup.1 is an oxygen atom, a sulfur atom, or a NH group, and R.sup.1 is a hydrogen atom or a hydrocarbon group, the method comprising: producing a mRNA library encoding precursor peptides represented by the formula (III): ##STR00050## wherein X is serine or threonine, or an analog thereof, Y is a peptide consisting of four amino acids represented by Y(10)-Y(11)-Y(12)-Y(13)- and/or analogs thereof, wherein Y(10) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, Y(11) is serine, cysteine, threonine or diaminopropionic acid, or an analog thereof, Y(12) is serine or threonine, or an analog thereof, and Y(13) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, m number of Xa, m and Z are the same as defined as m number of Xa, m and Z, respectively, in the formula (I), and LP is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof; binding puromycin to the 3 end of each mRNA of the mRNA library to produce a puromycin-bound mRNA library; expressing the precursor peptides by a cell-free translation system with the puromycin-bound mRNA library to produce a first peptide-mRNA complex library; forming an azole ring on at least Y(11) in the precursor peptides with an azole ring-forming enzyme; converting at least X and Y(12) in the precursor peptides to ,-unsaturated amino acid residues with an ,-unsaturated amino acid-forming enzyme in the presence of cosubstrate tRNA.sup.Glu for glutamylation and aminoacylation enzyme GluRS; and forming a nitrogen-containing 6-membered ring with a macrocyclase while eliminating LP, if present.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
DESCRIPTION OF EMBODIMENTS
[0215] Hereinafter, embodiments of the present invention will be described in detail. However, the present invention is not limited by the following present embodiment and can be carried out through various changes or modifications without departing from the spirit of the present invention.
[0216] One embodiment of the method for producing a compound library according to the present invention is a method for producing a compound library containing two or more cyclic compounds represented by the formula (I):
##STR00020##
wherein [0217] m number of X.sub.a, and X.sub.b and X.sub.c each independently represent an amino acid residue selected from the group consisting of any amino acids and analogs thereof, [0218] Z is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, [0219] m is an integer selected from 2 to 40, [0220] ring A is a nitrogen-containing 6-membered ring optionally having a substituent, [0221] B.sup.1 is an oxygen atom, a sulfur atom, or a NH group, and [0222] R.sup.1 is a hydrogen atom or a hydrocarbon group, the method including a step of allowing a macrocyclase in vitro to act on two or more peptides represented by the formula (II):
##STR00021##
wherein [0223] X represents a group represented by the formula (1):
##STR00022##
(wherein R.sup.2 is a hydrogen atom or a hydrocarbon group), [0224] Y is a peptide residue consisting of four amino acids and/or analogs thereof and contains a group represented by the formula (2):
##STR00023##
(wherein R.sup.1 and R.sup.3 each represent a hydrogen or a hydrocarbon group, and B.sup.1 represents an oxygen atom, a sulfur atom, or a NH group), [0225] m number of X.sub.a each independently represents an amino acid residue selected from the group consisting of any amino acids and analogs thereof, [0226] LP is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, [0227] Z is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, and [0228] m is an integer selected from 2 to 40, [0229] and forming the nitrogen-containing 6-membered ring A while eliminating LP, if present, to form the two or more cyclic compounds represented by the formula (I).
[0230] In the formula (I) and the formula (II), m number of X.sub.a may be the same or different and each independently represents an amino acid residue selected from the group consisting of any amino acids and analogs thereof.
[0231] In the formula (1) and the formula (2), the unsaturated double bond containing R.sup.2 or R.sup.3 may be a single isomer in E or Z form or may be a mixture of E and Z forms. The formula (1) is preferably represented by
##STR00024##
and the formula (2) is preferably represented by
##STR00025##
[0232] One embodiment of the method for producing a compound library according to the present invention is a method for producing a compound library containing two or more cyclic compounds represented by the formula (I), including: [0233] a step of producing a mRNA library encoding precursor peptides represented by the formula (III):
##STR00026##
wherein [0234] X is serine or threonine, or an analog thereof, [0235] Y is a peptide consisting of four amino acids represented by Y(10)-Y(11)-Y(12)-Y(13)- and/or analogs thereof, wherein Y(10) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, Y(11) is serine, cysteine, threonine, or diaminopropionic acid or an analog thereof, Y(12) is serine or threonine or an analog thereof, and Y(13) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, [0236] m number of X.sub.a each independently represents an amino acid residue selected from the group consisting of any amino acids and analogs thereof, [0237] LP is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, [0238] Z is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof, and [0239] m is an integer selected from 2 to 40; [0240] a step of expressing the precursor peptides by a cell-free translation system with the mRNA library to produce a first peptide library; [0241] a step of reacting an azole ring-forming enzyme with the first peptide library, so that an azole ring is formed on at least Y(11) in the precursor peptides to produce a second peptide library; and [0242] a step of reacting an ,-unsaturated amino acid-forming enzyme with the second peptide library in the presence of cosubstrate tRNA.sup.Glu for glutamylation reaction and aminoacylation enzyme GluRS, so that at least X and Y(12) in the precursor peptides are converted to ,-unsaturated amino acid residues to produce a third peptide library; and [0243] a step of reacting a macrocyclase with the third peptide library and forming a nitrogen-containing 6-membered ring while eliminating LP, if present, to form the two or more cyclic compounds represented by the formula (I).
[0244] In the formula (III), m number of X.sub.a may be the same or different and each independently represents an amino acid residue selected from the group consisting of any amino acids and analogs thereof.
[0245] The ,-unsaturated amino acid in the ,-unsaturated amino acid-forming enzyme refers to an amino acid having an unsaturated double bond formed between a carbon at position and a carbon at position adjacent to the carbon at position in an amino acid or an analog thereof, as shown in [Formula 21] given below. The unsaturated double bond may be a single isomer in E or Z form or may be a mixture of E and Z forms.
##STR00027##
[0246] In the formula, Ra is any organic group.
[0247] One embodiment of the method for producing a compound library according to the present invention is a method for producing a compound library containing two or more cyclic compounds represented by the formula (I), including: [0248] a step of producing a mRNA library encoding precursor peptides represented by the formula (III); [0249] a step of binding puromycin to the 3 end of each mRNA of the mRNA library to produce a puromycin-bound mRNA library; [0250] a step of expressing the precursor peptides by a cell-free translation system with the puromycin-bound mRNA library to produce a first peptide-mRNA complex library; [0251] a step of reacting an azole ring-forming enzyme with the first peptide-mRNA complex library, so that an azole ring is formed on at least Y(11) in the precursor peptides to produce a second peptide-mRNA complex library; [0252] a step of reacting an ,-unsaturated amino acid-forming enzyme with the second peptide-mRNA complex library in the presence of cosubstrate tRNA.sup.Glu for glutamylation reaction and aminoacylation enzyme GluRS, so that at least X and Y(12) in the precursor peptides are converted to ,-unsaturated amino acid residues to produce a third peptide-mRNA complex library; and [0253] a step of reacting a macrocyclase with the third peptide-mRNA complex library and forming a nitrogen-containing 6-membered ring while eliminating LP, if present, to form the two or more cyclic compounds represented by the formula (I).
[0254] The method for producing a compound library according to the present invention can conveniently produce a compound library of post-translationally modified and macrocyclized compounds without including a step of removing leader peptides, whereas the leader peptides usually need to be removed for in vitro use of enzymes in a post-translational modification reaction step.
[0255] In the present specification, the amino acid is a proteinogenic amino acid. In the present specification, the proteinogenic amino acid means an amino acid constituting a protein (Arg, His, Lys, Asp, Glu, Ser, Thr, Asn, Gln, Cys, Gly, Pro, Ala, Ile, Leu, Met, Phe, Trp, Tyr, and Val). In the present specification, the amino acid is also indicated by a conventional single-letter code or three-letter code.
[0256] In the present specification, the analog of an amino acid includes a natural or non-natural amino acid other than a proteinogenic amino acid. The natural or non-natural amino acid other than a proteinogenic amino acid is also referred to as a non-proteinogenic amino acid. Examples of the non-proteinogenic amino acid include, but are not limited to: ,-disubstituted amino acids (-methylalanine, etc.), N-alkyl--amino acids, D-amino acids, -amino acids and -hydroxylic acid, which differ in backbone structure from natural forms; amino acids differing in side chain structure from natural forms (norleucine, homohistidine, etc.); amino acids having extra methylene on a side chain (homo amino acids, homophenylalanine, diaminopropionic acid, -methylcysteine, -isopropylserine, -phenylserine, etc.); and amino acids obtained by substituting a carboxylic acid functional group amino acid in a side chain by sulfonic acid (cysteic acid, etc.). In the present specification, the analog of an amino acid also encompasses a mutant or a derivative of a proteinogenic amino acid or a non-proteinogenic amino acid and, specifically, also includes derivatives, such as an ,-unsaturated amino acid and azole, formed from a proteinogenic amino acid or a non-proteinogenic amino acid.
[0257] When the peptide according to the present invention contains an ,-unsaturated amino acid as an amino acid analog, examples of the ,-unsaturated amino acid as the amino acid analog specifically include analog (I) having the following structure:
##STR00028##
wherein R.sup.X1 is a hydrogen atom or a hydrocarbon group.
[0258] When the peptide according to the present invention contains azole as an amino acid analog, examples of the azole as the amino acid analog specifically include analog (II) having the following structure:
##STR00029##
wherein B.sup.X is an oxygen atom, a sulfur atom or a NH group, and R.sup.X2 is a hydrogen atom or a hydrocarbon group.
[0259] In the present specification, a chemical structural formula encompasses a tautomer, a geometric isomer, an optical isomer and the like.
[0260] Particularly, examples of the analog of Cys include, but are not limited to, an analog represented by a formula given below. Alternatively, the analog of Cys may be analog (I) or analog (II), as mentioned above, derived from the following formula:
##STR00030##
wherein R represents a hydrogen atom, an alkyl group having 1 to 10 carbon atoms and optionally having a substituent, or an aromatic group optionally having a substituent.
[0261] Particularly, examples of the analog of Ser or Thr include, but are not limited to, an analog represented by a formula given below. Alternatively, the analog of Ser or Thr may be analog (I) or analog (II), as mentioned above, derived from the following formula:
##STR00031##
wherein R represents a hydrogen atom, an alkyl group having 1 to 10 carbon atoms and optionally having a substituent, or an aromatic group optionally having a substituent.
[0262] Particularly, examples of the analog of diaminopropionic acid (Dap) include, but are not limited to, an analog given below. Alternatively, the analog of diaminopropionic acid may be analog (I) or analog (II), as mentioned above, derived from the following formula:
##STR00032##
wherein R represents a hydrogen atom, an alkyl group having 1 to 10 carbon atoms and optionally having a substituent, or an aromatic group optionally having a substituent.
[0263] In the present specification, examples of the hydrocarbon group preferably include an alkyl group having 1 to 10 carbon atoms and optionally having a substituent, and an aromatic group optionally having a substituent. In the present specification, the hydrocarbon group is preferably an alkyl group having 1 to 6 carbon atoms or a phenyl group optionally having a substituent, more preferably an alkyl group having 1 to 4 carbon atoms or a phenyl group, and further preferably a methyl group.
[0264] In the present specification, examples of the substituent include an alkyl group, an aromatic group, a halogen group, an azide group and an amino group. The substituent is preferably an alkyl group having 1 to 4 carbon atoms, and more preferably a methyl group.
[0265] The nitrogen-containing 6-membered ring optionally having a substituent in the formula (I) is not particularly limited as long as the nitrogen-containing 6-membered ring results from a reaction between the formula (1) and the formula (2), i.e., 2+4 cycloaddition. Specifically, examples thereof include the following structures:
##STR00033##
wherein R.sup.A1 and R.sup.A2 are each independently hydrogen or a hydrocarbon group, and each of R.sup.A1 and R.sup.A2 is preferably a hydrogen or an alkyl group having 1 to 4 carbon atoms, and more preferably a hydrogen or a methyl group.
[0266] Each of LP and LP is also referred to as a leader peptide and represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof. LP and LP may be present or absent. The presence of LP or LP tends to facilitate recognizing a precursor peptide by an enzyme such as a macrocyclase, an azole ring-forming enzyme, an ,-unsaturated amino acid-forming enzyme and the like, so that the reaction proceeds smoothly.
[0267] The number of amino acids and/or analogs thereof constituting LP or LP is preferably 11 or more and 100 or less, more preferably 11 or more and 60 or less, further preferably 16 or more and 45 or less, as to LP, and preferably 11 or more and 100 or less, more preferably 11 or more and 60 or less, further preferably 16 or more and 45 or less, as to LP for sufficient substrate recognition by a modifying enzyme.
[0268] An important leader peptide region for the azole ring-forming enzyme has been revealed in goadsporin, which has a thiopeptide-like modified structure (Ozaki, T. et al. Dissection of goadsporin biosynthesis by in vitro reconstitution leading to designer analogues expressed in vivo. Nat Commun 8, 14207, doi:10.1038/ncomms14207 (2017).). Table 1 shows results of a leader peptide truncation experiment for biosynthesis of goadsporin.
[0269] See
[0270] As shown in the table, leader-truncated precursor peptides obtained by N-terminally truncating a leader peptide region of precursor peptide GodA of goadsporin are used as substrates. For the leader peptide region having 20 residues (LP-20) or more, six azole rings are formed. For the leader peptide region having 15 residues (LP-15), the efficiency of azole ring formation is reduced. Azole ring formation is no longer seen in shorter ones (LP-10 and LP-5).
[0271] LP is not particularly limited by its sequence and is preferably a peptide of -(20th)LSELTVTSLRDTVALPENGA(1st)-(SEQ ID NO: 14) from the 20th to 1st (the 1st amino acid is adjacent to X) amino acids in order from the N terminus with X in the formula (II) defined as position 1, or a peptide having homology with this peptide. For LP, the homology with the peptide of -LSELTVTSLRDTVALPENGA-(SEQ ID NO: 14) is preferably 50% or more, more preferably 70% or more, further preferably 90% or more.
[0272] LP is not particularly limited by its sequence and is preferably a peptide of -(25th)LQDLDLSELTVTSLRDTVALPENGA(1st)-(SEQ ID NO: 15) from the 25th to 1st amino acids in order from the N terminus with X in the formula (III) defined as position 1, or a peptide having homology with this peptide. For LP, the homology with the peptide of -LQDLDLSELTVTSLRDTVALPENGA-(SEQ ID NO: 15) is preferably 50% or more, more preferably 70% or more, and further preferably 90% or more.
[0273] Each of the sequences of LP and LP is more preferably a peptide of -(30th)VESLDLQDLDLSELTVTSLRDTVALPENGA(1st)-(SEQ ID NO: 16) from the 30th to 1 st amino acids in order from the N terminus with X defined as position 1, or a peptide having homology with this peptide, and further preferably a peptide of -(38th)MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGA(1st)-(SEQ ID NO: 17) from the 38th to 1st amino acids in order from the N terminus with X defined as position 1, or a peptide having homology with this peptide. The homology with these peptides is preferably 50% or more, more preferably 70% or more, and further preferably 90% or more.
[0274] LP preferably has a hydrophobic amino acid or a derivative thereof, more preferably leucine or an analog thereof, further preferably leucine, at position 17 with X in the formula (III) defined as position 1.
[0275] LP preferably has a hydrophobic amino acid or a derivative thereof, more preferably leucine or a derivative thereof, further preferably leucine, at position 20 with X in the formula (III) defined as position 1.
[0276] LP preferably has an acidic amino acid or a derivative thereof, more preferably aspartic acid or a derivative thereof, further preferably aspartic acid, at position 21 with X in the formula (III) defined as position 1.
[0277] LP preferably has a hydrophobic amino acid or a derivative thereof, more preferably leucine or a derivative thereof, further preferably leucine, at each of positions 17 and 20 with X in the formula (III) defined as position 1.
[0278] LP preferably has a hydrophobic amino acid or a derivative thereof at each of positions 17 and 20 and an acidic amino acid or a derivative thereof at position-21, more preferably leucine or a derivative thereof at each of positions 17 and 20 and aspartic acid or a derivative thereof at position 21, further preferably leucine at each of positions 17 and 20 and aspartic acid at position 21, with X in the formula (III) defined as position 1.
[0279] Z in the formula (I) and the formula (II) or Z in the formula (III) is present or absent and, when present, represents a peptide consisting of 1 to 100 amino acids and/or analogs thereof.
[0280] Each of Z and Z, if present, is not particularly limited by its sequence and types of amino acids and is preferably a peptide consisting of 1 to 100 amino acids and/or analogs thereof, more preferably a peptide consisting of 1 to 50 amino acids and/or analogs thereof, further preferably a peptide consisting of 1 to 40 amino acids and/or analogs thereof, still further preferably a peptide consisting of 3 to 30 amino acids and/or analogs thereof. In Z in the formula (I) and the formula (II) or Z in the formula (III), the amino acid adjacent to Xc or Y is not particularly limited and is preferably an amino acid other than an acidic amino acid or an analog thereof.
[0281] m in the formula (I) and the formula (II) or m in the formula (III) is an integer selected from 2 to 40, preferably an integer of 2 or larger and 24 or smaller, more preferably an integer of 2 or larger and 20 or smaller, further preferably an integer of 2 or larger and 16 or smaller. When each of m and m is an integer selected from 2 to 40, cyclization tends to proceed smoothly by the action of macrocyclase.
[0282] Y in the formula (I) is a peptide residue consisting of four amino acids and/or analogs thereof and contains a group represented by the formula (2) given below. The group represented by the formula (2) is a residue corresponding to two amino acids and/or analogs thereof in the peptide residue consisting of four amino acids and/or analogs thereof. The peptide residue in Y except for the group represented by the formula (2) is a residue corresponding to any two amino acids and/or analogs thereof.
##STR00034##
wherein R.sup.1 and R.sup.3 each represent a hydrogen or a hydrocarbon group, and B.sup.1 represents an oxygen atom, a sulfur atom or a NH group.
[0283] Y in the formula (I) is a peptide residue consisting of four amino acids and/or analogs thereof and preferably contains a group represented by the following formula (2-1) or formula (2-2):
##STR00035##
wherein R.sup.1, R.sup.4 and R.sup.5 each represent a hydrogen atom or a hydrocarbon group, and B.sup.1 represents an oxygen atom, a sulfur atom or a NH group.
##STR00036##
wherein R.sup.1, R.sup.3 and R.sup.5 each represent a hydrogen atom or a hydrocarbon group, and B.sup.1 and B.sup.2 each represent an oxygen atom, a sulfur atom or a NH group.
[0284] Y in the formula (I) is preferably a group represented by the following formula (3):
##STR00037##
wherein R.sup.1, R.sup.3, R.sup.4 and R.sup.5 each independently represent a hydrogen atom or a hydrocarbon group, and B.sup.1 and B.sup.2 each represent an oxygen atom, a sulfur atom or a NH group.
[0285] Y in the formula (I) is more preferably a group represented by the following formula (3):
##STR00038##
wherein R.sup.1, R.sup.3, R.sup.4 and R.sup.5 each independently represent a hydrogen atom or a methyl group, and B.sup.1 and B.sup.2 each represent an oxygen atom or a sulfur atom, with the proviso that when B.sup.1 and/or B.sup.2 is a sulfur atom, each of R.sup.1 and R.sup.5 is a hydrogen.
[0286] The group represented by the formula (3) or the formula (3) is preferably represented by the following formula:
##STR00039##
[0287] Y in the formula (I) is further preferably a group represented by the following formula (3):
##STR00040##
wherein R.sup.1, R.sup.4 and R.sup.5 each independently represent a hydrogen atom or a methyl group, and B.sup.1 and B.sup.2 each represent an oxygen atom or a sulfur atom, with the proviso that when B.sup.1 and/or B.sup.2 is a sulfur atom, each of R.sup.1 and R.sup.5 is a hydrogen.
[0288] The group represented by the formula (3) is preferably represented by the following formula:
##STR00041##
[0289] Y in the formula (I) is still further preferably a group represented by the following formula (3-1):
##STR00042##
[0290] Y in the formula (III) is a peptide consisting of four amino acids represented by Y(10)-Y(11)-Y(12)-Y(13)- and/or analogs thereof, wherein Y(10) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof, Y(11) is serine, cysteine, threonine or diaminopropionic acid, or an analog thereof, Y(12) is serine or threonine, or an analog thereof, and Y(13) is an amino acid residue selected from the group consisting of any amino acids and analogs thereof.
[0291] Y(11) is preferably serine, cysteine or threonine, or an analog thereof, more preferably serine, cysteine or threonine, further preferably serine.
[0292] Y(12) is preferably serine or threonine or an analog thereof, more preferably serine or an analog thereof, further preferably serine.
[0293] Preferably, Y(11) is serine, cysteine or threonine, or an analog thereof, and Y(12) is serine or an analog thereof.
[0294] Y(10) is not particularly limited and is preferably serine or threonine, or an analog thereof from the viewpoint of the efficiency of the macrocyclization reaction. Y(13) is not particularly limited and is preferably serine, cysteine, threonine or diaminopropionic acid, or an analog thereof from the viewpoint of the efficiency of the macrocyclization reaction.
[0295] Y(10) is more preferably serine or threonine, further preferably serine.
[0296] Y(13) is more preferably serine, cysteine or threonine, further preferably cysteine.
[0297] Preferably, Y(10) is serine or threonine or an analog thereof, Y(11) is serine, cysteine or threonine or an analog thereof, Y(12) is serine or an analog thereof, and Y(13) is serine, cysteine, threonine or diaminopropionic acid, or an analog thereof. More preferably, Y(10) is serine or threonine, or an analog thereof, Y(11) is serine, cysteine or threonine or an analog thereof, Y(12) is serine, and Y(13) is serine, cysteine or threonine, or an analog thereof. Further preferably, Y(10) is serine, Y(11) is serine, Y(12) is serine, and Y(13) is cysteine.
[0298] For (Xa).sub.m in the formula (III), the efficiency of the enzymatic reaction tends to be reduced when amino acid Xa(1) is an acidic amino acid or an analog of the acidic amino acid.
[0299] Thus, in (Xa).sub.m in the formula (III), the amino acid residue Xa(1) adjacent to X is preferably an amino acid other than an acidic amino acid or an analog thereof.
[0300] For (Xa).sub.m in the formula (III), the efficiency of the enzymatic reaction tends to be reduced when an amino acid residue adjacent to Y(10) on an N-terminal side, i.e., amino acid residue Xa(m) at position m, is an acidic amino acid or an analog of the acidic amino acid.
[0301] Thus, in (Xa).sub.m in the formula (III), the amino acid residue Xa(m) at position m is preferably an amino acid other than an acidic amino acid or an analog thereof.
[0302] For (Xa).sub.m in the formula (III), the efficiency of the enzymatic reaction tends to be reduced when an amino acid residue adjacent to Xa(m) described above on an N-terminal side, i.e., amino acid residue Xa(m1) at position m1, is an acidic amino acid or an analog of the acidic amino acid, or a basic amino acid or an analog of the basic amino acid.
[0303] Thus, in (Xa).sub.m in the formula (III), the amino acid residue Xa(m1) at position m1 is preferably an amino acid other than an acidic amino acid and a basic amino acid or analogs thereof.
[0304] An amino acid adjacent to Y(13) in Z in the formula (III) is any amino acid or an analog thereof. However, the efficiency of the enzymatic reaction tends to be reduced when this amino acid is an acidic amino acid or an analog of the acidic amino acid.
[0305] Thus, the amino acid adjacent to Y(13) in Z in the formula (III) is preferably an amino acid other than an acidic amino acid or an analog thereof.
[0306] The method for producing a peptide library according to the present invention employs an azole ring-forming enzyme, an ,-unsaturated amino acid-forming enzyme and macrocyclase.
[0307] The azole ring-forming enzyme in the method for producing a peptide library according to the present invention preferably includes LazD, LazE and LazF. An enzyme having homology with each of LazD, LazE and LazF can also be used as the azole ring-forming enzyme.
[0308] Examples of the enzyme having homology with each of LazD, LazE and LazF include enzymes shown in Table 2 below. Two or more of these enzymes may be used in combination. The enzyme having homology with each of LazD, LazE and LazF is also referred to as a homolog of LazD, LazE or LazF. The homolog means an enzyme that is an enzyme other than LazD, LazE and LazF and that enables a peptide having a formed azole ring to be detected when an similar azole ring formation reaction as described in Examples mentioned later is performed for an arbitrary peptide with the same concentration as that of LazD, LazE or LazF.
[0309] The homology of the homologs of LazD, LazE and LazF can be 20% or more with respect to the alignment of LazD, LazE and LazF, respectively. In the present specification, the enzyme having homology also includes an enzyme having homology (%) of 20% or more with respect to the alignment of the original enzyme. Found enzymes that can be used similarly to LazD, LazE or LazF on the basis of homology (%) with respect to the alignment of LazD, LazE or LazF are shown in Table 3 (for LazD), Table 4 (for LazE) and Table 5 (for LazF). The enzymes shown in these tables have been found by homology search using BLAST.
[0310] In the case of using LazD, LazE and LazF for the azole ring formation according to the present invention, LazD and LazE form azoline, and subsequently, LazF (a domain contained in LazF, close to C-terminal side, involved in azole ring formation) forms azole, thereby constructing an azole ring. The azole ring-forming enzyme according to the present invention is a group including enzymes involved in azoline formation and azole formation.
[0311] In this context, each of the homologs of LazD and LazE may be an enzyme containing a domain involved in azoline formation and a domain involved in an additional function together (also referred to as a bi-functional enzyme) or may be two or more separate enzymes each containing a domain involved in azoline formation. LazF contains a C-terminal domain involved in azole formation and an N-terminal domain involved in ,-unsaturated amino acid formation. Thus, the homolog of LazF as the azole ring-forming enzyme can be an enzyme containing at least a domain involved in azole formation and may be two or more separate enzymes each containing a domain involved in azole formation.
[0312] As described above, the azole ring-forming enzyme is not particularly limited as long as the enzyme contains at least domains involved in azoline formation and azole formation. The homolog of LazD, LazE or LazF preferably contains a domain having homology of 80% or more, more preferably homology of 85% or more, further preferably homology of 90% or more, with each of the domains involved in azoline formation and azole formation in LazD, LazE and LazF.
[0313] The ,-unsaturated amino acid-forming enzyme in the method for producing a peptide library according to the present invention preferably includes LazB and LazF. An enzyme having homology with each of LazB and LazF can also be used as the ,-unsaturated amino acid-forming enzyme.
[0314] Examples of the enzyme having homology with each of LazB and LazF include enzymes shown in Table 6 (for LazB) and Table 5B (for LazF) below. Two or more of these enzymes may be used in combination.
[0315] The enzyme having homology with each of LazB and LazF is also referred to as a homolog of LazB or LazF. The homolog means an enzyme that is an enzyme other than LazB and LazF and that enables a peptide having a formed a, -unsaturated amino acid to be detected when an similar ,-unsaturated amino acid formation reaction as described in Examples mentioned later is performed for an arbitrary peptide with the same concentration as that of LazB or LazF.
[0316] The homology of the homologs of LazB and LazF can be 20% or more with LazB and LazF, respectively.
[0317] In the case of using LazB and LazF for the ,-unsaturated amino acid formation according to the present invention, LazB performs glutamylation, and subsequently, LazF (a domain of LazF, close to N-terminal side, involved in ,-unsaturated amino acid formation) causes glutamate elimination, thereby constructing an ,-unsaturated amino acid. The ,-unsaturated amino acid-forming enzyme according to the present invention is a group including enzymes involved in glutamylation and glutamate elimination.
[0318] In this context, each of the homologs of LazB and LazF may be an enzyme containing a domain involved in glutamylation or glutamate elimination and a domain involved in an additional function together (also referred to as a bi-functional enzyme) or may be two or more separate enzymes each containing a domain involved in glutamylation or glutamate elimination.
[0319] As described above, the ,-unsaturated amino acid-forming enzyme is not particularly limited as long as the enzyme contains at least domains involved in glutamylation and glutamate elimination. The homologs of LazB and LazF preferably contain a domain having homology of 80% or more, more preferably homology of 85% or more, further preferably homology of 90% or more, with the domains involved in glutamylation and glutamate elimination in LazB and LazF, respectively.
[0320] The macrocyclase in the method for producing a peptide library according to the present invention preferably includes LazC. An enzyme having homology with LazC can also be used as the macrocyclase.
[0321] Examples of the enzyme having homology with LazC include enzymes shown in Table 7. Two or more of these enzymes may be used in combination.
[0322] The enzyme having homology with LazC is also referred to as a homolog of LazC. The homolog means an enzyme that is an enzyme other than LazC and that enables a peptide having a formed macrocycle to be detected when an similar macrocyclization reaction as described in Examples mentioned later is performed for an arbitrary peptide with the same concentration as that of LazC.
[0323] The homology of the homolog of LazC can be 20% or more with LazC.
[0324] The macrocyclase is not particularly limited as long as the enzyme contains at least a domain involved in macrocyclization. The homolog of LazC may be an enzyme containing a domain involved in macrocyclization and a domain involved in an additional function together (also referred to as a bi-functional enzyme) or may be two or more separate enzymes each containing a domain involved in macrocyclization. The homolog of LazC preferably contains a domain having homology of 80% or more, more preferably homology of 85% or more, further preferably homology of 90% or more, with the domain involved in macrocyclization in LazC.
[0325] In the present specification, the phrase having homology of Y % or more with the amino acid sequence represented by SEQ ID NO: X means that when two polypeptides are aligned so as to match their amino acid sequences to the maximum, the ratio of the number of common amino acid residues to the total number of amino acids shown in SEQ ID NO: X is Y % or more.
TABLE-US-00001 TABLE 2 Dha/Dhb formation Azole cyclization Dehydroal- Dehydroal- Name of Azoline anine anine specific Azoline Azoline oxidation formation formation compound cycliza- cyclization (azole (glutamic (glutamate to be tion (cyclodehy- cycli- acid elimina- Macrocy- Producing synthesized (docking) dration) zation) addition) tion) clization microbe Reference Thipep- Lactazole LazD LazE LazF LazB LazF LazC Streptomyces Chem. Biol. 21 tide C-ter N-ter lactacystinaeus (5), 679-688 OM-6519 (2014) Micrococcin = TclI TclJ TclN TclK TclL TclM Staphylococcus J. Bacteriol. Thiocillin epidermidis 2016, 198, strain 115 2431-2438 Thiocillin = TclI TclJ TclN TclK TclL TclM Bacillus cereus PNAS, 2009. 106 Micrococcin ATCC 14579 (8) 2549-2553 Berninamycin BerE2 BerE2 BerE1 BerB BerC BerD Streptomyces PNAS, 2013. 110 BerG1 BerG2 BerE2 bernensis (21) 8483-8488 UC 5144 Thiomuracin TbtF TbtG TbtE TbtB TbtC TbtD Thermobispora J Am Chem Soc. bispora 2015 137(51): DSM 43833 16012-16015. Thiomuracin TpdF TpdG TpdE TpdB TpdC TpdD Nonomuraea J Am Chem Soc. Bp3714-39 2009; 131(16): 5946-55. GE2270 PbtF PbtG PbtE PbtB PbtC PbtD Planobispora J Am Chem Soc. rosea 2015 137(51): ATCC53733 16012-16015. GE2270 TpdF TpdG TpdE TpdB TpdC TpdD Nonomuraea J Am Chem Soc. strain WU8817 2009; 131(16): 5946-55. Nosiheptide NosH NosG NosF NosE NosD NosO Streptomyces ACS Chem. Biol., actuosus 2009, 4 (10), ATCC 25421 pp 855-864 Thiostrepton TsrN TsrO TsrM TsrJ TsrK TsrL Streptomyces Chemistry & TsrS laurentii Biology, 16, ATCC 31255 2009, 141-147 Siomycin SioN SioO SioM SioJ SioK SioL Streptomyces Chemistry & SioS sioyaensis Biology, 16, ATCC 13989 2009, 141-147 Thipep- TP-1161 TpdG TpaH TpaE TpaL TpaK TpaB Nocardiopsis Appl. Environ. tide TpaC TpaF sp. TFS65-07 Microbiol. 76 (21), TpaD 7093-7101 (2010) Thiocillin TclI TclJ TclN TclK TclL TclM Bacillus cereus PNAS, 2009. ATCC 14579 106 (8) 2549-2553 GE37468 GetH GetI GetG GetD GetE GetF Streptomyces PNAS, 2011. 108 GetK ATCC 55365 (32) 13053-13058 Cyclothia- CltD CltB CltC CltE CltF CltD Streptomyces Appl. Environ. zomycin CltG hygroscopicus Microbiol. 76 (7), 10-22 2335-2344 (2010) LAPs Goadsporin GodD GodD GodE GodF GodG Streptomyces Microbiology 151, sp. Tp-A0584 3923-3933 (2005) Planta- BamC BamD BamB Bacillus ACS Chem. Biol., zolicin methylotrophicus 2016, 11, FZB42 2232-2243 cyano- Patellamide PatD PatG PNAS, 2005. 102 bactin (20) 7315-7320 unnamed LynD LynG Nat Chem Biol. cyanobactin 2008 June; 4(6): 341-343. Trichamide TriD TriG Nat Chem Biol. 2008 June; 4(6): 341-343. Tenuecycla- TenD TenG Nat Chem Biol. mide 2008 June; 4(6): 341-343. Trunkamide TruD TruG Prochloron Nat Chem Biol. didemni 2008 June; 4(6): 341-343. Lantipep- Nisin NisB NisB Lactococcus Nature 517, tide lactis 6F3 509-512 (2015) NAI-107 MibB MibB Microbispora PNAS, 2010. 107 corallina (30) 13461-13466
[0326] The reaction of the ,-unsaturated amino acid-forming enzyme with a peptide according to the present invention is performed in the presence of a cosubstrate for glutamylation reaction and aminoacylation enzyme. In this context, the cosubstrate for glutamylation reaction and the aminoacylation enzyme may be derived from a cell-free translation system or may be other than those contained in the cell-free translation system. Specifically, the reaction of the ,-unsaturated amino acid-forming enzyme with a peptide according to the present invention may be performed using a cosubstrate for glutamylation reaction and aminoacylation enzyme in a cell-free translation system when the cell-free translation system contains them, and may be performed in the presence of a cosubstrate for glutamylation reaction and/or aminoacylation enzyme that is not contained in the cell-free translation system, by separately adding them. Whether to use a cosubstrate and aminoacylation enzyme contained in a cell-free translation system or to use a cosubstrate and aminoacylation enzyme other than the cell-free translation system can be appropriately selected according to the type of the ,-unsaturated amino acid-forming enzyme used, etc.
[0327] From homology information on amino acid sequences by HHpred, LazB has exhibited 13% identity to an N-terminal region of biosynthetic enzyme NisB for class I lanthipeptide Nisin carried by Lactococcus lactis. NisB catalyzes the formation of an ,-unsaturated amino acid such as dehydroalanine or dehydrobutyrine by the dehydration of Ser or Thr in Nisin biosynthesis.
[0328] For RiPPs compounds, it has been reported that the ,-unsaturated amino acid such as dehydroalanine or dehydrobutyrine is formed through the dehydration reaction of Ser or Thr. The Ser or Thr dehydration mechanism is reportedly divided broadly into two different mechanisms. One of them is a tRNA-dependent dehydration mechanism seen in thiopeptides or class I lanthipeptides, and the other one is an ATP-dependent dehydration mechanism seen in class II to IV lanthipeptides.
[0329] The tRNA-type dehydration mechanism has been revealed for NisB. As shown below, a dehydroamino acid is formed by glutamylation which adds a glutamic acid aminoacylated to glutamyl-tRNA to a hydroxy group, and elimination of the glutamic acid.
##STR00043##
[0330] It is known that the ,-unsaturated amino acid formation of other thiopeptides is based on the tRNA-type dehydration mechanism (Nature Volume 517, pages 509-512, (2015)). Since LazB has high homology with an N-terminal region of NisB, LazB presumably catalyzes glutamylation reaction using glutamyl-tRNA.sup.Glu
[0331] Thus, in the present invention, glutamyl-tRNA.sup.Glu is used as a cosubstrate for reaction in the formation of an ,-unsaturated amino acid. In the present invention, particularly, when LazB and LazF, and/or enzymes having homology with them are used as the ,-unsaturated amino acid-forming enzyme, tRNA.sup.Glu is not particularly limited as long as the tRNA.sup.Glu is at least accepted by the ,-unsaturated amino acid-forming enzyme. From the viewpoint that the reaction proceeds efficiently, it is preferred to use actinomycete-derived tRNA.sup.Glu and/or E. coli-derived tRNA.sup.Glu, and it is more preferred to use tRNA.sup.Glu derived from an actinomycete Streptomyces lactacystinaeus which is a lactazole-producing microbe and/or tRNA.sup.Glu derived from Streptomyces lividans which is used as a host heterologously expressing lactazole.
[0332] Also, aminoacylation enzyme GluRS is used for forming glutamyl-tRNA.sup.Glu from tRNA.sup.Glu Particularly, when LazB and LazF, and/or enzymes having homology with them are used as the ,-unsaturated amino acid-forming enzyme, GluRS is not particularly limited as long as the tRNA.sup.Glu used is glutamylated. Actinomycete-derived GluRS and/or E. coli-derived GluRS is preferred, and GluRS derived from an actinomycete Streptomyces lactacystinaeus which is a lactazole-producing microbe and/or GluRS derived from Streptomyces lividans which is used as a host heterologously expressing lactazole is more preferred. The actinomycete-derived GluRS may be GluRS extracted from the actinomycete or may be obtained as a recombinant protein of GluRS within the actinomycete genome. The E. coli-derived GluRS may be GluRS extracted from E. coli or may be obtained as a recombinant protein of GluRS from the E. coli genome.
[0333] The peptide represented by the formula (II) may be prepared, for example, from a precursor peptide represented by the formula (III) by the action of the azole ring-forming enzyme, the ,-unsaturated amino acid-forming enzyme and the macrocyclase, or may be prepared by an organic chemical approach known in the art with a precursor peptide represented by the formula (III) as a starting material. Alternatively, the peptide represented by the formula (II) may be prepared in accordance with a peptide synthesis method known in the art, for example, an organic chemical approach described in J. Am. Chem. Soc 2015, 137, 3494-3497, and J. Am. Chem. Soc. 2016, 138, 13461-13464.
[0334] Specifically, the peptide represented by the formula (II) can be obtained, for example, by allowing a general acid or base catalyst to act on the precursor peptide represented by the formula (III) so that a carbonyl group and a hydroxy group or a thiol group in the peptide are intramolecularly dehydrated and condensed to form an azole ring, then converting a hydroxy group in the peptide to a leaving group, and allowing a general base to act on the resultant to form an ,-unsaturated amino acid. Alternatively, the precursor peptide represented by the formula (III) may be prepared using amino acids having a selenium atom at position y, such as selenocysteine, phenylselenocysteine and selenolysine, and induced into selenoxide by treatment with an oxidizing agent such as hydrogen peroxide, followed by elimination to form an ,-unsaturated amino acid.
[0335] In the present specification, the cell-free translation system refers to a translation system involving no cell. For example, E. coli extracts, wheat germ extracts, rabbit erythrocyte extracts or insect cell extracts can be used as the cell-free translation system. Alternatively, a reconstituted cell-free translation system may be used, which is constructed by reconstituting a ribosomal protein, aminoacyl-tRNA synthetase (aaRS), ribosomal RNA, amino acid, rRNA, GTP, ATP, translation initiation factor (IF) elongation factor (EF), release factor (RF) and ribosome recycling factor (RRF), respectively purified, and other factors necessary for translation.
[0336] The system may contain RNA polymerase in order to also perform transcription from DNA. A commercially available cell-free translation system can be used, for example, RTS-100(registered trademark) from Roche Diagnostics K.K. as an E. coli-derived system, PURESYSTEM(registered trademark) from Post Genome Institute (PGI) and PURExpress In Vitro Protein Synthesis Kit from New England BioLabs Inc. as a reconstituted translation system, and a system using wheat germ extracts from ZOEGENE Corp. or CellFree Sciences Co., Ltd.
[0337] For example, techniques described in the following documents are known in the art as systems using E. coli ribosome: H. F. Kung et al., 1977. The Journal of Biological Chemistry Vol. 252, No. 19, 6889-6894; M. C. Gonza et al., 1985, Proceeding of National Academy of Sciences of the United States of America Vol. 82, 1648-1652; M. Y. Pavlov and M. Ehrenberg, 1996, Archives of Biochemistry and Biophysics Vol. 328, No. 1, 9-16; Y. Shimizu et al., 2001, Nature Biotechnology Vol. 19, No. 8, 751-755; H. Ohashi et al., 2007, Biochemical and Biophysical Research Communications Vol. 352, No. 1, 270-276.
[0338] According to the cell-free translation system, an expression product can be obtained with high purity without being purified.
[0339] The cell-free translation system of the present invention may be supplemented with factors necessary for transcription and thereby used not only in translation but in transcription.
[0340] One aspect of the present invention is a compound library containing two or more cyclic compounds represented by the formula (I), wherein at least one of the cyclic compounds represented by the formula (I) is in a non-natural form.
[0341] The non-natural form refers to a form structurally differing from naturally occurring lactazole or the like.
[0342] One aspect of the present invention is a screening method for identifying a cyclic compound represented by the formula (I) which binds to a target substance, including: a step of contacting a compound library produced by the production method of the present invention or the compound library of the present invention with the target substance, followed by incubation; and a step of selecting a cyclic compound represented by the formula (I) bound with the target substance.
[0343] One aspect of the present invention is a screening kit for identifying a cyclic compound represented by the formula (I) which binds to a target substance, containing a compound library produced by the production method of the present invention or the compound library of the present invention.
[0344] One aspect of the present invention is a method for producing a cyclic compound represented by the formula (I), including a step of allowing a macrocyclase in vitro to act on a peptide represented by the formula (II) and forming the nitrogen-containing 6-membered ring A while eliminating LP to form the cyclic compound represented by the formula (I).
[0345] One aspect of the present invention is a method for producing a cyclic compound represented by the formula (I), including: a step of producing mRNA encoding a precursor peptide represented by the formula (III); a step of expressing the precursor peptide by a cell-free translation system using the mRNA to produce a first peptide; a step of reacting an azole ring-forming enzyme with the first peptide, so that an azole ring is formed on at least Y(11) in the precursor peptide to produce a second peptide; a step of reacting an ,-unsaturated amino acid-forming enzyme with the second peptide in the presence of cosubstrate tRNA.sup.Glu for glutamylation reaction and aminoacylation enzyme GluRS, so that at least X and Y(12) in the precursor peptide are converted to ,-unsaturated amino acid residues to produce a third peptide; and a step of reacting a macrocyclase with the third peptide and forming a nitrogen-containing 6-membered ring while eliminating LP to form a cyclic compound represented by the formula (I).
[0346] When the method for producing a compound library and the method for producing a cyclic compound according to the present invention include steps of producing a first peptide library or a first peptide, producing a second peptide library or a second peptide, producing a third peptide library or a third peptide and producing a cyclic compound, these steps also encompass an embodiment in which the reactions are performed at once by adding enzymes or cosubstrates to one system, i.e., an embodiment in which these production steps proceed in a series of reactions in the system, and also encompass an embodiment in which the reactions are performed stepwise by adding and reacting enzymes in order.
[0347] Specific embodiments encompassed by the method for producing a compound library and the method for producing a cyclic compound according to the present invention include: [0348] an embodiment which includes first adding an azole ring-forming enzyme to a system containing precursor peptides or a puromycin-bound mRNA library, followed by reaction, next adding an ,-unsaturated amino acid-forming enzyme, optionally with cosubstrate tRNA.sup.Glu for glutamylation reaction and/or aminoacylation enzyme GluRS, followed by reaction, and further adding a macrocyclase, followed by reaction (pattern I); [0349] an embodiment which includes first adding cosubstrate tRNA.sup.Glu for glutamylation reaction and/or aminoacylation enzyme GluRS, if necessary, to a system containing precursor peptides or a puromycin-bound mRNA library, adding an azole ring-forming enzyme and an ,-unsaturated amino acid-forming enzyme, followed by reaction, and next adding a macrocyclase, followed by reaction (pattern II); [0350] an embodiment which includes first adding an azole ring-forming enzyme to a system containing precursor peptides or a puromycin-bound mRNA library, followed by reaction, next adding cosubstrate tRNA.sup.Glu for glutamylation reaction and/or aminoacylation enzyme GluRS, if necessary, adding an ,-unsaturated amino acid-forming enzyme and macrocyclase, followed by reaction (pattern III); and [0351] an embodiment which includes first adding cosubstrate tRNA.sup.Glu for glutamylation reaction and/or aminoacylation enzyme GluRS, if necessary, to a system containing precursor peptides or a puromycin-bound mRNA library, and adding an azole ring-forming enzyme, an ,-unsaturated amino acid-forming enzyme and a macrocyclase, followed by reaction (pattern IV).
EXAMPLES
<Synthesis of Precursor Peptide>
[0352] In order to reconstruct lactazole biosynthesis in vitro, a precursor peptide was prepared using a cell-free translation system. It is considered that C-terminal several amino acids of LazA are cleaved by cellular endogenous protease. Accordingly, LazA* tailored to a purified product of lactazole A was synthesized by truncating C-terminal three residues (QDM). The sequences of LazA and LazA* are shown in
(Preparation of DNA Template)
[0353] In order to synthesize the precursor peptide using a cell-free translation system, a DNA template was first prepared.
[0354] An attempt was made to prepare a DNA template containing a nucleotide sequence encoding the precursor peptide LazA as well as a T7 promoter sequence, a SD sequence and a ribosomal binding sequence. For the promoter sequence, the SD sequence and the ribosomal binding sequence, a DNA template used in a FIT-GS system (goadsporin) was referred to (Ozaki, T. et al. Dissection of goadsporin biosynthesis by in vitro reconstitution leading to designer analogues expressed in vivo. Nat Commun 8, 14207, doi: 10.1038/ncomms14207 (2017).).
[0355] The nucleotide sequence encoding the precursor peptide needed to be changed from actinomycete-type codons into E. coli type so that the cell-free translation system can utilize E. coli-derived RNA polymerase or ribosome. Hence, the DNA template was designed so as to optimize the nucleotide sequence on the basis of the usage frequency of E. coli codon as shown in Table 8. The designed nucleotide sequence encoding the precursor peptide is shown in
TABLE-US-00002 TABLE 8 Usage frequency of E. coli codon Order of precedence 1 2 3 4 5 Ala GCA GCT GCG Cys TGT TGC Asp GAC GAT Glu GAA GAG Phe TTT TTC Gly GGT GGC GGG His CAT CAC Ile ATT ATC Lys AAG AAA Leu CTG TTA CTT TTG Met ATG Asn AAT AAC Pro CCG CCA CCT Gln CAA CAG Arg CGT CGC Ser TCT TCA AGC AGT Thr ACC ACT ACG ACA Val GTT GTG GTA Trp TGG Tyr TAT TAC
[0356] Subsequently, the preparation of the designed DNA template was attempted. Since the nucleotide sequence of the DNA template was 214 base pairs, the DNA template was prepared by primer extension and PCR using six primers.
[0357] The prepared DNA template was confirmed by electrophoresis to have base pairs having the length of interest. The DNA template having the confirmed length was purified using FastGene/PCR Extraction Kit (Nippon Genetics Co., Ltd.) and eluted with 20 l of MilliQ water.
TABLE-US-00003 TABLE 9 Primer extension reaction composition KOD-Plus-neo (Toyobo Co., Ltd.) 2.0 (l) 10 KOD-Plus-neo Buffer 10 2 mM dNTPs 10 25 mM MgSO.sub.4 6.0 50 M F1 primer 2.0 50 M R1 primer 2.0 MilliQ water 68 Total 100 l
TABLE-US-00004 TABLE 10 Primer extension reaction conditions 94 C. 1.0 min 50 C. 1.0 min {close oversize bracket} 5 cycles 68 C. 1.0 min
TABLE-US-00005 TABLE 11 1st PCR reaction composition KOD-Plus-neo 2.0 (l) 10 KOD-Plus-neo Buffer 10 2 mM dNTPs 10 25 mM MgSO.sub.4 6.0 50 M F2 primer 1.0 50 M R2 primer 1.0 MilliQ water 65 Extension product 5.0 Total 100 l
TABLE-US-00006 TABLE 12 2nd PCR reaction composition KOD-Plus-neo 2.0 (l) 10 KOD-Plus-neo Buffer 10 2 mM dNTPs 10 25 mM MgSO.sub.4 6.0 50 M F2 primer 1.0 50 M R3 primer 1.0 MilliQ water 69.5 1st PCR product 0.5 Total 100 l
TABLE-US-00007 TABLE 13 3rd PCR reaction composition KOD-Plus-neo 2.0 (l) 10 KOD-Plus-neo Buffer 10 2 mM dNTPs 10 25 mM MgSO.sub.4 6.0 50 M F2 primer 1.0 50 M R4 primer 1.0 MilliQ water 69.5 2nd PCR product 0.5 Total 100 l
TABLE-US-00008 TABLE 14 1st PCR and 2nd PCR reaction conditions 94 C. 40 min 50 C. 40 min {close oversize bracket} 5 cycles 68 C. 40 min
TABLE-US-00009 TABLE 15 3rd PCR reaction conditions 94 C. 40 min 50 C. 40 min {close oversize bracket} 14 cycles 68 C. 40 min
(Translation Reaction in Cell-Free Translation System)
[0358] Next, translation reaction was performed in a cell-free translation system with the DNA template prepared in the preceding section (Preparation of DNA template) to prepare precursor peptide LazA.
[0359] The cell-free translation system used in this experiment was the one prepared by the Suga Laboratory of Department of Chemistry, School of Science, The University of Tokyo. The preparation of the cell-free translation system is described in Goto, Y., Katoh, T. & Suga, H. Flexizymes for genetic code reprogramming. Nat Protoc 6, 779-790, (2011). E. coli A19-derived ribosome, translation elongation factors (IF1, IF2, and IF3), translation elongation factors (EF-G, EF-Tu, and EF-Ts), translation release factors (RF2, RF3, and RRF), aminoacyl-tRNA synthetase, methionyl-tRNA formyltransferase, T7 RNA polymerase, creatine kinase, myokinase, inorganic pyrophosphatase and nucleoside diphosphate kinase were used as constituent proteins of the cell-free translation system.
[0360] The cell-free translation system employed two divided solutions, Solution A containing cofactors, etc. and Solution B containing proteins, preserved at 80 C. The composition of the Solution A and the Solution B used is as described in Nature Protocols, 2011. The N-terminal amino acid of the peptide to be synthesized becomes formylmethionine by the action of the methionyl-tRNA formyltransferase.
[0361] In vitro translation reaction was performed using the cell-free translation system with the prepared DNA template. The composition of the in vitro translation system is shown in Table 16. The reaction was performed by incubation at 37 C. for 30 minutes using a vapor-phase incubator.
[0362] After the in vitro translation reaction, desalting operation was performed using zip tip C18. Subsequently, the desalted translated peptide was analyzed by MALDI-TOFMS using sinapic acid as a matrix. As a result of the analysis by MALDI-TOF MS, a peak was observed at [M+H].sup.+ 5672.4 (calculated value is [M+H].sup.+ 5672.6), confirming that the precursor peptide LazA* of interest was able to be synthesized.
TABLE-US-00010 TABLE 16 Reaction conditions Solution A version 7S 0.273 l Solution B version10.1 0.320 l DNA template 0.25 l 5 mM mixed solution of 20 amino acids 0.25 l MilliQ 1.407 l Total 2.5 l
<Preparation of LazB, LazC, LazD, LazE, LazF, Cosubstrate and GluRS>
[0363] The enzymes used in the production of libraries were prepared as follows.
(Preparation of LazB)
[0364] lazB-opt/pET26b was transferred to E. coli BL21 (DE3) for protein expression by heat shock method to obtain transformants. One colony thereof was precultured at 37 C. for 16 hours using 6 ml of LB medium. 4 ml of the resulting cultures was inoculated to 200 ml of ZYM-5052 medium. Subsequently, main culture was performed at 180 rpm at 18 C. for 20 hours. The bacterial cells thus cultured were centrifuged at 4720g for 10 minutes for harvest and then stored at 80 C. For the extraction of the recombinant protein, the bacterial cells were suspended in 50 mM Tris-HCl pH 8.0, 500 mM NaCl and 10 mM imidazole pH 8.0. The suspended bacterial cells were ultrasonically disrupted, and the suspension was centrifuged at 10300g at 4 C. for 30 minutes. From the obtained supernatant, the protein was subjected to His-tag-purification using Bio-Scale Mini Profinity IMAC cartridge (Bio-Rad Laboratories, Inc.). The cartridge was washed with the same buffer as used in the suspension, followed by elution with a buffer having an imidazole concentration elevated to 200 mM. The elution fraction was desalted with Bio-Gel P-6 desalting cartridge (Bio-Rad Laboratories, Inc.). The buffer was replaced with 25 mM HEPES pH 8.0, 500 mM NaCl and 5% glycerol. The LazB purification fraction was subjected to polyacrylamide gel electrophoresis (SDS-PAGE). As a result, a band corresponding to His-Tag-bound LazB was observed at a molecular weight of approximately 96 kDa, confirming that the protein of interest was correctly obtained. The concentration calculated from absorbance at UV 280 nm was 17.9 M (approximately 1.7 mg/ml).
(Preparation of LazC)
[0365] lazC-opt/pET26b was transferred to E. coli BL21 (DE3) for protein expression by heat shock method to obtain transformants. One colony thereof was precultured at 37 C. for 16 hours using 6 ml of LB medium. 4 ml of the resulting cultures was inoculated to 200 ml of ZYM-5052 medium. Subsequently, main culture was performed at 180 rpm at 18 C. for 20 hours. The bacterial cells thus cultured were purified and desalted in the same manner as in LazB. The buffer was replaced with 25 mM HEPES pH 6.8 and 500 mM NaCl. The LazC purification fraction was subjected to SDS-PAGE. As a result, a band corresponding to His-Tag-bound LazC was observed at a molecular weight of approximately 45 kDa, confirming that the protein of interest was correctly obtained. The concentration calculated from absorbance at UV 280 nm was 23.0 M (approximately 1.0 mg/ml).
(Preparation of LazD)
[0366] Although coexpression with pET26b vector, pET16 vector and chaperon, etc. was attempted for the purification of LazD, no solubilized protein was obtained in any of the cases due to low expression levels and insolubilization. Accordingly, pCold vector of a cold-shock expression system was attempted.
[0367] lazD-opt/pColdII was transferred to E. coli BL21 (DE3) for protein expression by heat shock method to obtain transformants. One colony thereof was precultured at 37 C. for 16 hours using 20 ml of LB medium. 16 ml of the resulting cultures was inoculated to 800 ml of LB medium. Subsequently, the bacterial cells were cultured at 150 rpm at 37 C. for 2 hours and then cooled in ice. IPTG was added thereto with a final concentration of 0.1 mM, and the bacterial cells were cultured at 180 rpm at 15 C. for 18 hours. The bacterial cells thus cultured were centrifuged at 4720g for 10 minutes for harvest and then immediately suspended in 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 10 mM imidazole pH 8.0 and 2 mM DTT. The suspended bacterial cells were ultrasonically disrupted, and the suspension was centrifuged at 10300g at 4 C. for 30 minutes. From the obtained supernatant, the protein was subjected to His-tag-purification using Bio-Scale Mini Profinity IMAC cartridge. The cartridge was washed with the same buffer as used in the suspension, followed by elution with a buffer having an imidazole concentration elevated to 200 mM. The elution fraction was desalted with Bio-Gel P-6 desalting cartridge. The buffer was replaced with 25 mM HEPES pH 8.0, 500 mM NaCl and 2 mM DTT. The LazD purification fraction was subjected to SDS-PAGE. As a result, a band corresponding to His-Tag-bound LazD was observed at a molecular weight of approximately 58 kDa, confirming that the protein of interest was correctly obtained. The fraction was concentrated approximately 4-fold by ultrafiltration using a 30 kDa ultrafiltration membrane. The concentration of the concentrated fraction calculated from absorbance at UV 280 nm was 41.7 M (approximately 2.4 mg/ml).
(Preparation of LazE)
[0368] Although coexpression with pET26b vector, pET16 vector and chaperon, etc. was attempted for the expression and purification of LazE, as with LazD, no solubilized protein was obtained in any of the cases due to low expression levels and insolubilization. Accordingly, the pCold vector of a cold-shock expression system was attempted.
[0369] lazE-opt/pColdII was transferred to E. coli BL21 (DE3) for protein expression by heat shock method to obtain transformants. One colony thereof was precultured at 37 C. for 16 hours using 20 ml of LB medium. 16 ml of the resulting cultures was inoculated to 800 ml of LB medium. Subsequently, the bacterial cells were cultured at 150 rpm at 37 C. for 2 hours and then cooled in ice. IPTG was added thereto with a final concentration of 0.1 mM, and the bacterial cells were cultured at 180 rpm at 15 C. for 18 hours. The bacterial cells thus cultured were purified and desalted in the same manner as in LazD. The LazE purification fraction was subjected to SDS-PAGE. As a result, a band corresponding to His-Tag-bound LazE was observed at a molecular weight of approximately 74 kDa, confirming that the protein of interest was correctly obtained. The fraction was concentrated approximately 7-fold by ultrafiltration using a 30 kDa ultrafiltration membrane. The concentration of the concentrated fraction calculated from absorbance at UV 280 nm was 22.6 M (approximately 1.7 mg/ml).
(Preparation of LazF)
[0370] lazF-opt/pET26b was transferred to E. coli BL21 (DE3) for protein expression by heat shock method to obtain transformants. One colony thereof was precultured at 37 C. for 16 hours using 6 ml of LB medium. 4 ml of the resulting cultures was inoculated to 200 ml of ZYM-5052 medium. Subsequently, main culture was performed at 180 rpm at 18 C. for 20 hours. The bacterial cells thus cultured were purified and desalted in the same manner as in LazB. The buffer was replaced with 25 mM HEPES pH 6.8 and 500 mM NaCl. The LazF purification fraction was subjected to SDS-PAGE. As a result, a band corresponding to His-Tag-bound LazF was observed at a molecular weight of approximately 61 kDa, confirming that the protein of interest was correctly obtained. The purified LazF assumed yellow color which indicated that LazF was bound with flavin. Yamashita et al. have revealed that FMN is noncovalently bound with LazF (Ozaki, T. et al. Dissection of goadsporin biosynthesis by in vitro reconstitution leading to designer analogues expressed in vivo. Nat Commun 8, 14207, (2017).). The concentration of LazF calculated by the Bradford method was 32.9 M (approximately 2.0 mg/ml).
(Preparation of Cosubstrate)
[0371] tRNA.sup.Glu derived from Lactazole-producing microbe, which serves as a cosubstrate for glutamylation reaction mediated by LazB was prepared by in vitro transcription.
(1) Synthesis of DNA template
[0372] First, a tRNA.sup.Glu sequence was found from the genome of an actinomycete Streptomyces lactacystinaeus, which is a lactazole-producing microbe. Four copies of tRNA.sup.Glu were encoded in the genome of S. lactacystinaeus. Three of these copies were tRNA.sup.Glu(CUC) having completely the same nucleotide sequence, and the other copy was tRNA.sup.Glu(UUC).
[0373] The two types of tRNA.sup.Glu were prepared, and DNA templates of the two tRNA.sup.Glu(CUC and UUC) were each prepared (see
[0374] 2 l of the 2nd PCR products were electrophoresed to confirm that DNA templates having the length of interest were amplified. The 2nd PCR products confirmed to be amplified were subjected to phenol-chloroform extraction to remove proteins. Finally, pellets obtained by ethanol precipitation were dissolved in 400 l of MilliQ water.
TABLE-US-00011 TABLE 17 Primer extension reaction composition Taq DNA polymerase 0.75 (l) 10 PCR Buffer 10 5 mM dNTPs 5 250 mM MgCl.sub.2 1.0 200 M F1 primer 0.5 200 M R1 primer 0.5 MilliQ water 82.25 Total 100 l
TABLE-US-00012 TABLE 18 Primer extension reaction conditions 94 C. 1.0 min 50 C. 5 cycles 1.0 min {close oversize bracket} 68 C. 1.0 min
TABLE-US-00013 TABLE 19 1st PCR reaction composition Taq DNA polymerase 0.75 (l) 10 PCR Buffer 10 5 mM dNTPs 5 250 mM MgCl.sub.2 1.0 200 M F2 primer 0.5 200 M R2 primer 0.5 MilliQ water 81.75 Extension product 0.5 Total 100 l
TABLE-US-00014 TABLE 20 1st PCR reaction conditions 94 C. 40 min 50 C. {close oversize bracket} 5 cycles 40 min 68 C. 40 min
TABLE-US-00015 TABLE 21 2nd PCR reaction composition Taq DNA polymerase 30.0 (l) 10 PCR Buffer 400 5 mM dNTPs 200 250 mM MgCl.sub.2 40.0 50 M F2 primer 40.0 50 M R3 primer 40.0 1st PCR product 20.0 MilliQ water 3230 Total 4000 l
TABLE-US-00016 TABLE 22 2nd PCR reaction conditions 94 C. 40 min 50 C. {close oversize bracket} 14 cycles 40 min 68 C. 40 min
(2) In Vitro Transcription Reaction
[0375] In vitro transcription reaction was performed under the reaction conditions of Table 23 below with the synthesized DNA templates. The transcription reaction was performed by incubation at 37 C. for 20 hours.
[0376] After the completion of the in vitro transcription reaction, the template DNAs were degraded by DNase treatment. Then, proteins were removed by isopropanol precipitation. Pellets obtained by the isopropanol precipitation were dissolved in 400 l of MilliQ and purified using a modified gel. The RNA solutions thus gel-purified were subjected to ethanol precipitation again. Then, these solutions were adjusted so as to attain 250 M solutions while the concentration was measured using Nanodrop, which were then stored at 80 C.
TABLE-US-00017 TABLE 23 In vitro transcription reaction composition T7 RNA polymerase 80.0 (l) 10 T7 Buffer 400 25 mM NTPs 600 250 mM MgCl.sub.2 360 100 mM DTT 400 2M KOH (well mixed after addition) 45.0 100 mM GMP 200 2nd PCR product 400 MilliQ water 1515 Total 4000 l
(Preparation of GluRS)
[0377] Aminoacylation enzyme GluRS aminoacylates tRNA.sup.Glu with glutamic acid, as shown in
[0378] Since neither a strain nor genomic DNA of the lactazole-producing microbe S. lactacystinaeus was obtained, GluRS within the genome of S. lividans used as a host heterologously expressing lactazole was obtained as a recombinant protein (Hayashi, S. et al. Genome mining reveals a minimum gene set for the biosynthesis of 32-membered macrocyclic thiopeptides lactazoles. Chem Biol 21, 679-688, (2014).).
[0379] Specifically, a gluRS region was first amplified by PCR using primers gluRS-Fw-NdeI and gluRS-Rv-XhoI with S. lividans genome extracts as a template. The amplified fragment was cloned into pET26b vector through NdeI and XhoI to obtain gluRS/pET26b.
[0380] Next, gluRS/pET26b was transferred to E. coli BL21 (DE3) for protein expression by heat shock method to obtain transformants. One colony thereof was precultured at 37 C. for 16 hours using 6 ml of LB medium. 4 ml of the resulting cultures was inoculated to 200 ml of LB medium. Subsequently, the bacterial cells were shake-cultured at 150 rpm at 37 C. for 2 hours and then cooled in ice. IPTG was added thereto with a final concentration of 0.1 mM, and the bacterial cells were shake-cultured at 180 rpm at 18 C. for 20 hours. The bacterial cells thus cultured were centrifuged at 4720g for 10 minutes for harvest and then stored at 80 C. For the extraction of a recombinant protein, the bacterial cells were suspended in 50 mM Tris-HCl pH 8.0, 300 mM NaCl and 20 mM imidazole pH 8.0. The suspended bacterial cells were ultrasonically disrupted, and the suspension was centrifuged at 10300g at 4 C. for 30 minutes. From the obtained supernatant, the protein was subjected to His-tag-purification using Ni-NTA. The column was washed with the same buffer as used in the suspension, followed by elution with a buffer having an imidazole concentration elevated to 200 mM. The elution solution was dialyzed overnight against Tris-HCl pH 7.5. The actinomycete-type GluRS thus His-tag-purified was subjected to SDS-PAGE. As a result, a band corresponding to His-Tag-bound GluRS was observed at a molecular weight of approximately 55 kDa, confirming that the protein of interest was correctly obtained. The concentration calculated from absorbance at UV 280 nm was 39.0 M (approximately 2.1 mg/ml).
<Preparation of Cyclic Compound>
[0381] Cyclic compounds represented by the formula (I) were formed from the precursor peptide obtained in the preceding section <Synthesis of precursor peptide>.
[Example 1] Azole Ring Formation and ,-Unsaturated Amino Acid Formation
[0382] First, stepwise reaction was performed by allowing azole ring formation reaction to proceed completely using LazD, LazE and LazF, and after a lapse of given time, adding LazB and tRNA.sup.Glu to the reaction system so that ,-unsaturated amino acid formation reaction proceeded.
[0383] LazA* was synthesized on the scale of 5.0 l of a cell-free translation system. 25 l of a reaction solution supplemented with a coenzyme and LazD, LazE and LazF was allowed to act at 25 C. for 5 hours. After 5-hour reaction, half the amount, i.e., 12.5 l, was desalted using zip tip C18 and analyzed by MALDI-TOF MS. LazB, tRNA.sup.Glu and GluRS were added to the remaining half (12.5 l) and reacted again at 25 C. for 15 hours.
[0384] Tables 24 and 25 show the composition of the azole ring formation reaction system and the composition of the ,-unsaturated amino acid formation reaction system, respectively.
[0385] As a result of the analysis by MALDI-TOF MS, it was found, as shown in
[0386] As described above, the in vitro reconstruction of azole ring formation and ,-unsaturated amino acid formation in the lactazole biosynthesis pathway was achieved.
TABLE-US-00018 TABLE 24 Azole ring formation reaction composition 5.0 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 1 M LazD 1 M LazE 2 M LazF Total volume 25 l
TABLE-US-00019 TABLE 25 ,-unsaturated amino acid formation reaction composition 12.5 l LazA* having azole rings formed 10 M Producing microbe tRNA.sup.Glu 1 M GluRS 2 M LazB 1 M LazF Total volume 15 l
[Comparative Example 1] Azole Ring Formation and ,-Unsaturated Amino Acid Formation
[0387] The azole ring-forming enzymes LazD, LazE and LazF and the ,-unsaturated amino acid-forming enzymes LazB and LazF were reacted at the same time, and the reaction product was analyzed.
[0388] LazA* was synthesized on the scale of 2.5 l of a cell-free translation system. LazD, LazE, LazF, LazB and the other cosubstrates were added thereto according to the composition given below, and reacted. The reaction was performed by incubation at 25 C. for 20 hours. After the reaction, the reaction solution was desalted using zip tip C18 and analyzed by MALDI-TOF MS.
[0389] Table 26 shows the composition of the azole ring and ,-unsaturated amino acid formation reaction system.
[0390] As a result of the analysis by MALDI-TOF MS, four major reaction products were found at m/z 5502.6, 5656.6, 5675.6, and 5695.7, whereas a peak of the peptide of interest (m/z 5520) in which four azole rings and four dehydroalanine moieties were formed was not confirmed. These four observed peaks were not consistent with any of m/z of possible intermediates (combinations of varying numbers of azole rings formed, varying numbers of ,-unsaturated amino acids formed and varying numbers of glutamylation products). Three peaks at m/z 5656.6, 5675.6 and 5695.7 were presumably peaks derived from compounds resulting from Michael addition reaction of compounds having a strongly nucleophilic thiol group or the like with dehydroalanine.
TABLE-US-00020 TABLE 26 Azole ring and ,-unsaturated amino acid formation reaction composition 2.5 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 1 M LazD 1 M LazE 2 M LazF 10 M Producing microbe tRNA.sup.Glu 1 M GluRS 2 M LazB Total volume 15 l
[Comparative Example 2] Azole Ring Formation and ,-Unsaturated Amino Acid Formation
[0391] The stepwise reaction which involved allowing azole ring formation reaction and then ,-unsaturated amino acid formation reaction to proceed in Example 1 was changed to a stepwise reaction which involved allowing ,-unsaturated amino acid formation reaction and then azole ring formation reaction to proceed. Specifically, this reaction was performed as follows.
[0392] LazA* was synthesized on the scale of 5.0 l of a cell-free translation system. LazB, tRNA.sup.Glu and GluRS were added thereto and reacted at 25 C. for 5 hours. After 5-hour reaction, half the amount was desalted using zip tip C18 and analyzed by MALDI-TOF MS. LazD, LazE and LazF were added to the remaining half and reacted again at 25 C. for 15 hours.
[0393] Tables 27 and 28 show the composition of the ,-unsaturated amino acid formation reaction system and the composition of the azole ring formation reaction system, respectively.
[0394] As a result of the analysis by MALDI-TOF MS, the dehydration reaction of 1 or 2 molecules associated with ,-unsaturated amino acid formation was confirmed, as shown in
TABLE-US-00021 TABLE 27 ,-Unsaturated amino acid formation reaction composition 5.0 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 10 M Producing microbe tRNA.sup.Glu 1 M GluRS 2 M LazB 2 M LazF Total volume 25 l
TABLE-US-00022 TABLE 28 Azole ring formation reaction composition 12.5 l LazA* having formed ,-unsaturated amino acids 1 M LazD 1 M LazE 1 M LazF Total volume 15 l
[Example 2] Macrocyclization Reaction
[0395] As mentioned in the preceding section [Example 1], the in vitro reconstruction of azole ring formation and ,-unsaturated amino acid formation was achieved. Subsequently, macrocyclization reaction was performed using a prepared recombinant enzyme. The reaction was performed using biosynthetic enzyme LazC presumably involved in macrocyclization reaction.
[0396] LazA* was synthesized on the scale of 5.0 l of a cell-free translation system. LazD, LazE, LazF, LazB, LazC and other cosubstrates were added thereto according to the composition given below, and reacted in 30 l in total of a reaction system. The reaction was performed in reaction systems including four reaction systems: A. a reaction system of LazA* alone; B. LazA*+LazD, LazE and LazF; C. LazA*+LazD, LazE, LazF, LazB, tRNA.sup.Glu and GluRS; and D. LazA*+LazD, LazE, LazF, LazB, tRNA.sup.Glu, GluRS and LazC. Each reaction was performed by incubation at 25 C. for 20 hours. The composition of the reaction systems is shown in Table 29.
[0397] After the reaction, each reaction solution was desalted using zip tip C18 and analyzed by MALDI-TOF MS. For the analysis, half the amount, i.e., 15 l, was analyzed using sinapic acid (SA) as a matrix, and the remaining half was analyzed using CHCA (-cyano-4-hydroxycinnamic acid) as a matrix. The samples with sinapic acid used as a matrix were measured in a region of molecular weights of 2000 or larger. The samples with CHCA used as a matrix were measured in a region of molecular weights of 3000 or smaller.
[0398] The results of the analysis by MALDI-TOF MS are shown in
[0399] As shown in
[0400] Since m/z of a leader peptide is easily detected, this m/z can serve as an index for conveniently determining whether a macrocyclization product has been formed.
[0401] As described above, a method for synthesizing a cyclized compound using enzymes for lactazole A in vitro was established.
TABLE-US-00023 TABLE 29 Azole ring, ,-unsaturated amino acid, and macrocycle formation reaction composition 5.0 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 1 M LazD 1 M LazE 2 M LazF 10 M Producing microbe tRNA.sup.Glu (CUC) 1 M GluRS 2 M LazB 2 M LazC Total volume 30 l
<Substrate Tolerance>
[0402] The constructed method for synthesizing a cyclized compound using enzymes for lactazole A in vitro as mentioned above was examined for applicable substrate tolerance.
[Example 3] Substrate Tolerance to Length of Precursor Peptide1
[0403] In order to confirm the possibility of forming macrocycles other than a 32-membered ring by the macrocyclase LazC, precursor peptides inserted with Ala were prepared by inserting Ala to the core peptide region. Macrocyclization was performed with these precursor peptides as substrates.
[0404] As in Example 1, a mutant DNA template was prepared by primer extension and PCR and translated in a cell-free translation system to confirm that the precursor peptides of interest, inserted with Ala, were synthesized. Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to respective translationally-synthesized Ala-inserted precursor peptides and reacted. Table 30 shows the composition of azole ring, ,-unsaturated amino acid and macrocycle formation reaction. The reaction was performed by incubation at 25 C. for 20 hours. The reaction product was analyzed by MALDI-TOF MS and LC-MS.
[0405] Table 31 shows the sequences of the prepared precursor peptides and the numbers of azole rings and ,-unsaturated amino acids formed observed in each precursor peptide. Each of the precursor peptides exhibited the numbers of azole rings and ,-unsaturated amino acids formed similar to those of the native one (LazA*). This demonstrated that the insertion of Ala hardly influences azole ring formation and ,-unsaturated amino acid formation. In the table, symbols such as 4, 5 represent that two peaks have almost the same intensity. The same holds true for such symbols in the tables given below.
[0406]
TABLE-US-00024 TABLE 30 Azole ring, ,-unsaturated amino acid, and macrocycle formation reaction composition 5.0 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 1 M LazD 1 M LazE 2 M LazF 10 M Producing microbe tRNA.sup.Glu(CUC) 1 M GluRS 2 M LazB 2 M LazC Total volume 30 l
[0407] See
[Example 3] Substrate Tolerance to Length of Precursor Peptide2
[0408] Most of the Ala-inserted precursor peptides in which one residue of Ala was inserted became a macrocyclic compound having an expanded ring in response to macrocyclization reaction mediated by LazC. Accordingly, in order to examine how large the ring formed by LazC could be or how small the ring formed by LazC could be, mutant precursor peptides were prepared by inserting two or three residues of Ala or by deleting one or two residues of amino acids from LazA*. These mutant precursor peptides were reacted as substrates with LazC.
[0409] In accordance with the method of Example 2, the precursor peptides shown in Table 32 were prepared, and each precursor peptide was subjected to azole ring, ,-unsaturated amino acid and macrocycle formation reaction.
[0410] See
[0411] As seen from Examples 3 and 4, LazC successfully formed macrocycles from 26-membered to 41-membered rings, demonstrating that LazC has substrate tolerance to the size of a macrocycle.
[Example 5] Ser(4), Cys(5), Ser(6), and Cys(7)-Substituted Analog
[0412] The 4SCSC7_4AAAA7 precursor peptide was prepared by substituting all the amino acid residues Ser(4), Cys(5), Ser(6) and Cys(7), which are converted to azole rings and ,-unsaturated amino acids, by Ala. This precursor peptide was reacted as a substrate with LazC.
[0413] In according with the method of Example 3, a mutant DNA template encoding 4SCSC7_4AAAA7 was prepared and translated in the cell-free translation system to confirm that the mutant precursor peptide of interest was synthesized. Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to the translationally-synthesized mutant precursor peptide and reacted. The reaction product was analyzed by MALDI-TOF MS and LC-MS.
[0414] The amino acid sequence of the prepared 4SCSC7_4AAAA7 precursor peptide is shown in Table 33.
[0415]
[0416] See
[Example 6] Ser(11), Ser(12), Cys(13) or Ser(10)-Substituted Analog
[0417] Mutant precursor peptides were prepared by substituting each of Ser(11), Ser(12), Cys(13) and their neighboring Ser(10) one by one by Ala. These mutant precursor peptides were analyzed for whether to be recognized as a substrate by LazC.
[0418] In according with the method of Example 3, mutant DNA templates encoding respective analogs described in Table 34 were prepared and translated in a cell-free translation system to confirm that the mutant precursor peptides of interest were synthesized. Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to each translationally-synthesized mutant precursor peptide and reacted. The reaction products were analyzed by MALDI-TOF MS and LC-MS.
[0419] Table 34 shows the amino acid sequences of the prepared precursor peptides, and the numbers of azole rings and ,-unsaturated amino acids formed.
[0420]
[0421] See
[Example 7] Trp(2), Gly(3), Gln(8), Ala(9), Gln(15) or Pro(16)-Substituted Analog
[0422] Example 5 demonstrated that macrocyclization proceeds even if Ser(4), Cys(5), Ser(6) and Cys(7) are substituted. Example 6 demonstrated that for the recognition of a substrate by LazC, Ser(11) and Ser(12) are important and Ser(10) and Cys(13) are also relatively important.
[0423] The other amino acids Trp(2), Gly(3), Gln(8) and Ala(9) supposed to be contained in the macrocycle were studied for whether to be substitutable. Also, amino acids exterior to the macrocycle were studied for whether macrocyclization would also proceed in Gln(15) or Pro(16)-substituted analogs.
[0424] In according with the method of Example 3, mutant DNA templates encoding respective precursor peptides described in Table 35 were prepared and translated in the cell-free translation system to confirm that the mutant precursor peptides of interest were synthesized. Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to each translationally-synthesized mutant precursor peptide and reacted. The reaction product were analyzed by MALDI-TOF MS and LC-MS. The results of the LC-MS analysis (MS peaks of leader peptides and macrocyclization products) are shown in
[0425] In the table, the symbol ( ) in 3, (2), etc. represents a minor peak. The same holds true for such symbols in the tables given below.
[0426] Results about the reaction efficiency in substitution of the intra-macrocycle residues (Trp(2), Gly(3), Gln(8), Ala(9), Gln(15) and Pro(16)) are summarized in
[0427] See
[Example 8-1] Substrate Tolerance to Length of Precursor Peptide3
[0428] In order to further study the size of the macrocycle that could be catalyzed by LazC, Ala multiply-inserted precursor peptides were prepared by inserting multiple Ala residues to the 4SCSC7_4AAAA7 precursor peptide, whereas multiply-deleted precursor peptides were prepared by deleting multiple residues therefrom.
[0429] In according with the method of Example 3, mutant DNA templates encoding respective precursor peptides with one to seven Ala residues inserted to the 4SCSC7_4AAAA7 precursor peptide and precursor peptides with one to eight amino acid residues deleted from the 4SCSC7_4AAAA7 precursor peptide were prepared and translated in the cell-free translation system to confirm that the mutant precursor peptides of interest were synthesized. Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to each translationally-synthesized mutant precursor peptide and reacted. The reaction product was analyzed by MALDI-TOF MS and LC-MS.
[0430] Table 36 shows the amino acid sequences of the prepared Ala multiply-inserted and multiply-deleted precursor peptides, and the numbers of azole rings and ,-unsaturated amino acids formed. Similar azole ring formation and ,-unsaturated amino acid formation were seen in the mutant precursor peptides, demonstrating that LazD, LazE, LazF and LazB tolerate these mutant precursor peptides as substrates. This suggests that for the substrate recognition of the azole ring-forming enzymes and the ,-unsaturated amino acid-forming enzymes, distance from a leader peptide region is not important and the arrangement of an amino acid sequence surrounding the residues serving as a substrate is important.
[0431]
[0432] See
[Example 8-2] Substrate Tolerance to Length of Precursor Peptide4
[0433] In order to further study the size of the macrocycle that could be formed by the Laz enzyme group, Ala and Asn multiply-inserted precursor peptides were prepared by inserting multiple Ala and Asn residues to the 4SCSC7_4AAAA7 precursor peptide, whereas multiply-deleted precursor peptides were prepared by deleting multiple residues therefrom.
[0434] In according with the method of Example 3, mutant DNA templates encoding respective precursor peptides with Ala and Asn inserted to the 4SCSC7_4AAAA7 precursor peptide and precursor peptides with amino acid residues deleted from the 4SCSC7_4AAAA7 precursor peptide were prepared and translated in the cell-free translation system to confirm that the mutant precursor peptides of interest were synthesized. Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to each translationally-synthesized mutant precursor peptide and reacted. The reaction products were analyzed by LC-MS. In this experiment, modification reaction mediated by the Laz enzyme group and the formation of a macrocyclization product were confirmed by broad extracted ion chromatograms (brEIC) in which peak(s) detected in the range of 400 or 600 of the tetravalent or pentavalent m/z value of a precursor peptide were integrated. In the brEIC, the presence of a precursor peptide, a linear intermediate peptide having azoline/azole/dehydrated amino acid and a leader peptide fragment (LP-NH.sub.2) through LazC reaction can be confirmed at the same time.
[Example 9-1] Substrate Tolerance of Azole Ring-Forming Enzyme to Cys-Substituted Analog
[0435] In order to determine the substrate recognition of the azole ring-forming enzymes, Cys-substituted precursor peptides were prepared by substituting residues of the core peptide region one by one by Cys, and reacted with the azole ring-forming enzymes.
[0436] In according with the method of Example 3, mutant DNA templates encoding respective Cys-substituted precursor peptides with amino acid residues of the core peptide region substituted one by one by Cys were prepared and translated in the cell-free translation system to confirm that the mutant precursor peptides of interest were synthesized. Subsequently, LazD, LazE and LazF were added to each translationally synthesized mutant precursor peptide and reacted. The reaction products were analyzed by MALDI-TOF MS.
[0437] Table 37 shows the amino acid sequences of the prepared Cys-substituted precursor peptides, and the observed number of azole rings formed. The azole ring-forming enzymes were found to recognize a region rich in Cys or Ser and tend to cause the azole cyclization of Cys or Ser residues in this region.
[0438] See
[Example 9-2] Substrate Tolerance of Macrocyclization to Ala-Substituted Analog
[0439] As in Example 1, mutant DNA templates were prepared by primer extension and PCR and translated in the cell-free translation system to synthesize S1A, W2A, G3A, S4A, C5A, S6A, C7A, Q8A, S10A, S11A, S12A, C13A, Q15A and P16A altered precursor peptides (see
##STR00044##
The sequence identifier of the amino acid sequence is SEQ ID NO: 18.
[0440] Subsequently, each altered precursor peptide mentioned above was reacted as in Example 8-2, and the reaction product was analyzed by LC-MS. Modification reaction mediated by the Laz enzyme group and the formation of macrocyclization products were confirmed by broad extracted ion chromatograms (brEIC) in which peaks detected in the range of 400 of the tetravalent m/z value of a precursor peptide were integrated.
[Example 9-3] Substrate Tolerance of Macrocyclization to Lys-Substituted Analog
[0441] As in Example 1, mutant DNA templates were prepared by primer extension and PCR and translated in the cell-free translation system to synthesize W2K, G3K, A4K, A5K, A6K, A7K, Q8K, A9K, Q15K and P16K altered precursor peptides (see
##STR00045##
The sequence identifier of the amino acid sequence is SEQ ID NO: 38.
[0442] Subsequently, each altered precursor peptide mentioned above was reacted in accordance with the procedures described in Example 9-2, and the reaction product was analyzed by LC-MS. Modification reaction mediated by the Laz enzyme group and the formation of macrocyclization products were confirmed by broad extracted ion chromatograms (brEIC) in which peaks detected in the range of 400 of the tetravalent m/z value of a precursor peptide were integrated.
[Example 9-4] Substrate Tolerance of Macrocyclization to Glu-Substituted Analog
[0443] As in Example 9-3, W2E, G3E, A4E, A5E, A6E, A7E, Q8E, A9E, Q15E and P16E altered precursor peptides (see
[Example 10-1] Substrate Tolerance of Macrocyclization to Ser(10), Ser(11), or Cys(13)-Substituted Analog
[0444] As in Example 1, mutant DNA templates were prepared by primer extension and PCR and translated in the cell-free translation system to confirm that the S10T, S11T, S11C, C13S and C13T altered precursor peptides of interest (see Table 38) were synthesized.
[0445] Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to each of the translationally-synthesized S10T, S11T, S11C, C13S and C13T altered precursor peptides and reacted. Table 39 shows the composition of azole ring, ,-unsaturated amino acid and macrocycle formation reaction. The reaction was performed by incubation at 25 C. for 20 hours. The reaction products were analyzed by MALDI-TOF MS and LC-MS.
[0446] See
TABLE-US-00025 TABLE 39 Azole ring, ,-unsaturated amino acid, and macrocycle formation reaction composition 5.0 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 1 M LazD 1 M LazE 2 M LazF 10 M Producing microbe tRNA.sup.Glu (CUC) 1 M GluRS 2 M LazB 2 M LazC Total volume 30 l
[Example 10-2] Substrate Tolerance of Macrocyclization to Analog (Substitution and Extension) as to C-Terminal Region
[0447] As in Example 1, mutant DNA templates were prepared by primer extension and PCR and translated in the cell-free translation system to obtain the precursor peptides altered in a C-terminal region shown in
[Example 10-3] Substrate Tolerance of Macrocyclization to Analog Having Random Artificial Sequence as Intra-Ring Sequence, and Analog Having Randomized Intra-Ring Sequence and Having Extended C-Terminal Region
[0448] As in Example 1, mutant DNA templates were prepared by primer extension and PCR and translated in the cell-free translation system to obtain the altered precursor peptides of interest having a randomized intra-ring sequence (
[Example 11] Recognition of Leader Peptide
[0449] In order to determine the role of leader peptides in the lactazole biosynthetic enzymes, leader peptide-truncated precursor peptides were prepared and reacted as substrates with each modifying enzyme.
[0450] Mutant precursor peptides were prepared by N-terminally truncating a leader peptide having 38 residues. The prepared mutant precursor peptides contained leader peptides having 30, 25, 20 and 15 residues and were designated as LP-30, LP-25, LP-20, and LP-15, respectively. Azole ring formation reaction, ,-unsaturated amino acid formation reaction and macrocyclization reaction were performed with these four mutant precursor peptides as substrates. The reaction products were analyzed by MALDI-TOF MS and LC-MS to confirm whether the reaction has proceeded or not.
[0451] The amino acid sequences of the prepared leader peptide-truncated precursor peptides are shown in Table 40. The sequence SWGSCSCQASSSCAQP (SEQ ID NO: 18) corresponds to the core peptide region. The N terminus is always formylmethionine because of synthesis by translation. As a result of the azole ring formation reaction mediated by LazD, LazE and LazF and the ,-unsaturated amino acid formation reaction mediated by LazB and LazF with each of the mutant precursor peptides as a substrate, it was found that the azole ring formation and the ,-unsaturated amino acid formation proceeded almost completely up to LP-25, whereas the efficiency of azole ring formation and ,-unsaturated amino acid formation was reduced in LP-20. The results about mass chromatograms are shown in
[0452]
[0453] These results demonstrated that an important site of a leader peptide for the azole ring-forming enzymes and the ,-unsaturated amino acid-forming enzymes in lactazole biosynthesis is a C-terminal side from Leu(25). The results also demonstrated that as for the macrocyclase, reaction proceeds in the presence of at least a C-terminal region from Leu(20).
TABLE-US-00026 TABLE40 Ana- log name Aminoacidsequence LazA* MSDITASRVESLDLQDLDLSELTVTSLR DTVALPENGASWGSCSCQASSSCAQP LP- MVESLDLQDLDLSELTVTSLR 30 DTVALPENGASWGSCSCQASSSCAQP LP- MLQDLDLSELTVTSLR 25 DTVALPENGASWGSCSCQASSSCAQP LP- MLSELTVTSLR 20 DTVALPENGASWGSCSCQASSSCAQP LP- MVTSLR 15 DTVALPENGASWGSCSCQASSSCAQP
From top to bottom, the sequence identifiers are SEQ ID NOs: 103 to 107.
[Example 12] Ala Scanning Experiment of Leader Peptide
[0454] Altered precursor peptides were prepared by substituting each of the amino acid residues positioned from 1 to 25 of the leader peptide in LP-25 shown in
[0455] Specifically, as in Example 1, mutant DNA templates were prepared by primer extension and PCR and translated in the cell-free translation system to confirm that the altered precursor peptides of interest were synthesized as altered forms of the leader peptide site.
[0456] Subsequently, LazD, LazE, LazF, LazB, tRNA.sup.Glu(CUC), GluRS and LazC were added to each translationally-synthesized Ala-inserted precursor peptide and reacted. Table 41 shows the composition of azole ring, ,-unsaturated amino acid and macrocycle formation reaction. The reaction was performed by incubation at 25 C. for 20 hours. The reaction products were analyzed by MALDI-TOF MS and LC-MS.
[0457]
TABLE-US-00027 TABLE 41 Azole ring, ,-unsaturated amino acid, and macrocycle formation reaction composition 5.0 l LazA* 50 mM Tris-HCl pH 8.0 5 mM ATP (adjusted to pH 7.0 with NaOH) 10 mM MgCl.sub.2 1 mM DTT 1 M LazD 1 M LazE 2 M LazF 10 M Producing microbe tRNA.sup.Glu (CUC) 1 M GluRS 2 M LazB 2 M LazC Total volume 30 l
[Example 13] Preparation and Screening of Compound Library
[0458] As shown in
[0459] According to the scheme shown in
[0460] These results showed that the production method of the present invention including using an azole ring-forming enzyme, an ,-unsaturated amino acid-forming enzyme and a macrocyclase can provide a compound library.
[Example 14-1] Synthesis of Cyclic Peptide Containing Non-Proteinogenic Amino Acid
[0461] On the basis of the reprogramming scheme shown in
[0462] In accordance with the method described in Example 1, each DNA template described above was translated and further induced into a cyclic peptide through the step of allowing LazB, LazC, LazD, LazE and LazF enzymes to act. The products after translation and cyclic peptide-formation were measured by LC/MS to confirm whether the translation for the DNA templates harboring the non-proteinogenic amino acids have proceeded, and whether cyclic peptides have been formed. The results are shown in Tables 42 to 44. In the tables, m/z shown in the column Observation results is the observed value of MS, or the value of MS of the cyclic peptide.
[0463] The structures of the introduced non-natural amino acids are as described below.
[0464] In Table 43, v.064 and v.082 denote precursor peptides obtained from DNA templates containing no codon to be reprogrammed. MS of a cyclic peptide was also observed in v.064 and v.082. The obtainment of the cyclic peptides from v.064 and v.082 means that the peptides corresponding to Z and Z in the formula (II) and the formula (III) are not limited by their lengths or types.
##STR00046##
TABLE-US-00028 TABLE42 partA DNA Codon template reprogramming Aminoacidsequenceofprecursorpeptide v.061 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASWGAAAAQASSSCAQP v.061 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASNMeGGAAAAQASSSCAQP v.061 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASNMeAGAAAAQASSSCAQP v.070 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAWAAAAQASSSCAQP v.070 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASANMeGAAAAQASSSCAQP v.070 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASANMeAAAAAQASSSCAQP v.086 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGWAAAQASSSCAQP v.086 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGNMeGAAAQASSSCAQP v.086 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGNMeAAAAQASSSCAQP v.087 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAWAAQASSSCAQP v.087 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGANMeGAAQASSSCAQP v.087 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGANMeAAAQASSSCAQP v.088 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAWAQASSSCAQP v.088 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAANMeAAQASSSCAQP v.089 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAWQASSSCAQP v.089 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAANMeAQASSSCAQP v.074 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAWASSSCAQP v.074 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAANMeGASSSCAQP v.074 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAANMeAASSSCAQP v.074 tgg=F.sub.5Phe MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAf5FASSSCAQP v.074 tgg=cLeu MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAA.sub.cLASSSCAQP v.074 tgg=.sup.OHAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAA.sup.OHAASSSCAQP v.074 tgg=.sup.OHPhe MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAA.sup.OHFASSSCAQP v.074 tgg=.sup.DAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAA.sup.DAASSSCAQP v.075 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAAWSSSCAQP v.075 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAANMeGSSSCAQP v.075 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAANMeASSSCAQP v.077 tgg=A MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAQASSSCAQP v.077 tgg=M MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAGAAAAQASSSCMQP Fromtoptobottom,thesequenceidentifiersareSEQIDNOs:108to136. partB Observation Observation resultsfrom resultsfrom LC-MSof LC-MSof thiopeptide precursor derivative peptide formedafter DNA after Lazenzyme template translation grouptreatment Remarks v.061 m/z=1424.67 m/z=682.28 ~45%Glu [(z=4) (z=2) misincorporation [Cysadduct] v.061 m/z=1395.91 m/z=624.72 (z=4) (z=2) [Cysadduct] v.061 m/z=1399.41 m/z=631.76 (z=4) (z=2) [Cysadduct] v.070 m/z=1428.17 m/z=682.28 (z=4) (z=2) [Cysadduct] v.070 m/z=1399.40 m/z=631.77 (z=4) (z=2) [Cysadduct] v.070 m/z=1402.90 m/z=638.76 (z=4) (z=2) [Cysadduct] v.086 m/z=1413.91 m/z=682.27 Partialhydrolysis (z=4) (z=2) ofprecursorpeptide [MEadduct] v.086 m/z=1385.15 m/z=624.75 (z=4) (z=2) [MEadduct] v.086 m/z=1388.66 m/z=631.75 (z=4) (z=2) [MEadduct] v.087 m/z=1413.92 m/z=682.27 (z=4) (z=2) [MEadduct] v.087 m/z=1385.16 m/z=624.74 (z=4) (z=2) [MEadduct] v.087 m/z=1388.67 m/z=631.75 (z=4) (z=2) [MEadduct] v.088 m/z=1413.92 m/z=682.27 (z=4) (z=2) [MEadduct] v.088 m/z=1388.66 m/z=631.75 (z=4) (z=2) [MEadduct] v.089 m/z=1413.92 m/z=682.27 (z=4) (z=2) [MEadduct] v.089 m/z=1388.66 m/z=631.75 (z=4) (z=2) [MEadduct] v.074 m/z=1410.40 m/z=653.74 Partialhydrolysis (z=4) (z=2) ofprecursorpeptide [Cysadduct] v.074 m/z=1381.65 m/z=596.24 (z=4) (z=2) [Cysadduct] v.074 m/z=1385.16 m/z=603.24 (z=4) (z=2) [Cysadduct] v.074 m/z=1423.14 m/z=679.23 (z=4) (z=2) [Cysadduct] v.074 m/z=1391.65 m/z=616.23 (z=4) (z=2) [Cysadduct] v.074 m/z=1381.91 m/z=596.72 (z=4) (z=2) [Cysadduct] v.074 m/z=1400.92 m/z=634.73 (z=4) (z=2) [Cysadduct] v.074 m/z=1381.66 m/z=596.23 (z=4) (z=2) [Cysadduct] v.075 m/z=1410.42 m/z=653.77 (z=4) (z=2) [Cysadduct] v.075 m/z=1381.65 m/z=596.25 (z=4) (z=2) [Cysadduct] v.075 m/z=1385.15 m/z=603.25 (z=4) (z=2) [Cysadduct] v.077 m/z=1366.15 m/z=624.74 (z=4) (z=2) v.077 m/z=1381.15 m/z=654.74 (z=4) (z=2)
TABLE-US-00029 TABLE43 partA DNA Codon Aminoacidsequenceof template reprogramming precursorpeptide v.080 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAG AAAAQASSSCAWP v.080 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAG AAAAQASSSCANMeGP v.081 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAG AAAAQASSSCAQW v.081 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAG AAAAQASSSCAQNMeG v.081 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASAG AAAAQASSSCAQNMeA v.071 tgg=W MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA WAAAWQASSSCAQP v.071 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA NMeGAAANMEGQASSSCAQP v.071 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA NMeAAAANMeAQASSSCAQP v.072 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA aag=K WAKAWQASSSCAQP v.072 tgg=N.sup.MeAla, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA aag=K NMeAAKANMeAQASSSCAQP v.072 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA aag=N.sup.MeGly WANMeGAWQASSSCAQP v.072 tgg=N.sup.MeAla, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASA aag=N.sup.MeGly NMeAANMeGANMeAQASSSCAQP v.073 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS aag=K WKWKWKQASSSCAQP v.073 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS aag=N.sup.MeGly WNMeGWNMeGWNMeGQASSSCAQP v.100 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS cat=H, AWAHAFQASSSCAQNMeG ttt=F, aag=N.sup.MeGly v.100 tgg=F.sub.5Phe, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS cat=cLeu, A.sub.f5FA.sub.cLANMeAQASSSCAQNMeG ttt=N.sup.MeAla, aag=N.sup.MeGly v.101 tgg=F.sub.5Phe, MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS cat=cLeu, ANMeGA.sub.f5FA.sub.cLQASSSCAQNMeA ttt=N.sup.MeAla, aag=N.sup.MeGly v.064 N.A. MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS WGAAAAAAQASSSCAQPNNLNVG v.082 N.A. MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGAS AGAAAAQASSSCAQPGELARP Fromtoptobottom,thesequenceidentifiersareSEQIDNOs:137 to155. partB Observation results from LC-MSof thiopeptide Observation derivative resultsfrom formed LC-MSof afterLaz precursor enzyme DNA peptideafter group template translation treatment Remarks v.080 m/z= m/z= 1380.68 653.75 (z=4) (z=2) v.080 m/z= m/z= 1351.91 596.24 (z=4) (z=2) v.081 m/z= m/z= 1388.41 669.27 (z=4) (z=2) v.081 m/z= m/z= 1359.66 611.74 (z=4) (z=2) v.081 m/z= m/z= 1363.16 618.75 (z=4) (z=2) v.071 m/z= m/z= 1456.92 746.80 (z=4) (z=2) [Cys adduct] v.071 m/z= m/z= 1399.40 631.76 (z=4) (z=2) [Cys adduct] v.071 m/z= m/z= 1406.42 645.77 (z=4) (z=2) [Cys adduct] v.072 m/z= m/z= 1471.18 775.32 (z=4) (z=2) [Cys adduct] v.072 m/z= m/z= 1420.69 674.31 (z=4) (z=2) [Cys adduct] v.072 m/z= m/z= 1456.94 746.80 (z=4) (z=2) [Cys adduct] v.072 m/z= m/z= 1406.43 645.78 (z=4) (z=2) [Cys adduct] v.073 N.D. m/z= HPLCtailingof 593.59 thiopeptide (z=3) v.073 m/z= m/z= 1485.68 804.32 (z=4) (z=2) [Cys adduct] v.100 m/z= m/z= 1457.18 747.30 (z=4) (z=2) [Cys adduct] v.100 m/z= m/z= 1447.92 728.77 (z=4) (z=2) [Cys adduct] v.101 m/z= m/z= 1447.93 728.75 (z=4) (z=2) [Cys adduct] v.064 m/z= m/z= 1613.02 1058.95 (z=4) (z=2) [Cys adduct] v.082 m/z= m/z= 1541.00 936.42 (z=4) (z=2) [ME adduct]
TABLE-US-00030 TABLE44 partA DNA Codon Aminoacidsequenceof template reprogramming precursorpeptide v.088 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRD TVALPENGASAGAANMeGAQASSSCAQP v.089 tgg=N.sup.MeGly MSDITASRVESLDLQDLDLSELTVTSLRD TVALPENGASAGAAANMeGQASSSCAQP v.074 tgg=.sup.DSer MSDITASRVESLDLQDLDLSELTVTSLRD TVALPENGASAGAAAA.sup.DSASSSCAQP v.077 tgg=F MSDITASRVESLDLQDLDLSELTVTSLRD TVALPENGASAGAAAAQASSSCFQP v.077 tgg=R MSDITASRVESLDLQDLDLSELTVTSLRD TVALPENGASAGAAAAQASSSCRQP v.080 tgg=N.sup.MeAla MSDITASRVESLDLQDLDLSELTVTSLRD TVALPENGASAGAAAAQASSSCANMeAP v.100 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRD cat=H, TVALPENGASAWAHAFQASSSCAQK ttt=F, aag=K v.100 tgg=W, MSDITASRVESLDLQDLDLSELTVTSLRD cat=cLeu, TVALPENGASAWAcLAFQASSSCAQK ttt=F, aag=K Fromtoptobottom,thesequenceidentifiersareSEQIDNos:156to163. partB Observation resultsfrom LC-MSof Observation thiopeptide resultsfrom derivative LC-MSof formedafter DNA precursorpeptide Lazenzyme template aftertranslation grouptreatment Remarks v.088 m/z=1385.16 m/z=624.75(z=2) (z=4) [MEadduct] v.089 m/z=1385.17 m/z=624.75(z=2) (z=4) [MEadduct] v.074 m/z=1385.66 m/z=604.22(z=2) (z=4) [Cysadduct] v.077 m/z=1385.17 m/z=662.77(z=2) (z=4) v.077 m/z=1387.42 m/z=667.29(z=2) (z=4) v.080 m/z=1355.42 m/z=603.24(z=2) (z=4) v.100 m/z=1177.34 m/z=775.83(z=2) (z=5) [Cysadduct] v.100 m/z=1464.95 m/z=762.84(z=2) (z=4) [Cysadduct]
[Example 14-2] Substrate Tolerance of Macrocyclization to Non-Proteinogenic Amino Acid-Substituted Analog N.SUP.Me.Gly
[0465] As in Example 9-2, W2N.sup.MeGly, G3N.sup.MeGly, A4N.sup.MeGly, A5N.sup.MeGly, A6N.sup.MeGly, A7N.sup.MeGly, Q8N.sup.MeGly, A9N.sup.MeGly, C13N.sup.MeGly, A14N.sup.MeGly, Q15N.sup.MeGly and P16N.sup.MeGly altered precursor peptides (see
[Example 14-3] Substrate Tolerance of Macrocyclization to Non-Proteinogenic Amino Acid-Substituted Analog N.SUP.Me.Ala
[0466] As in Example 9-2, W2N.sup.MeAla, G3N.sup.MeAla, A4N.sup.MeAla, A5N.sup.MeAla, A6N.sup.MeAla, A7N.sup.MeAla, Q8N.sup.MeAla, A9N.sup.MeAla, C13N.sup.MeAla, A14N.sup.MeAla, Q15N.sup.MeAla and P16N.sup.MeAla altered precursor peptides (see
[Example 15] Reaction of Precursor Peptide Displayed on mRNA
[0467] In order to reveal that a precursor peptide displayed on mRNA would be modified by lactazole biosynthetic enzymes, the experiment outlined in
[Example 16] Study of Influence of Order of Addition of Enzymes on Reaction
[0468] By changing the order of addition of enzymes to a reaction system, influence of it on the reaction of a precursor peptide was studied.
[0469] The reaction of precursor peptide LazA* in a cell-free translation system was attempted according to the enzyme addition patterns I, II, III and IV shown in
[0470] The results about I, II, III and IV are shown in