Structural-profiling of analytes by nanopore trapping
12613234 ยท 2026-04-28
Assignee
Inventors
Cpc classification
G01N33/48721
PHYSICS
G01N2333/47
PHYSICS
International classification
Abstract
A method of characterizing an analyte or the interaction between the analyte and an agent in a nanopore system, wherein the nanopore system comprises a protein nanopore disposed in a membrane that separates a first conductive liquid medium from a second conductive liquid medium, wherein the protein nanopore is MspA, MspA homolog or variant thereof, wherein the analyte has an conformation and the analyte with the conformation can be accommodated in the vestibule of the MspA, the MspA homolog or the variant thereof but cannot translocate through the MspA, the MspA homolog or the variant thereof, the method comprising: i) applying an electrical potential difference between the first conductive liquid medium and the second conductive liquid medium to drive the analyte into the nanopore, and optionally contacting the agent with the analyte; ii) measuring an ionic current through the protein nanopore to provide a tested current pattern that contains at least ionic current measured during the analyte is in the vestibule of the MspA, the MspA homolog or the variant thereof; iii) associating the tested current pattern with at least one characteristic of the analyte or the interaction between the analyte and an agent.
Claims
1. A method of characterizing an analyte in a nanopore system, wherein the nanopore system comprises a protein nanopore disposed in a membrane that separates a first conductive liquid medium from a second conductive liquid medium, wherein the protein nanopore is MspA, MspA homolog or variant thereof, wherein the analyte has a conformation and the analyte with the conformation can be accommodated in the vestibule of the MspA, the MspA homolog or the variant thereof but cannot translocate through the MspA, the MspA homolog or the variant thereof, the method comprising: i) applying an electrical potential difference between the first conductive liquid medium and the second conductive liquid medium to drive the analyte into the nanopore; ii) measuring an ionic current through the protein nanopore to provide a tested current pattern that contains at least blockade ionic current caused by the analyte accommodated in the vestibule of the MspA, the MspA homolog or the variant thereof; iii) associating the tested current pattern with at least one characteristic of the analyte.
2. The method of claim 1, wherein the analyte is selected from the group consisting of a nucleic acid, a protein, a peptide, a peptide complex, a polysaccharide, a polymer, an enzyme, and a complex of a nucleic acid, a protein, a peptide, a polysaccharide, a polymer, an enzyme and an agent capable of interacting with them.
3. The method of claim 2, wherein the nucleic acid is selected from the group consisting of a LMW RNA, a nucleic acid duplex, an aptamer, a ribozyme or a nucleic acid with a structure of kissing loop, three-way junction, pseudoknot, kink-turn or G-quadruplex; wherein the LMW RNA comprises a siRNA with an overhanged or blunt end, a tRNA, a miRNA and/or a rRNA and wherein the nucleic acid duplex has an overhanged or blunt end.
4. The method of claim 3, wherein the nucleic acid duplex is consisted of a miRNA and a nucleic acid probe, and the nucleic acid probe is an RNA, a DNA or a nucleic acid analogue.
5. The method of claim 1, wherein the analyte comprises two or more different analytes and the characterization of these analytes is completed in one measurement.
6. The method of claim 1, wherein step iii) comprising associating the tested current pattern with at least one characteristic selected from the group consisting of the presence or the absence of the analyte, the identity of the analyte, the sequence of the analyte, the mutations in the analyte, the conformation of the analyte, the local structure of the analyte, the content of the analyte, the overall size of the analyte, the charge of the analyte, and the polarity.
7. The method of claim 1, wherein the analyte is a complex formed by the combination of a target molecule and an assistant molecule.
8. The method of claim 7, wherein step iii) comprises associating the tested current pattern with at least one characteristic of the target molecule.
9. The method of claim 1, wherein step iii) is performed by comparing the tested current pattern with a reference current pattern or by using a machine learning algorithm.
10. The method of claim 1, wherein the conductive liquid medium on the vestibular side of MspA, the MspA homolog or the variant thereof contains monovalent cation, and the conductive liquid medium on the constriction side of MspA, the MspA homolog or the variant thereof contains divalent cation.
11. The method of claim 10, wherein the monovalent cation is alkali metal ion, the divalent cation is alkaline earth metal ion.
12. The method of claim 11, wherein the divalent cation is selected from Ca.sup.2+, Mn.sup.2+, Mg.sup.2+ and Ba.sup.2+, and the monovalent cation is selected from K.sup.+, Na.sup.+ and Li.sup.+.
13. A method for characterizing the interaction between an analyte and an agent or the agent capable of interacting with the analyte in a nanopore system, wherein the nanopore system comprises a protein nanopore disposed in a membrane that separates a first conductive liquid medium from a second conductive liquid medium, wherein the protein nanopore is MspA, MspA homolog or variant thereof, wherein the analyte has a conformation and the analyte with the conformation can be accommodated in the vestibule of the MspA, the MspA homolog or the variant thereof but cannot translocate through the MspA, the MspA homolog or the variant thereof, the method comprising: i) contacting the analyte with the agent, and driving the analyte into the nanopore by an electrical potential difference between the first conductive liquid medium and the second conductive liquid medium; ii) measuring an ionic current through the protein nanopore to provide a tested current pattern that contains at least ionic current measured during the analyte is in the vestibule of the MspA, the MspA homolog or the variant thereof; iii) associated the current pattern with the interaction between the analyte and the agent or with the agent.
14. The method of claim 13, wherein the analyte is selected from the group consisting of a nucleic acid, a protein, a peptide, a polysaccharide, a polymer and an enzyme, or the analyte can interact with an ion, a small molecule, a ligand, a receptor or a substrate, and the agent is an ion, a small molecule, a ligand, a receptor or a substrate.
15. The method of claim 14, wherein the analyte is an aptamer, a ribozyme, a calmodulin, a lysozyme or a myoglobin.
16. The method of claim 13, wherein the agent is a polysaccharide, peptidoglycan, chitosan or chitin.
17. A method for detecting an analyte of interest in a sample in a nanopore system, wherein the nanopore system comprises a protein nanopore disposed in a membrane that separates a first conductive liquid medium from a second conductive liquid medium, wherein the protein nanopore is MspA, the MspA homolog or the variant thereof, wherein the analyte of interest has a conformation and the analyte of interest with the original conformation can be accommodated in the vestibule of MspA, the MspA homolog or the variant thereof but cannot translocate through MspA, the MspA homolog or the variant thereof, the method comprising: i) adding the sample to the at least one of the first conductive liquid medium from a second conductive liquid medium and applying an electrical potential difference between the first conductive liquid medium and the second conductive liquid medium that is suitable for driving the analyte of interest into the nanopore; ii) measuring an ionic current through the protein nanopore for a period of time to provide a tested current pattern; iii) comparing the tested current pattern which comprises at least ionic current trace measured during the analyte of interest is in the vestibule of MspA, the MspA homolog or the variant thereof with a reference current pattern; iv) determining the presence or the absence of the analyte of interest in the sample and/or the content of the analyte of interest in the sample by the comparison of iii).
18. The method of claim 17, wherein the analyte is whey protein, -lactalbumin and/or -lactoglobulin.
19. The method of claim 17, wherein the sample is milk or protein powder.
20. The method of claim 17, wherein the analyte of interest is selected from the group consisting of a nucleic acid, a protein, a polysaccharide, a polymer and an enzyme.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
(65)
(66)
(67)
(68)
(69)
(70)
(71)
(72)
(73)
(74)
(75)
(76)
(77)
(78)
(79)
(80)
(81)
(82)
(83)
(84)
(85)
(86)
(87)
(88)
(89)
(90)
(91)
(92)
(93)
(94)
(95)
(96)
(97)
(98)
(99)
(100)
(101)
(102)
DETAILED DESCRIPTION OF THE INVENTION
(103) It should be understood that this invention is not limited to particular embodiments described. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
(104) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are to disclose and describe the methods and/or materials in connection with which the publications are cited.
(105) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit, and the intervening range between the upper and lower limit of that range, is encompassed within the invention, unless the context clearly dictates otherwise. Where the stated range includes one or both of the limits, ranges excluding either or both of the limits included limits are also included in the invention.
(106) It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to an analyte includes one analyte and a plurality of different analytes and reference to the molecule includes reference to one or more molecules. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as solely, only and the like in connection with the recitation of claim elements, or use of a negative limitation.
(107) The term comprise, include, contain and variations of these terms, such as comprising, comprises and comprised, are not intended to exclude further additions, components, integers or steps. These terms also encompass the meaning of consist of or consisting of.
(108) the term about refers to a range equal to the particular value plus or minus twenty percent (+20%).
(109) The term and/or refers to any one, any few or all of the elements connected by the term.
(110) It should be understood that the method of the present invention may be performed in vivo, in vitro, or ex vivo. The method of the present invention may be not for the purpose of disease treatment, and/or not for the purpose of disease diagnosis.
(111) It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. All combinations of the embodiments pertaining to the invention are specifically embraced by the present invention and are disclosed herein just as if each and every combination was individually and explicitly disclosed. In addition, all sub-combinations of the various embodiments and elements thereof are also specifically embraced by the present invention and are disclosed herein just as if each and every such sub-combination was individually and explicitly disclosed herein.
(112) Mycobacterium smegmatis porin A (MspA) is a conically shaped biological nanopore composed of rigid -barrel structures.sup.28. Previous reports indicate that the pore in an octameric form possesses an incredible stability and consistency against extreme conditions.sup.29. Its narrow constriction, measuring 1.2 nm in diameter is advantageous in applications of nanopore sequencing.sup.30 or nanopore force spectroscopy.sup.31. On the other side, the inventors found that its large vestibule, which measures 4.8 nm in diameter, would permit transient accommodation of a large analyte in its native form by nanopore trapping. Surprisingly, this geometric advantage has however been ignored since its original report.
(113) We here propose a new sensing mode with MspA, termed nanopore trapping/translocation, with which direct discrimination between differently structured low molecular weight (LMW) RNAs such as miRNA, overhanged siRNA, blunt siRNA, tRNA or 5s rRNAis reported. The RNA structure is profiled in its folded form during trapping. Translocation is not strictly needed and no denaturant or sample ligation is required. Complementary to existing developments of large channel proteins, advantages such as the efficiency of pore preparation, the ease of spontaneous pore insertion, the high consistency of pore assembly, the extremely long storage time and a high spatial resolution are all gained (
(114) Mycobacterium smegmatis porin A (MspA) is a conically shaped biological nanopore with a 4.8 nm diameter opening and a 1.2 nm constriction. The -barrel constriction has a desirable mechanical rigidity,.sup.159 which serves to maintain a consistent pore assembly stable in extreme pH, temperature or detergent environments. More importantly, this constriction is critical to minimizing the measurement noises caused by structural fluctuations of the pore..sup.160 Acknowledging the high spatial resolution offered by its conical geometry, MspA was the first type of nanopore used in nanopore sequencing.sup.161 and applications of nanopore tweezers adapting a similar scheme..sup.162 Its large channel conductance and low measurement noise have also enabled studies of single molecule chemistry within the pore lumen..sup.163,164 Design of these applications has benefitted from its rigid and narrow constriction, but the use of its large vestibule has unfortunately been quite overlooked since its original report.
(115) In this work, we describe a previously unreported sensing mode called MspA nanopore trapping, in which large analytes such as proteins, may be lodged in the pore vestibule from where they can report sensing information. The narrow pore constriction does not permit direct passage of the protein through the pore but stochastic sensing of individual analytes can be achieved by probing spontaneous trapping and subsequent escape from the pore, which results in stochastic events during single channel recordings. Characteristic trapping events, which may reflect the overall size, charge, polarity and conformational changes of the protein can be analyzed to study the kinetics of conformational changes or ligand binding of a protein with a high resolution. To the best of our knowledge, direct sensing of proteins by MspA has not been reported previously. Advantages of MspA in this sensing scenario include an improved sensing resolution resulted from a sharp and rigid pore structure, ease of pore preparations and structural stability against extreme measurement or storage conditions.
(116) Calmodulin (CaM), a calcium-binding 17 kDa messenger protein, was examined as a proof of concept. In eukaryotes, wild-type CaM (wtCaM) serves as a critical link in the signal transduction pathway between Ca.sup.2+ and target proteins. Previous investigations performed by small-angle X-ray scattering (SAXS) and 3D/4D heteronuclear NMR spectroscopy have provided an accurate structure of CaM,.sup.165, 166 and revealed that the signal transduction pathway is achieved by two step allosterism of wtCaM. The Ca.sup.2+-free CaM (apo-wtCaM) first coordinates with Ca.sup.2+ leading to the Ca.sup.2+-bound form of CaM (Ca-wtCaM) and an overall structural change from a loose and flexible shape to a rigid dumbbell-shape (
(117) In summary, the inventors found that a blockade current pattern during the presence of an analyte in the vestibule of MspA is sufficient to characterize an analyte or the interaction between the analyte and an agent. Measurement of the blockade current during the translocation of the analyte through the constriction zone of MspA is not necessary, but it can also be combined with the blockade current of the analyte in the vestibule to provide a current pattern for characterizing the analyte or the interaction between the analyte and an agent. This finding is particularly meaningful for detecting the conformation of molecules, as well as those events or features related to the conformation (for example, events or features that can cause changes in the conformation of the molecule).
(118) Nanopore
(119) The term nanopore, as used herein, generally refers to a pore, channel or passage which has a very small diameter on the order of nanometers and extends through a membrane. A nanopore may have a characteristic width or diameter on the order of 0.1 nanometers (nm) to about 1000 nm. Some nanopores are proteins. MspA is an example of a protein nanopore.
(120) The term MspA, as used herein, generally refers to Mycobacterium smegmatis porin A. Sequence of wild type MspA are known by the person skilled in the art. For example, sequences of wild type MspA can be found in GenBank on https://www.ncbi.nlm.nih.gov/. In some embodiments, the wild-type MspA may have the following amino acid sequence:
(121) TABLE-US-00001 (SEQIDNO:1) GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYI VAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPP FGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNA HGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN.
(122) In some embodiments, the wild-type MspA may be consisted of SEQ ID NO: 1.
(123) A homolog (such as ortholog or paralog) of MspA may also be used as the nanopore herein. The term homolog, as defined herein, is a gene that has a similar structure and function with another gene. A homolog may have a sequence identity of at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% compared to its counterpart. The term homolog is sometimes used to apply to the relationship between genes separated by the event of speciation (see ortholog) or to the relationship between genes separated by the event of genetic duplication (see paralog). The term ortholog refers to genes in different species that evolved from a common evolutionary origin. The term paralog refers to genes related by duplication within a genome. Examples of paralog of MspA include MspB, MspC, and MspD. Examples of ortholog of MspA include MppA, PorM1, PorM2, PorM1, and Mmncs4296.
(124) A variant of MspA or MspA homolog may also be used as the nanopore herein. A variant may have one or more additions, substitutions and/or deletions of amino acids compared to their wild-type ones, or may have a sequence identity of at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% compared to the corresponding wild-type MspA or MspA homolog, and retains tunnel-forming capability.
(125) The person skilled in the art readily understand how to determine the identity of two polypeptides. For example, the identity can be calculated after aligning the two sequences so that the identity is at its highest level. For example, to determine the percent identity of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences may be a function of the number of identical positions shared by the sequences (i.e., percent identity=number of identical positions/total number of positions (e.g., overlapping positions)100). In one embodiment, the two sequences are the same length. Sequence identity can be determined in a number of different manners and through a number of algorithms. To determine sequence identity, sequences can be aligned using various methods and computer programs (e.g., BLAST, T-COFFEE, MUSCLE, MAFFT, etc.), available over the world wide web at sites including ncbi.nlm.nili.gov/BILAST, ebi.ac.uk/Tools/msa/tcoffee/, ebi.ac.uk/Fools/msa/muscle/, mafft.chr.jp/alignment/software/. See, e.g., Altschul et al. (1990), J. Mol. Bioi. 215:403-40.
(126) In some embodiments, a variant is one having a mutation (such as one or more additions, substitutions and/or deletions of amino acids in the constriction zone and/or the vestibule of a wild-type MspA or a wild-type MspA homolog. In some embodiments, a mutation may occur in the rim or the outside of the periplasmic loops of a wild-type MspA or a wild-type MspA homolog.
(127) In some embodiments, a variant of MspA or a MspA homolog, may comprise at least one additional positively charged amino acid, at least one additional negatively charged amino acid, at least one less positively charged amino acid or at least one less negatively charged amino acid compared to a wild-type MspA or a wild-type MspA homolog in the vestibule and/or the constriction zone.
(128) In some embodiments, one or more positively charged amino acid in the vestibule and/or the constriction zone of a wild-type MspA or a wild-type MspA homolog is replaced with a negatively charged amino acid, and each negatively charged amino acid is the same or different; or one or more negatively charged amino acid in the vestibule and/or the constriction zone of a wild-type MspA or a wild-type MspA homolog is replaced with a positively charged amino acid, and each positively charged amino acid is the same or different.
(129) In some embodiments, the vestibule and/or the constriction zone of a variant of a MspA or a MspA homolog comprises a greater number of positively charged residues than a wild-type MspA or a wild-type MspA homolog, or the vestibule and/or the constriction zone comprises a greater number of negatively charged residues than a wild-type MspA or a wild-type MspA homolog; or at least one positively charged amino acid in the vestibule and/or the constriction zone of a wild-type MspA or a wild-type MspA homolog, is either deleted or replaced by a negatively charged amino acid; or at least one negatively charged amino acid in the vestibule and/or the constriction zone of a wild-type MspA or a wild-type MspA homolog is either deleted or replaced by a positively charged amino acid.
(130) In some embodiments, a variant of Msp may comprise (i) mutations such that amino acid positions 90, 91, and 93 contain amino acids with a neutral charge and (ii) one or more mutations at the following amino acid positions: 88, 105, 108, 118, 126, 134, 138 or 139. In some embodiments, a variant MspA may comprise mutations of D90N/D91N/D93N or D93N/D91N/D90N/D118R/D134R/E139K compared to the wild-type MspA. D90N/D91N/D93N or D93N/D91N/D90N/D118R/D134R/E139K means that the mutant comprises simultaneously all of listed six mutations. In some embodiments, a variant of MspA may only has the mutations of D90N/D91N/D93N (M1 MspA) or D93N/D91N/D90N/D118R/D134R/E139K (M2 MspA) compared to the wild-type MspA. The number used herein identifies the location of site directed mutagenesis, where the first amino acid immediately after the start codon is defined as 1.
(131) In the present invention, MspA, MspA homology or a variant thereof may be recombinant protein.
(132) Preferably, MspA, MspA homology or a variant thereof used in the present invention does not gate spontaneously, even at 150 mV-200 mV or more. To gate or gating refers to the spontaneous change of electrical conductance through the tunnel of the protein that is usually temporary (e.g. lasting for as few as 1-10 milliseconds to up to a second). For some protein nanopore, the probability of gating increases with the application of higher voltages. Typically, the protein becomes less conductive during gating, and conductance may permanently stop (i.e., the tunnel may permanently shut) as a result, such that the process is irreversible. Optionally, gating refers to the conductance through the tunnel of a protein spontaneously changing to less than 75% of its open state current.
(133) MspA, MspA homology or a variant thereof discussed herein may comprise a vestibule having a length from about 2 to about 6 nm and a diameter from about 2 to about 6 nm, and a constriction zone having a length from about 0.3 to about 3 nm and a diameter from about 0.3 to about 3 nm, wherein the vestibule and constriction zone together define a tunnel.
(134) Avestibule refers to the cone-shaped portion of the interior of an MspA, MspA homology or a variant thereof whose diameter generally decreases from one end to the other along a central axis, where the narrowest portion of the vestibule is connected to the constriction zone.
(135) When referring to a diameter of the vestibule, it is understood that because the vestibule is cone-like in shape, the diameter changes along the path of a central axis, where the diameter is larger at one end than the opposite end. The diameter may range from about 2 nm to about 6 nm. When referring to diameter herein, one may determine a diameter by measuring center-to-center distances or atomic surface-to-surface distances.
(136) Aconstriction zone refers to the narrowest portion of the tunnel of an MspA, MspA homology or a variant thereof, in terms of diameter, that is connected to the vestibule.
(137) As known by the person skilled in the art, a MspA nanopore can comprise two or more MspA monomers (e.g., eight monomers), which associate with each other and form a tunnel, wherein each monomer may be the same of different. MspA nanopore may be an octameric MspA. The MspA, MspA homology or a variant thereof, as used herein, should be capable of forming nanopore. Any one MspA monomer that formed the MspA porin may be selected from the group consisting of MspA, MspA homology and a variant thereof. In some embodiments, all monomers in a MspA nanopore are the same, such as the same variant of MspA monomers. In some embodiments, a MspA nanopore may contain one or more variants of MspA monomers. In some embodiments, all of the monomers in a MspA nanopore are the same or different variants of MspA monomers.
(138) The preparation method of a MspA, MspA homology or a variant thereof is known by the person skilled in the art, for example, it could be prepared by prokaryote expression and easily purified by chromatography.
(139) Unless otherwise stated, in the following detailed description of Nanopore system, Characterization of an analyte or the interaction between an analyte and an agent and Analytes and agents, MspA represents MspA. MspA homology or a variant thereof.
(140) Nanopore System
(141) A nanopore system typically comprises a nanopore disposed in a membrane that separates a first conductive liquid medium from a second conductive liquid medium. The tunnel of the nanopore is the only path for the first conductive liquid medium and the second conductive liquid medium to communicate. Generally, an analyte is added in at least one of the first conductive liquid medium and the second conductive liquid medium. The membrane can be an organic membrane, such as a lipid bilayer, or a synthetic membrane, such as a membrane formed of a polymeric material. The thickness of the membrane through which the nanopore extends can range from 1 nm to around 10 m.
(142) The preparation of a nanopore system is well known, for example, when a porin (such as MspA) is placed in any one of a first conductive liquid medium and a second conductive liquid medium separated by a membrane (such as a lipid bilayer), the protein can insert spontaneously into the membrane to form a nanopore.
(143) When an electrical potential difference is applied between the first conductive liquid medium and the second conductive liquid medium (i.e., an electric field or a voltage is applied across the nanopore), an ionic current is generated through the tunnel of the nanopore, and the analyte may be electrophoretically driven into the nanopore from the conductive liquid medium and continue to electrophoretically move in a direction from one side of the nanopore to the other side. The electrical potential difference may be no less than 50 mV, no less than 100 mV, no less than 150 mV or no less than 200 mV; or range from about 50 mV to 200 mV, range from about 100 mV to 200 mV, range from about 150 mV to 200 mV. An analyte with positive charge electrophoretically moves to the side with lower potential. An analyte with negative charge electrophoretically moves to the side with higher potential. The direction of movement of the analyte can be controlled by adjusting the electric field. In some cases, the charge of the analyte depends on the pH of the medium, for example, when the analyte is a protein, the direction of movement of the analyte can also be controlled by adjusting the pH of the conductive liquid medium. The analyte may also be driven by a non-electrophoretic mean. In some embodiments, the electrical potential on the side of the constriction zone of MspA is higher than the electrical potential on the side of the vestibule of MspA. In some embodiments, the analyte is electrophoretically driven into the vestibule of MspA from the conductive liquid medium and continue to electrophoretically move in a direction from the vestibule of the nanopore to the constriction zone.
(144) In some embodiments, the electrical potential difference between the first conductive liquid medium and the second conductive liquid medium varies or remains constant. Process and apparatus for applying an electric field to a nanopore are known to the person skilled in the art. For example, a pair of electrodes may be used to applying an electric field to a nanopore. As will be understood, the voltage range that can be used can depend on the type of nanopore system and the analyte being used.
(145) The entry of the analyte into the nanopore (such as in the vestibule or the constriction zone) causes a blockage of to the ionic current, which is measurable, for example, by measuring the current after the analyte enters the nanopore and comparing it with the open pore current.
(146) In general, a blockage of the ionic current may also be called a blockade current, which is evidenced by a change in ionic current that is clearly distinguishable from noise fluctuations and is usually associated with the presence of an analyte molecule within the nanopore. The strength of the blockade, or change in current, will depend on a characteristic of the analyte. More particularly, blockage may refer to an interval where the ionic current drops to a level which is about 5-100% lower than the unblocked current level, remains there for a period of time, and returns spontaneously to the unblocked level. For example, the blockade current level may be about, at least about, or at most about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% lower than the unblocked current level. A blockage may be called a blockade event or an event.
(147) Measurement of the current through a nanopore are well known in the art and may be performed by way of optical signal or electric current signal. For example, one or more measurement electrodes could be used to measure the current through the nanopore. These can be, for example, a patch-clamp amplifier or a data acquisition device.
(148) Aliquid medium includes aqueous, organic-aqueous, and organic-only liquid media. Organic media include, e.g., methanol, ethanol, dimethylsulfoxide, and mixtures thereof. Liquids employable in methods described herein are well-known in the art. Descriptions and examples of such media, including conductive liquid media, are provided in U.S. Pat. No. 7,189,503, for example, which is incorporated herein by reference in its entirety. Salts, detergents, or buffers may be added to such media. Such agents may be employed to alter pH or ionic strength of the liquid medium. Since it is not necessary for the method of the present invention to translocate the analyte through the nanopore, the liquid medium does not need to include a velocity-altering agent, such as glycerol or various polymers (e.g., polyvinylpyrrolidone, polyethylene glycol, polyvinyl alcohol, cellulose polymers) and mixtures thereof, to increases or decreases the velocity of an analyte. For example, in this invention, the first conductive liquid medium and the second conductive liquid medium may independently be buffer solution comprising an alkali metal ion, such as KCl. The buffering agent may be HEPES or Tris, etc. The pH of the first conductive liquid medium and/or the second conductive liquid medium may be 1.0-13.0, preferably 6.0-8.0, preferably 7.0-7.5, which may depend on the desired charge properties of the analyte. In some embodiments, the concentration of KCl is 1.5 M KCl.
(149) In some embodiments, the nanopore system includes a symmetric buffer combination or an asymmetric buffer combination. A symmetric buffer combination means that the first conductive liquid medium and the second conductive liquid medium are the same. An asymmetric buffer combination means that the first conductive liquid medium and the second conductive liquid medium are different. An asymmetric buffer combination may facilitate the entry of the analyte into the nanopore. In the asymmetric buffer combination, one of the first conductive liquid medium and the second conductive liquid medium comprises monovalent cation, preferably an alkali metal ion, and more preferably selected from K.sup.+, Na.sup.+ and Li.sup.+, and the other comprises divalent cation, preferably alkaline earth metal ion, preferably selected from Ca.sup.2+, Mn.sup.2+, Mg.sup.2+ and Ba.sup.2+. Preferably, the liquid medium that comprises monovalent cation does not comprise divalent cation.
(150) Although not intending to be bound by theory, it is believed that the benefit of the asymmetric buffer combination should result from an increased electroosmotic flow induced by coordination interactions between divalent cation (such as alkaline earth metal ion, for example, Ca.sup.2+, Mn.sup.2+, Mg.sup.2+ and Ba.sup.2+) and amino acid residues in the pore lumen.
(151) The asymmetric buffer is particularly useful for the simultaneous analysis or sequential analysis of a variety of different analytes. These analytes may have different charges and move in different directions under the action of electrophoretic force. However, in the asymmetric buffer, due to the effect of electroosmotic flow, the analytes having different charge can all move in one direction, making it possible to analyze them simultaneously or sequentially.
(152) In some embodiments, the conductive liquid medium on the side of the vestibule of MspA comprises monovalent cation, and the conductive liquid medium on the side of the constriction zone of MspA comprises divalent cation. In some embodiments, the electrical potential on the side of the constriction zone of MspA is higher than the electrical potential on the side of the vestibule of MspA, and the direction of the electroosmotic flow is from the vestibule of MspA to the constriction zone.
(153) Characterization of an Analyte or the Interaction Between an Analyte and an Agent
(154) For analytes with a certain conformation, such as analytes with secondary structure, tertiary structure, or three-dimensional structure, they generally cannot translocate through the constriction zone of MspA while maintaining their conformation due to the size. In a conventional MspA nanopore detection method, such analytes need to be unfolded or unzipped by additional means to become a linear single-chain to translocate through the nanopore.
(155) The inventors found that as long as the analyte enters the vestibule of MspA, even if it does not translocate through the constriction zone of the nanopore, it can produce blockage information sufficient to distinguish different analytes. Since the vestibule of MspA is large enough, the analyte can enter the vestibule in its original conformation. Therefore, the current pattern containing the ionic current measured during the analyte is in the vestibule of MspA can be used to distinguish analytes with different conformation. The method of the present invention requires no prior chemical treatment or amplification of the analyte. The analyte does not need to be denatured (such as unfolded or unzipped) or connected to a molecular motor.
(156) A current pattern can be provided by measuring the ionic current through a nanopore for a period of time, during which the analyte can enter and stay in the vestibule of MspA and/or continue to be unfolded or unzipped and move through the constriction zone. A period of time, as used herein, is long enough so that the current pattern contains at least one complete event.
(157) Some analytes, such as proteins or nucleic acid duplex with blunt end, are difficult to be unfolded in an electric field. They enter the vestibule of MspA under the action of electrophoretic force and/or electroosmotic flow and move along the direction from the vestibule to the constriction zone, but are blocked outside the constriction zone due to their size, thereby being trapped (or lodged) in the vestibule. In this case, the greater the electric potential difference between the first conductive liquid medium and the second conductive liquid medium, the deeper the analyte enters into the nanopore, it can even reach the junction between the vestibule and the constriction pore, and is lodged there. At this time, the amplitude of the blockage is the largest, the blockade signal is the strongest and the resolution is also the highest. Therefore, the resolution can be improved by increasing the potential difference, which may be equal or greater than 50 mV, equal or greater than 100 mV; equal or greater than 150 mV or equal or greater than 200 mV. The ionic current measured during the analyte is present in the vestibule may provide information about the original conformation of the analyte, which may be related to multiple aspects of the analyte, such as identity, sequence, types, interaction with an agent, etc., or any combination thereof.
(158) After the measurement is completed, a reverse voltage can be applied to drive the analyte to move in a reverse direction (i.e., in a direction from the constriction zone to the vestibule) and exit the nanopore. Then, the voltage direction is changed again, and the next measurement can be performed. In the next measurement, different analytes or different interactions can be measured. Therefore, the method of the present invention can repeatedly use the same nanopore system for multiple detections.
(159) Some other analytes, such as a nucleic acid with an overhanged end (such as tRNA, sRNA, or nucleic acid duplex with an overhanged end), although cannot translocate through the constriction zone of MspA in its original conformation, may be unfolded or unzipped under the action of the electric field to form a linear single-chain, which can translocate through the constriction zone of MspA. In this case, a current pattern that only contains the ionic current measured during the analyte is in the vestibule of MspA, or a current pattern that contains the ionic current measured during the analyte is in the vestibule of MspA and the ionic current measured during the unfolded or unzipped analyte translocates through the constriction zone can be used to characterize the analyte or the interaction between the analyte and an agent. The ionic current measured during the analyte is present in the vestibule may provide different information from those the ionic current measured during the unfolded or unzipped analyte is translocating through the constriction zone, for example, the ionic current measured during the analyte is present in the vestibule may provide information about the original conformation of the analyte, which may be associated with multiple aspects of the analyte, such as identity, sequence, types, interaction with an agent, etc., or any combination thereof.
(160) A current pattern that contains at least the ionic current measured during the analyte is in the vestibule of MspA can be used to characterize the analyte itself and the interaction between the analyte and an agent. As can be understood, the current pattern that can be used to characterize the analyte itself and the interaction between the analyte and an agent may be either a current pattern that only contains the ionic current measured during the analyte is in the vestibule of MspA, or a current pattern that contains the ionic current measured during the analyte is in the vestibule of MspA and the ionic current measured during other stage (such as during the unfolded or unzipped analyte translocate through the constriction zone). The required current pattern (such as a current pattern that only contains the ionic current measured during the analyte is in the vestibule of MspA) can be extracted from a current record over a period of time, for example, according the characteristics of the current trace, e.g., blockage amplitude, etc. The person skilled in the art know how to distinguish the ionic current measured at different stage (such as during the analyte is in the vestibule of MspA or during the analyte translocate through the constriction zone of MspA). For example, the blockage amplitude of the ionic current trace during the analyte is present in the vestibule is generally shallower (which means a higher current level) than the blockage amplitude of the ionic current trace during the unfolded or unzipped analyte translocates through the constriction zone.
(161) When the analyte itself is to be characterized, the analyte can be added in any one of the first conductive liquid medium and the second conductive liquid medium, preferably in the conductive liquid medium on the side of the vestibule of MspA, such that the analyte can enter the vestibule of MspA from the conductive liquid medium under the action of electrophoretic force and/or electroosmotic flow. When the analyte itself is to be characterized, preferably, the current is measured in absence of any agent that is capable of interacting with the analyte.
(162) When the interaction between an analyte and an agent is to be characterized, the interaction may be the binding or dissociation of the analyte and the agent. The analyte can be any molecule with a conformation, including nucleic acid, protein, polysaccharides, polymer, enzyme, etc. The agent can be any substance that can interact, such as bind to, the analyte. Examples of the agent include ion, small molecule, ligand, receptor, substrate for an enzyme, etc. Preferably, the size of the agent allows it to pass freely through the constriction zone of MspA.
(163) When the interaction between an analyte and an agent is to be characterized, both the analyte and the agent are added in any one of the first conductive liquid medium and the second conductive liquid medium, such that the analyte can enter the vestibule of MspA from the conductive liquid medium under the action of electrophoretic force and/or electroosmotic flow and can contact the agent. Preferably, the analyte is added in the conductive liquid medium on the side of the vestibule of MspA, such that the analyte can enter the vestibule of MspA from the conductive liquid medium under the action of electrophoretic force and/or electroosmotic flow. The agent can be added in the conductive liquid medium on the same side with the analyte, or can be added in the conductive liquid medium on the opposite side of the analyte, or can be added in the conductive liquid medium on both sides. For example, the analyte is added in the first conductive liquid medium, and the agent is added in the first conductive liquid medium, the second conductive liquid medium or both. The analyte and the agent can be added in the conductive liquid medium simultaneously or sequentially. The analyte can be brought into contact with the agent in the conductive liquid medium first, and then an electric field can be applied to drive the analyte into the vestibule of MspA, or the analyte can be first driven into the vestibule of MspA, and then the agent is added to contact the analyte.
(164) A current pattern and a current trace, as used herein, may be used interchangeably, refer to the ionic current over time. A current pattern may contain one or more types of blockade event, and may contain one or more individual blockade events of the same type. Characteristics about distribution, frequency, amplitude, etc. of the blockade events can be learned from the current pattern.
(165) Event, as used herein, refers to a blockage of the nanopore by an analyte (i.e., an interval where the ionic current drops to a level which is about 5-100% lower than the unblocked current level, remains there for a period of time, and returns spontaneously to the unblocked level), and also refers to a current change caused by the blockage. The person skilled in the art know how to determine the occurrence of an event.
(166) A variety of characteristic parameters can be obtained from the current pattern. The characteristic parameters include, but not limit to, features of individual events, such as first blockade amplitude (first I.sub.b, which is also called first current level position), second blockade amplitude (second I.sub.b, which is also called second current level position), dwell time (t.sub.off), noise current level, minimum current, maximum current, median current, mean current, standard deviation, kurtosis and skewness of individual events. The characteristic parameters may further include events frequency, which is the frequency that the events of the same type occurs. The characteristic parameters may further include other features, such as blockage ratio (I/I.sub.0, wherein I=I.sub.0I.sub.0, or % I.sub.b, which is defines as (I.sub.0I.sub.b)/I.sub.0), capture frequency (k.sub.on, as defined by the equation 1/.sub.on=k.sub.on.Math.c, serves to evaluate the ability of nanopore trapping when different analytes were applied); inter-event duration (t.sub.on), blockade current distributions and open pore current (I.sub.0). One or more of these characteristic parameters can be used to characterize an analyte or the interaction between an analyte and an agent. In some embodiments, blockade amplitude (such as the first blockade amplitude and the second blockade amplitude) can be used to characterize an analyte or the interaction between an analyte and an agent, such as the identity of the analyte and/or the identity of the agent. In some embodiments, events frequency can be used to characterize an analyte or the interaction between an analyte and an agent, such as the quantity (or content) of the analyte, wherein the higher the events frequency is, the higher the analyte content is.
(167) The characterization of an analyte, an agent or the interaction between an analyte and an agent may include associating the current pattern with at least one characteristic of the analyte, the agent the interaction between the analyte and an agent, for example, based on the features of the current pattern (such as the characteristic parameters mentioned above). Therefore, at least one characteristic of the analyte, the agent or the interaction between the analyte and an agent can be determined based on the current pattern. Generally, said characteristics or said interaction between the analyte and an agent confers the analyte a specific conformation, which corresponds to a specific current pattern through the nanopore. In other words, analytes or agents that differ in said characteristics, or different combination of the analytes and the agents will have different conformations, which correspond to different current patterns through the nanopore, such that said different analytes or agents or the different combination of the analytes and the agents can be distinguished by their respective current pattern.
(168) The characteristics of the analyte or the agent may be any characteristic related to the conformation of the analyte or the agent, including, but not limited to, presence or absence of the analyte or the agent, the identity of the analyte or the agent, the sequence of the analyte or the agent, the mutations (such as number, position, or the identity of mutated nucleotide acids or mutated amino acids) in the analyte or the agent, the conformation of the analyte or the agent, the secondary structure, tertiary structure or local structure (such as the end structure of a nucleic acid, which may be overhanged or blunt) of the analyte or the agent, the content of the analyte or the agent, the overall size of the analyte or the agent, the charge of the analyte or the agent, the polarity of the analyte or the agent. Identity of the analyte or the agent refers to the distinguishing character of the analyte or the agent. Identity of the analyte or the agent may be the distinguishing character of a group of substances, which are the same regarding the distinguishing character and can be distinguished from other group of substances by the conformation. Identity may be or the distinguishing character of an individual substance. For example, the identity of an analyte or the agent may refer to that the analyte is a nucleic acid, a protein, a polysaccharide, a polymer or an enzyme. The identity of a RNA analyte may refer to that the RNA analyte is tRNA, siRNA, 5S rRNA, 16S rRNA, 18S rRNA, or 23S rRNA. The identity of a protein analyte or agent may refer to the protein is a specific protein, which can be distinguished from other specific proteins by the conformation.
(169) Associating the current pattern with at least one characteristic of an analyte, an agent or the interaction between the analyte and an agent may be achieved in many ways, which may be known to the person skilled in the art. For example, at least one characteristic of an analyte, an agent or the interaction between the analyte and an agent can be determined by the features of a tested current pattern, or by comparing a tested current pattern with a reference current pattern or by a machine learning.
(170) A tested current pattern, as used herein, refers to the current pattern obtained by using the tested analyte and/or the tested agent. Tested analyte and tested agent refer to the analyte to be characterized or the analyte and the agent involved in the interaction to be characterized.
(171) A reference current pattern refers the current pattern used as a reference to determine at least one characteristic of the analyte or the interaction between the analyte and an agent. According to the purpose of detection, different reference current pattern can be used. For example, the reference current pattern can be a current pattern obtained by using a known analyte and/or a known agent under the same conditions with the tested current pattern. The known analyte and the known agent are called reference analyte and reference agent, respectively. It can be determined whether the tested analyte is the same with or different from the reference analyte, whether the tested agent is the same with or different from the reference agent, and how the difference is by the comparison. It can also be determined that whether the interaction between the tested analyte and the tested agent is the same with or different from the interaction between the reference analyte and the reference agent, and how the difference is. In the cases that the tested analyte is the same with the reference analyte, it can be determined whether the tested agent is the same with or different from the reference agent, and how the difference is. In the cases that the tested agent is the same with the reference agent, it can be determined whether the tested analyte is the same with or different from the reference analyte, and how the difference is.
(172) A reference pattern may contain one or more types of blockade event, and may contain one or more individual blockade events of the same type. When comparing the tested current pattern and the reference current pattern, it is possible to compare one blockade event in the tested current pattern and one blockade event in the reference current pattern, or to compare multiple blockade events in the tested current pattern and multiple blockade events in the reference current pattern, and to determine whether the tested current pattern and the reference current pattern are the same or different. When comparing the tested current pattern and the reference current pattern, one or more of the above characteristic parameters obtained from the tested current pattern with those obtained from a reference current pattern. The skilled person knows how to compare the tested current pattern with the reference current pattern and how to determine whether they are the same or different.
(173) The comparison can reflect whether there is a difference between the reference analyte and the tested analyte and/or a difference between the reference agent and the tested agent that cause a change of the conformation of the analyte. The comparison can also reflect whether the difference between the reference analyte and the tested analyte and/or the difference between the reference agent and the tested agent can cause a change of the conformation of the analyte. In some embodiments, to characterize the interaction between an analyte and an agent, a reference current pattern is obtained by measuring an ionic current through the protein nanopore in absence of the agent.
(174) Associating the current pattern with at least one characteristic of the analyte or the interaction between the analyte and an agent may be achieved by using machine learning algorithm. In some embodiments, the step performed by using machine learning algorithm comprises: segmenting the tested current pattern into separate, unclassified events; extracting event features from the events; inputting the event features into a classifier model; predicting identity of each of the events based on the event features of each of the events in the classifier model; and outputting a result of prediction from the classifier model. The characteristics of the analyte or the interaction of the analyte and the agent can be determine by the identity of each of the events.
(175) In some embodiments, the classifier model is trained by: segmenting the current pattern of known events to generate discrete nanopore events as training events which have known identities; extracting event features from the training events; and building the classifier model based on the event features of the training events and the known identities of the training events.
(176) In some embodiments, the step of building the classifier model based on the event features of the training events and the known identities of the training events further comprises: inputting the event features of the training events into the classifier model; predicting the identity of each of the training events in the classifier model; and adjusting parameters of the classifier model based on the known identities of the training events so that the result of prediction is consistent with the known identities of the training events.
(177) In some embodiments, the step of adjusting parameters of the classifier model further comprises fine-tuning parameters of the classifier model based on a validation dataset derived from the training events.
(178) In some embodiments, the classifier model is selected and built from one of the following classifiers: Classification And Regression Tree (CART), Xgboost, Random Forest, KNN, and Gradient Boost.
(179) Event features may be any feature that can be learned from the current pattern of an event. Preferably, the event features are specific for the event. The event features may include a variety of characteristic parameters that can be obtained from the current pattern of an event, preferably, the event features may include one or more selected from the characteristic parameters as mentioned above. For example, the event features may include one or more or all of first blockade amplitude (first I.sub.b, which is also called first current level position), second blockade amplitude (second I.sub.b, which is also called second current level position), dwell time (t.sub.off), noise current level, minimum current, maximum current, median current, mean current, standard deviation, kurtosis and skewness of individual events.
(180) Identity of event, as used herein, refers to the distinctive character of the event, which may comprise the information of the analyte and/or the agent.
(181) The method of the present invention can be used to determine a variety of characteristics of an analyte and/or the interaction between a variety of analytes and a variety of agents, and thus can be used in a variety of applications. The method of the present invention can be used not only to characterize a single analyte, but also to characterize multiple different analytes or multiple different interaction at the same time. Multiple different analytes and/or multiple different agents can be added to the conductive liquid medium together, and the current pattern provided by recording the ionic current in a period of time can be associated with the characteristics of each the multiple different analytes, with the interaction between each of the multiple different analytes and each of the multiple different agents. In some embodiments, multiple different analytes and one agent can be added to the conductive liquid medium together, and the current pattern provided by recording the ionic current in a period of time can be associated with the interaction between each of the multiple different analytes and the one agent. In some embodiments, one analyte and multiple different agents can be added to the conductive liquid medium together, and the current pattern provided by recording the ionic current in a period of time can be associated with the interaction between each of the multiple different agents and the one analyte.
(182) In different applications, according to different purposes, different analytes, different agents, different reference analytes and/or and reference agents can be selected. When a machine learning algorithm is used, in different applications, different event features can be selected to train the classifier model.
(183) The inventor found that the conformation of different types of RNA can be distinguished by the vestibule of MspA. Therefore, in some embodiments, for example, the method can be used to determine whether an analyte belongs or does not belong to a specific RNA type, such as tRNA, siRNA, rRNA (e.g., 5S rRNA, 16S rRNA, 18S rRNA, 23S rRNA). The tested current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA, preferably without adding any agent capable of interacting with the analyte and changing the conformation of the analyte. The reference current pattern may be obtained by using one or more specific RNA type as a reference analyte. When the tested current pattern is the same with the reference current pattern, it is determined that the analyte belongs to the specific RNA type of the reference analyte. When the tested current pattern is different from the reference current pattern, it can be determined that the analyte does not belong to the specific RNA type of the reference analyte.
(184) The inventor found that the conformation of the nucleic acid duplex with an overhanged end the nucleic acid duplex with the same duplex sequence or duplex length and blunt end can be distinguished by the vestibule of MspA. Therefore, in some embodiments, for example, the method is used to determine whether a nucleic acid duplex has an overhanged end or a blunt end, wherein the nucleic acid duplex may be a duplex consisting of two RNA sequences, a duplex consisting of two DNA sequences, or a hybrid duplex consisting of any two of sequences of DNA, RNA and other nucleic acid analogues. The nucleic acid duplex may be a siRNA. The tested current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA, preferably without adding any agent capable of interacting with the analyte and changing the conformation of the analyte. The reference current pattern may be obtained by using a nucleic acid duplex having an overhanged end or a blunt end as a reference analyte. Preferably, the reference analyte has the same duplex sequence or duplex length with the tested analyte. When the tested current pattern is the same with the reference current pattern, it is determined that the analyte has the same type of end with the reference analyte.
(185) In some embodiments, for example, the method can be used to identify multiple different analytes in one measurement, for example, to identify multiple different proteins or to identify the types of multiple different RNAs, for example, in a low-molecular weight (LMW) RNA profiling. The tested current pattern may be obtained by adding the multiple different analytes to the first or second conductive liquid medium, and recording the ionic current through nanopore for a period of time (such as 20 s). The identities of the analytes are determined by comparing the tested current pattern with multiple reference current patterns, respectively, or by using a machine learning algorithm.
(186) In some embodiments, the method can be used to detect the analyte in a sample. It is not necessary to purify the analyte from the sample. The sample may be added directly to the first conductive liquid medium and the second conductive liquid medium.
(187) In some embodiments, the method can be used to detect whether an analyte of interest is present in a sample. The tested current pattern may be obtained by adding the sample to the first or second conductive liquid medium, and recording the ionic current through nanopore for a period of time. The reference current pattern may be obtained by using the analyte of interest as a reference analyte, and the reference current pattern comprises at least the ionic current measured during the reference analyte is inside the vestibule of MspA. The appearance of the events which is the same with the events caused by the reference analyte in the reference current pattern indicates the presence of the analyte of interest in the sample. The absence of the events which is the same with the events caused by the reference analyte in the reference current pattern indicates the absence of the analyte of interest in the sample. In some embodiments, the method can be used to detect the content of an analyte of interest in a sample. The tested current pattern may be obtained by adding the sample to the first or second conductive liquid medium, and recording the ionic current through nanopore for a period of time. The reference current pattern may be obtained by using the analyte of interest with a specific content as a reference analyte and the reference current pattern comprises at least the ionic current measured during the reference analyte is inside the vestibule of MspA. The comparison of the events frequency between the tested current pattern and the reference current pattern indicates the content of the analyte of interest in the sample. Higher events frequency indicates higher content and lower events frequency indicates lower content. The content of the analyte of interest in a sample may also be quantified, for example, by the methods known in the art.
(188) In some embodiments, a target molecule, for example, those do not have a conformation or are too small in size so that they can easily pass through the constriction zone of MspA without unzipping or unfolding, can combine with an assistant molecule to form a tested complex. The target molecule may combine with other molecule in different ways such as covalent bonds, hydrogen bonds, van der Waals forces, etc. so that the tested complex meets the analyte standards of the present invention, i.e., having a conformation, which allows the analyte to be accommodated in the vestibule of MspA, but prevents the analyte from entering and translocate through the constriction zone of MspA. The use of such a complex as the tested analyte in the method of the present invention allows for the characterization of the target molecule. For example, the use of such a complex as the tested analyte in the method of the present invention allows for the determination of one or more characteristics of the target molecule. The one or more characteristics confer the tested complex a specific conformation that can be detected by the vestibule of MspA. For example, by using a reference complex formed by the combination of a reference molecule and the same assistant molecule as the reference analyte, the difference between the target molecule and the reference molecule can be determine and the target molecule can be characterized. The difference between the target molecule and the reference molecule leads to the difference between the tested complex and the reference complex, which can be distinguished by the vestibule of MspA. The target molecule may be a peptide, a single-stranded nucleic acid (e.g., DNA or RNA, such as miRNA). The one or more characteristics of the target molecule may comprise sequence, etc.
(189) As an example, in the characterization of a miRNA, the tested analyte may be a duplex formed by the hybridization of a miRNA and a nucleic acid probe, wherein the nucleic acid probe may be DNA, RNA or other nucleic acid analogues. It can be determined whether the sequence of the miRNA to be tested is completely complementary to or mismatched with the probe sequence, which can further determine whether the sequence of the miRNA to be tested is the expected sequence. The tested current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA, preferably without adding any agent capable of interacting with the analyte and changing the conformation of the analyte. The reference current pattern may be obtained by using duplex consisting of the probe and a reference miRNA which is completely complementary to the probe. When the tested current pattern is the same with the reference current pattern, it is determined that the miRNA in the analyte is completely complementary to the probe. When the tested current pattern is different from the reference current pattern, it can be determined that the miRNA in the tested analyte is not completely complementary to the probe, i.e., there is a mismatch between the miRNA and the probe. According to the characteristics of the tested current pattern, it is even possible to determine the number and position of mismatched bases between the miRNA and the probe.
(190) In some embodiments, for example, the method can be used to determine whether a mutation of a protein cause its conformation to change. The analyte may be a mutated protein, and the tested current pattern may be obtained from at least the ionic current measured during the mutated protein is inside the vestibule of MspA, preferably without adding any agent capable of interacting with the analyte and changing the conformation of the analyte. The reference current pattern may be obtained by using a parental protein as a reference analyte. When the tested current pattern is different from the reference current pattern, it can be determined that the mutation of the protein cause a conformation change.
(191) The inventors found that the interaction between an analyte and an agent may cause the change of the conformation of the analyte, which may be detected by the vestibule of MspA. Therefore, in some embodiments, for example, the method can be used to determine the interaction between analyte and an agent (such as the presence of the interaction). The analyte can be any molecule with a conformation, including nucleic acid, protein, polysaccharides, polymer, enzyme, etc. The agent can be any substance that can interact, such as bind to, the analyte. Examples of the agent include ion, small molecule, ligand, receptor, substrate for an enzyme, etc. Preferably, the size of the agent allows it to pass freely through the constriction zone of MspA. Preferably, the interaction between an analyte and an agent is capable of causing the change of the conformation of the analyte
(192) In some embodiments, for example, the method can be used to determine whether the tested agent can interact with a known analyte. The tested current pattern can be obtained from at least the ionic current measured during the known analyte is inside the vestibule of MspA in presence of the tested agent. The reference current pattern may be obtained from at least the ionic current measured during the known analyte is inside the vestibule of MspA in absence of an agent capable of interacting with the known analyte. In some embodiments, when the tested current pattern has a change compared with the reference current pattern, it can be determined that the tested agent can interact with said known analyte.
(193) The method can also be used to determine whether the tested analyte can interact with a known agent. The tested current pattern may be obtained from at least the ionic current measured during the tested analyte is inside the vestibule of MspA in presence of the known agent. The reference current pattern may be obtained from at least the ionic current measured during the tested analyte is inside the vestibule of MspA in absence of an agent capable of interacting with the tested analyte. In some embodiments, when the tested current pattern has a change compared with the reference current pattern, it can be determined that the tested analyte can interact with said known agent.
(194) The method can also be used to determine whether a sample comprises an agent capable of interacting with the analyte. The tested current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA in presence of the sample. The reference current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA in absence of an agent capable of interacting with the analyte. In some embodiments, when the tested current pattern has a change compared with the reference current pattern, it can be determined that the sample comprises an agent capable of interacting with the analyte. In some embodiments, the reference current pattern can be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA in presence of a specific agent capable of interacting with the analyte, and when the tested current pattern is the same with the reference current pattern, it can be determined that the sample comprises said specific agent.
(195) The method can also be used to characterize an agent capable of interacting with the analyte. The tested current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA in presence of the agent capable of interacting with the analyte, i.e., the ionic current measured during the complex of the analyte and the agent is inside the vestibule of MspA. The reference current pattern may be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA in absence of an agent capable of interacting with the analyte. In some embodiments, when the tested current pattern has a change compared with the reference current pattern, the agent capable of interacting with the analyte can be characterized. In some embodiments, the reference current pattern can be obtained from at least the ionic current measured during the analyte is inside the vestibule of MspA in presence of a specific agent capable of interacting with the analyte, and when the tested current pattern is the same with the reference current pattern, it can be determined that the agent to be characterized is said specific agent and the concentration of the agent to be characterized may also be determined.
(196) In some embodiments, the analyte may be a protein, such as an enzyme. The agent to be characterized is capable of interacting with the protein. Examples of the agent include, but are not limited to, a cofactor, a ligand or a receptor of the protein, or a substrate of an enzyme. The agent includes, but is not limited to ion, small molecule compound, nucleic acid, protein, peptide, polysaccharides, polymer. In some embodiments, the analyte is lysozyme. In some embodiments, the agent capable of interacting with the analyte may be polysaccharides substrate of lysozyme, such as peptidoglycan, chitosan, chitin, etc., for exam n acetylchitohexaose. Therefore, the method of the present may be used to characterize polysaccharides through the interaction between the polysaccharides and lysozyme.
(197) The method can also be used to determine whether the mutation site of a protein mutant is the site where the parental protein interacts with a specific agent. The tested current pattern may be obtained from at least the ionic current measured during the protein mutant is inside the vestibule of MspA in presence of the agent. The reference current pattern may be obtained from at least the ionic current measured during the parental protein is inside the vestibule of MspA in presence of the agent. When the tested current pattern has a change compared with the reference current pattern, it can be determined that the mutation site of a protein mutant is the site where the parental protein interacts with the specific agent.
(198) The method can also be used to detect or distinguish between wild-type and mutant of a protein or a nucleic acid, different mutants of a protein or a nucleic acid, different states of a protein (for example, binding to or not binding to a cofactor, receptor, ligand or a substrate (e.g., for an analyte such as enzyme)), etc., as long as what will be distinguished have different conformations.
(199) Analytes and Agents
(200) The analyte used herein should be a molecule that is smaller than the vestibule of MspA and bigger than the constriction zone of MspA in size. The size of the analyte is determined by its conformation. Therefore, the analyte used herein has a conformation, which allows the analyte to be accommodated in the vestibule of MspA, but prevents the analyte from entering and translocate through the constriction zone of MspA. That is to say, when the analyte is in its conformation, it can be accommodated in the vestibule of MspA, but cannot translocate through the constriction zone of MspA.
(201) The analyte can be charged or neutral, and can be positively or negatively charged, for example, in a buffer, such as in the first conductive liquid medium and the second conductive liquid medium. The analyte preferably can be dissolved in the buffer, or can be moved under the action of an electric field or electroosmotic flow. The conformation may be a secondary structure, a tertiary structure, or a three-dimensional structure. The conformation may be the natural conformation of the analyte, that is, the conformation when it functions. The conformation may be the conformation when the analyte is in a buffer, such as in the first conductive liquid medium and the second conductive liquid medium. In some embodiments, the analyte has its natural conformation when it is in a buffer, such as in the first conductive liquid medium and/or the second conductive liquid medium.
(202) When the components of the analyte change, or when a certain agent interacts with the analyte, it may cause the conformation of the analyte to change, which can be detected by the method of the present invention, thereby characterizing the analyte or the interaction between the analyte and the agent.
(203) The analyte can be any molecule with a conformation, including nucleic acid, protein, peptide, polysaccharides, polymer, enzyme, etc., or a complex of any two or more of them. The analyte may also be a complex of nucleic acid, protein, peptide, polysaccharides, polymer, enzyme, etc. and an agent capable of interacting with them, such as their cofactor, ligand, receptor, substrate, etc.
(204) The nucleic acid may be a LMW RNA (Low molecular weight RNA, typically <200 nt, such as a tRNA, a siRNA, a rRNA (e.g., 5S rRNA, 16S rRNA, 18S rRNA, 23S rRNA), a miRNA), a aptamer, a ribozyme, a nucleic acid duplex or a RNA with specific structure (such as kissing loop, three-way junction, pseudoknot, kink-turn or G-quadruplex). The nucleic acid duplex may have an overhanged end or a blunt end. The nucleic acid duplex may be a duplex consisting of two RNA sequences, a duplex consisting of two DNA sequences, or a hybrid duplex consisting of any two of sequences of DNA, RNA and other nucleic acid analogues. The nucleic acid duplex may be consisted of a miRNA and a nucleic acid probe, and the nucleic acid probe is a RNA, a DNA or a nucleic acid analogue.
(205) Nucleic acid analogues, as used herein, refer to are compounds which are analogous (structurally similar) to naturally occurring RNA and DNA. Nucleic acids are chains of nucleotides, which are composed of three parts: a phosphate backbone, a pentose sugar, either ribose or deoxyribose, and one of four nucleobases. An analogue may have any of these altered. Nucleic acid analogues may be distinguished from naturally occurring DNA or RNA by changes to the backbone of the molecule. Nucleic acid analogues include, but not limit to, arabino nucleic acids (ANA), bridged nucleic acid (BNA), cyclohexenyl nucleic acid (CeNA), 2-fluoroarabino nucleic acids (FANA), glycol nucleic acid (GNA), hexose nucleic acid (HNA), locked nucleic acid (LNA), morpholino, peptide nucleic acid (PNA), threose nucleic acid (TNA).
(206) Protein, as used herein, may include an individual protein, a subunit of a protein, a mixture of different kinds of proteins, and a protein complex. Protein complex, as used herein, may refer to a complex formed by interaction between two or more individual proteins or subunits thereof. Examples of protein include calmodulin, lysozyme, myoglobin, ACTR/NCBD complex, whey protein, -lactalbumin and -lactoglobulin.
(207) The protein or peptide which is used as an analyte may have a secondary structure, a tertiary structure, or a quaternary structure formed by folding an amino acid sequence. The secondary structure may include, for example, -helix, -sheet, -turn, etc. The tertiary structure may include a three-dimensional structure formed by hydrogen bonds, ionic bonds, hydrophobic interactions, disulfide bonds, etc. on the basis of the secondary structure of the amino acid sequence. The quaternary structure may include, for example, a structure formed of two or more subunits.
(208) The protein or peptide which is used as an analyte may have different isoelectric point (pI), such as an isoelectric point (pI) of about 7.0, a protein with pI less than about 7.0, and a protein with pI of about 7.0. An isoelectric point (pI) of about 7.0 may be in the range of about 6.5 to about 7.5. pI less than about 7.0 includes pI less than about 6.5, less than about 6.0, less than about 5.5, less than about 5.0, less than about 4.5, less than about 4.0, etc. pI greater than 7.0 includes pI greater than about 7.5, greater than about 8.0, greater than about 8.5, greater than about 9.0, greater than about 9.5, greater than about 10.0, etc.
(209) The analyte may comprise two or more different analytes. For example, the analyte comprises different LMW RNA or different proteins. In some embodiments, the different proteins or peptides may be independently selected from the group consisting of neutral protein, positively charged protein and negatively charged protein. In some embodiments, the different proteins or peptides may be independently selected from the group consisting of a protein with pI of about 7.0, a protein with pI less than about 7.0, and a protein with pI greater than about 7.0. In some embodiments, the analyte comprises all of neutral protein, positively charged protein and negatively charged protein. In some embodiments, the analyte comprises two or three of neutral protein, positively charged protein and negatively charged protein. In some embodiments, the analyte comprises two or three of a protein with an isoelectric point (pI) of about 7.0, a protein with a pI less than about 7.0, and a protein with a pI greater than about 7.0.
(210) The analyte can be an analyte that is capable of interacting with (such as binding to) an agent. Examples of the agent that can interact with the analyte herein include ion, small molecule, ligand, receptor, cofactor, substrate for an enzyme, etc. Preferably, the size of the agent allows it to pass freely through the constriction zone of MspA. The agent preferably can be dissolved in the buffer, or can be moved under the action of an electric field or electroosmotic flow.
(211) Small molecule, as used herein, refer to a low molecular weight organic compound or peptide, e.g., <900 daltons, or with a size on the order of 1 nm.
(212) In some embodiments, the analyte or the agent can be comprised in a sample. The sample may be a blood, a serum, a plasma, cerebrospinal fluid, a body fluid derived from a subject, or a sample from a tissue or organ of the subject. The subject may be an animal or a plant, wherein the animal may be a mammal, including human. The sample can also be a sample derived from the environment, such as from water or soil, etc. The analyte can be a biomarker, such as a disease biomarker.
(213) The sample may also be a food, a beverage, a healthy product which comprises the analyte, and the analyte may be a nutritional ingredient or a harmful ingredient in the food, the beverage or the healthy product. The sample may also be a medicament which comprises the analyte as an active ingredient or a harmful ingredient. In some embodiments, the sample may be milk (such as liquid milk or milk powder) or protein powder, and the method of the present invention may be used to detect the concentration of some proteins in the sample. For example, the method of the present invention may be used to detect the concentration of whey protein, especially -lactalbumin and/or -lactoglobulin in milk or protein powder, which can be used to evaluate the quality of milk or protein powder. This allows people to abandon the traditional method of evaluating the protein content in milk or protein powder by detecting nitrogen, and directly determine the protein content in milk or protein powder, so that no misjudgment will occur.
(214) The analyte or the agent may not be purified from the sample. The sample may be directly added to the first conductive liquid medium and/or the second conductive liquid medium. For samples in non-liquid form, the sample can be directly added to the first conductive liquid medium and/or the second conductive liquid medium to dissolve and then measured, or the sample can be formulated into a solution or suspension first, and then added to the first conductive liquid medium and/or the second conductive liquid medium.
(215) In some embodiments, the analyte is a complex formed by the combination of a target molecule and an assistant molecule. The target molecule may combine with the assistant molecule in different ways such as covalent bonds, hydrogen bonds, van der Waals forces, etc. so that complex meets the analyte standards of the present invention, i.e., having a conformation, which allows the analyte to be accommodated in the vestibule of MspA, but prevents the analyte from entering and translocate through the constriction zone of MspA. The use of such an analyte in the present method may facilitate characterization of the target molecule. In some embodiments, the target molecule is miRNA.
EXAMPLES
Example 1: Structural-Profiling of Low Molecular Weight (LMW) RNAs by Nanopore Trapping/Translocation Using Mycobacterium smegmatis Porin A (MsPA)
(216) 1. Single Molecule Sensing of miRNA
(217) Electrophysiology measurements were performed as described in Methods using the M2 MspA mutant (D93N/D91N/D90N/D118R/D134R/E139K).sup.32 (
(218) Hsa-miR-21, which is one of the first identified mammalian microRNAs (miRNA) and has been well investigated as multiple cancer biomarkers.sup.34, was custom synthesized and treated as a model miRNA to test the method (Table 1). Experimentally, after the addition of hsa-miR-21 with a 200 nM final concentration to cis and with a +150 mV constantly applied potential, successive resistive pulses immediately appeared in both experiments. The open pore current (I.sub.o), the blockage amplitude (I.sub.b), the dwell time (t.sub.off) and the inter-event interval (t.sub.on) are defined in
(219) TABLE-US-00002 TABLE1 Nucleicacidabbreviationsandsequences. abbreviations sequences(5-3) hsa-miR-21 UAGCUUAUCAGACUGAUGUUGA siFoxA1-a CUUACGCUGAGUACUUCGAAA siFoxA1-b UCGAAGUACUCAGCGUAAGUG luciferasesiRNA-a AGCAAUAGUUCACGCUGAAAG luciferasesiRNA-b CUUUCAGCGUGAACUAUUGCU Footnote: SiFoxA1 was prepared by the hybridization of siFoxA1-a and siFoxA1-b. Luciferase siRNA was prepared by the hybridization of luciferase siRNA-a and luciferase siRNA-b.
(220) TABLE-US-00003 TABLE 2 Statistics for hsa-miR-21 sensing in different buffers. All measurements were performed as described in Methods. Hsa- miR-21 was added to cis with a final concentration of 200 nM. I.sub.p was derived from Gaussian fitting results. .sub.off and .sub.on were derived from single exponential fitting results. All statistical results were from 5-min continuous recordings for each condition.
2. Single Molecule Sensing of siRNA
(221) Small interfering RNA (siRNA), measuring 20-25 bp in length, appears as a RNA duplex with 2-nt 3-overhangs or blunt ends and plays a central role in gene silencing.sup.35. This duplex of siRNA is conformationally more confined than that of dsDNA and is primarily in the A form.sup.36. The duplex of siRNA has a cross sectional diameter of 2.4 nm.sup.37, larger than that of the MspA constriction, indicating that a direct translocation of siRNA through MspA is geometrically restricted (
(222) siFoxA1, which inhibits the expression of Forkhead protein FoxA1, is a 19-bp siRNA duplex with overhanging nucleotides on each end.sup.38 (Table 1,
(223) Luciferase siRNA.sup.39, a 21-bp duplex and an inefficient silencing structure.sup.40, was employed as a model blunt siRNA (Table 1,
(224) TABLE-US-00004 TABLE 3 I.sub.p of RNA sensing by MspA. All measurements were performed as described in Methods. I.sub.p was derived from Gaussian fitting results.
3. Single Molecule Sensing of tRNA
(225) Transfer RNA (tRNA) is another intensively studied and a well-known model in RNA structural biology. Its secondary structure is composed of four domains: the acceptor stem, the D-arm, the T-arm and the anticodon loop (
(226) Purification of a specific type of tRNA is difficult due to the biochemical similarity of different types of tRNAs.sup.41. Reported tRNA isolation is extremely labor intensive, involving ionic exchange chromatography, solvent extraction, countercurrent extraction, chromatography on benzyl-DEAE-cellulose and reverse phase chromatography.sup.41. However, phenylalanine specific tRNA, abbreviated here as tRNA.sup.phe, is unique because it can be simply obtained with high purity by elution from a benzylated DEAE-cellulose column with a gradient of NaCl.sup.42. Brewer's yeast tRNA.sup.phe, which was extracted as described above.sup.42, is commercially provided by Sigma-Aldrich and was employed as a representative tRNA in follow-up studies.
(227) During a nanopore measurement (Methods), Brewer's yeast tRNA.sup.phe was added to cis with a final concentration of 200 nM. Successive long residing and fluctuating translocation events were subsequently observed, among which two types of events, tentatively termed tRNA type 1 or type 2 events, demonstrate a high reproducibility in their event characteristics (
(228) To further explore this phenomenon, nanopore measurements with tRNA.sup.phe were carried out with applied voltages varying between +125 and +225 mV. Both tRNA type 1 or type 2 events were still observed. In general, the residence times of all type 1 events were systematically extended when the applied voltage was increased (
(229) TABLE-US-00005 TABLE 4 .sub.off of tRNA.sup.phe measured at different voltages. All measurements were performed as described in Methods. tRNA.sup.phe was added to the cis chamber with a final concentration of 200 nM. .sub.off was derived from single exponential fitting results.
4. Single Channel Recording of 5S rRNA
(230) 5S ribosomal RNA (5S rRNA) is an integral component of the ribosome. Its small size (approximately 120 nt), conserved structure and association with ribosomal proteins made it an ideal model RNA for studies of RNA structure.sup.44 and RNA-protein interactions.sup.45. The secondary structure of 5S rRNA is composed of five helices (denoted I-V in roman numerals), four loops (B-E), and one hinge (A), which form a Y-shaped tertiary structure.sup.46. The loop C, loop E and helix I are located at the three ends of the Y shape.sup.46. The structure shows a higher complexity than that of tRNA and might generate different event characteristics when probed by MspA.
(231) 5S rRNA extracted from E. coli (
(232) 5. Single Molecule RNA Structural Profiling
(233) Hsa-miR-21, siFoxA1, luciferase siRNA, tRNA.sup.phe and 5S rRNA demonstrate an increased complexity in their overall structures. These differences in structure were all discriminable by the same pore MspA, utilizing the large opening of the pore vestibule and an overall conical pore geometry (
(234) Simultaneous sensing of siFoxA1, luciferase siRNA, tRNA.sup.phe and 5S rRNA using MspA were also demonstrated (
(235) 6. Machine Learning Assisted RNA Identification
(236) Machine learning is a branch of artificial intelligence research, whose aim is to build computerized algorithms which learn from input data without focusing on the programing. This concept demonstrates a generality suitable for analyzing nanopore sensing data, as previously reported.sup.13, 52-54 55. Event characteristics of siRNA, tRNA and 5S rRNA demonstrate a high consistency when probed by MspA, and such data are well suited for the construction of a machine learning algorithm aiming to automatically recognize different RNA structures. To begin with, raw time traces containing nanopore sensing events were first automatically segmented to generate discrete nanopore events (
(237) The training process is composed of feature extraction and model building (
(238) The feature importance was generated during model testing which demonstrates the relative importance of all nine features in event recognition (
(239) The model was employed to predict events with unknown identities (
(240) Video S1. Simultaneous sensing of siRNA, tRNA and 5S rRNA. Electrophysiology measurements were performed as described in Methods. A 1.5 M KCl buffer (1.5 M KCl, 10 mM HEPES, pH 7.0) was placed in cis and a 1 M CaCl.sub.2 buffer (1 M CaCl.sub.2, 10 mM HEPES, pH 7.0) was placed in trans. Overhanged siRNA (SiFoxA1, 25 nM), blunt siRNA (luciferase siRNA, 10 nM), tRNA (tRNA.sup.phe, 400 nM) and 5S rRNA (30 nM) were simultaneously added to cis. Characteristic events of siRNA, tRNA and 5S rRNA were clearly observed from the trace. Assisted by the machine learning algorithm, each event was automatically identified and labelled with letters of O (overhanged siRNA), B1 (blunt siRNA type 1), B1 (blunt siRNA type 2), T1 (tRNA type 1), T2 (tRNA type 2) or R (5S rRNA type 1) respectively.
(241) 7. Molecular Dynamics (MD) Study of tRNA Trapping/Translocation
(242) Among all tested analyte, tRNA demonstrates two highly characteristic types of events. Experimentally, these two event types respectively demonstrate trapping (type 1) and translocation (type 2) of tRNA when probed by MspA (
(243)
(244) The different analyte-pore interactions caused by different conformations of tRNA lead to distinctive ionic currents. To quantitatively compare the resulting ionic current for the different conformational states of the system, the external electric field was switched to 0.09 V/10 nm, which corresponds to a voltage bias of +150 mV as used in the experiments. Following a previous study.sup.57, the instantaneous ionic current was calculated based on the coordinates of the ions. Since the instantaneous ionic current has large fluctuations, we first calculated the cumulative currents. Then the ionic currents were derived from the slope of the cumulative currents by linear fitting. In addition to the above mentioned three simulation systems, we also performed ion current simulations for the systems without tRNA (open pore) and with the tRNA translocating through the pore (Z<0). As shown in
(245) Video S2-4. Animations of tRNA translocation generated by MD simulation. MD simulations were performed as described in Example 2 Methods. An external electric field of 4.0 V/10 nm was continuously applied along the direction perpendicular to the membrane plane. The simulations lasted for 100 ns with a time step of 2 fs per frame. In each animation, the tRNA enters the pore with the stem down (Video S2), the loop down (Video S3) or the arm down (Video S4) conformation.
(246) Video S5. Animation of 5S rRNA translocation generated by MD simulation. MD simulations were performed as described in Example 2 Methods. An external electric field of 4.0 V/10 nm was continuously applied along the direction perpendicular to the membrane plane. The simulations lasted for 100 ns with a time step of 2 fs per frame. 5S rRNA enters the pore with the helix I down conformation.
(247) 8. Event Feature Conservation for tRNAs from Different Sources
(248) Previous crystallographic studies indicate that with the exception of particular mammalian mitochondrial tRNAs, tRNAs of a widely divergent phylogenetic origin demonstrate a highly conserved L-shaped tertiary conformation.sup.58. With this knowledge in mind, the structure-induced nanopore events of brewer's yeast tRNA.sup.phe might be generally applied to a much wider variety of tRNAs from different sources. To explore this speculation, we performed nanopore sensing of the total tRNAs from brewer's yeast and from E. coli, both supplied by Sigma-Aldrich.
(249) Gel electrophoresis was performed for both tRNA samples, from which the yeast total tRNAs have the desired purity but the E. coli total tRNAs contain noticeable contaminations, including 5S rRNA and other higher molecular weight RNAs.sup.59 (
(250) During nanopore measurements (Methods), yeast tRNA or purified E. coli tRNA were respectively added to cis at a 20 ng/l or 2 ng/l final concentration. Representative traces were separately demonstrated in
(251) TABLE-US-00006 TABLE 5 I.sub.p of tRNA events from different biological sources. All measurements were performed as described in Methods. tRNA.sup.phe was added to cis with a final concentration of 200 nM. Yeast total tRNA was added to cis with a final concentration of 20 ng/L. E. coli total tRNA (unpurified) was added to cis with a final concentration of 20 ng/L. E. coli total tRNA (purified) was added to cis with a final concentration of 2 ng/L. I.sub.p was derived from Gaussian fitting results.
(252) TABLE-US-00007 TABLE 6 Proportion of tRNA signals determined with machine learning algorithms. All measurements were performed as described in Methods. Different analytes were respectively added to cis. Three independent measurements were performed for each condition to produce the statistics. proportion proportion proportion biological of tRNA of type of type samples signals 1 signals 2 signals tRNA.sup.phe 0.71 0.05 0.41 0.05 0.30 0.04 Yeast tRNA 0.380 0.013 0.21 0.04 0.17 0.03 E. coli tRNA 0.402 0.009 0.206 0.016 0.196 0.007 (purified) E. coli LMW RNA 0.48 0.11 0.24 0.09 0.23 0.06
9. Direct tRNA Identification from E. coli Extracts
(253) To verify its feasibility, cultured E. coli (BL21) DE3 was lysed. All low molecular weight (LMW) RNA (<200 nt) was extracted by the small RNA extraction reagent from Takara, named RNAiso for Small RNA. The extraction procedure is schematically illustrated in
(254) Prior to nanopore measurements, the extracted sample was first characterized by 12% denaturing urea polyacrylamide gel electrophoresis (Urea-PAGE) analysis (
(255) As a negative control, high molecular weight (HMW) RNAs (>200 nt) of E. coli (BL21) DE3 were extracted using MiniBEST Universal RNA Extraction Kit (Takara). This kit preferentially extracts all RNAs with a molecular weight >200 nucleotides (nt) according to the manufacturer's protocol.sup.66. Detailed extraction procedures are described in Example 2 Methods. Experimentally, from 1% agarose gel electrophoresis results, the sharp bands respectively correspond to the 23S Ribosome RNA (rRNA) (2904 nt) and the 16S rRNA (1542 nt) which is a good indication that the HMW RNA extraction was successful (
(256) Nanopore sensing of the HMW RNA extraction was performed with a 50 ng/L final concentration of HMW RNA in cis. A representative 10 min trace is shown in
(257) 10. Conclusions:
(258) In summary, this paper presents a nanopore sensing strategy which directly distinguishes between RNA native structures utilizing the large vestibule of an MspA nanopore. Representative RNA analytes, including miRNA, siRNA, tRNA or rRNA, generate rich sensing information during translocation which reports their identities unambiguously. We admit that RNA structural profiling by nanopore trapping/translocation may get complicated when extremely structurally similar RNAs were simultaneously evaluated. However, compared with existing RNA detection methods based on hybridization.sup.67,68 or reverse transcription.sup.69, 70, it requires no prior chemical treatment or amplification and a single molecule resolution is achieved. It thus serves as an alternative method for fast estimation of the expression level of a particular RNA, and is suitable for assessment of RNA integrity, stress-induced tRNA differential expression.sup.71 or tRNA cleavage derived fragments.sup.72. Acknowledging an overall rigidity and conical geometry of the pore, trapping by MspA also reports highly consistent and distinguishable event characteristics. To cope automatically and quantitatively with sensing events, a custom machine learning algorithm has been developed (
(259) Our results confirm that the vestibule of MspA can serve as a large constriction, complementary to the development of large pores such as ClyA.sup.23, Phi29 DNA connector.sup.24, FraC.sup.25, PlyA/PlyB.sup.26 or DNA nanopores.sup.74, however the exceptional structural stability of MspA is advantageous for sample storage, long-term measurement and a low noise of measurement. Thought not yet disclosed in this study, the strategy of nanopore trapping has as well been successfully used to sense proteins or their allosteric transitions caused by small molecule bindings, which is to be published separately. Following the same principle, future applications of the technique may also include direct sensing of ribozymes, aptamers or their interactions with small molecules.
(260) 11. Methods
(261) Nanopore measurements: The measurement device is composed of two custom poly-formaldehyde chambers separated by a 20 m-thick Teflon film drilled with an aperture (100 m in diameter). Prior to the measurement, the aperture was first treated with 0.5% (v/v) hexadecane (dissolved in pentane) and set for pentane evaporation. Afterwards, 500 L electrolyte buffers were respectively added to both chambers. A pair of custom Ag/AgCl electrodes, electrically connected to the patch clamp amplifier, were respectively placed in both chambers, in contact with the buffers. Conventionally, the chamber which is electrically grounded was defined as the cis chamber, while the opposing chamber was defined as the trans chamber. 100 L pentane solution of DPhPC (5 mg/mL) was added to both chambers. A lipid bilayer was formed by pipetting the electrolyte buffer in either chamber up and down several times. Upon successful formation of the lipid bilayer, the acquired current immediately drops to 0 pA, indicating that the aperture connecting both chambers has been completely sealed. MspA was added to the cis chamber to initiate spontaneous pore insertion. Upon a single nanopore insertion, the buffer in the cis chamber was manually exchanged to avoid further pore insertions.
(262) To avoid external electromagnetic and vibration noises during the measurements, the device was shielded in a custom Faraday cage (34 cm by 23 cm by 15 cm) mounted on a floating optical table (Jiangxi Liansheng Technology). All electrophysiology measurements were performed with an Axonpatch 200B patch clamp amplifier paired with a Digidata 1550B digitizer (Molecular Devices). All single channel recordings were sampled at 25 kHz and low-pass filtered with a 1 kHz cutoff frequency. The acquired traces were further digitally filtered with a 500 Hz low-pass Bessel filter (eight-pole) using Clampfit 10.7 (Molecular Devices).
(263) Unless otherwise stated, all nanopore measurements in this paper were performed with a 1.5 M KCl buffer (1.5 M KCl, 10 mM HEPES, pH 7.0) in cis and a 1 M CaCl.sub.2 buffer (1 M CaCl.sub.2, 10 mM HEPES, pH 7.0) in trans and a +150 mV potential was continuously applied.
(264) Data analysis: RNA translocation events were recognized with the single channel research option in Clampfit 10.7. The machine learning algorithm was custom programmed by Python. Subsequent analyses including histogram plotting and curve fitting were performed in Origin 9.1 (Origin Lab).
(265) 12. Data and Code Availability Statement
(266) The machine learning based executable software RNA-Classification and its code have been deposited at https://drive.google.com/file/d/17JoqS2JUY-QOY4e5Ib0HE4PsexYtEIKq/view?usp=sharing. The workflow of this software is provided in
(267) 13. Acknowledgments
(268) This project was funded by National Natural Science Foundation of China (Grant No. 31972917, No. 91753108, No. 21675083), Programs for high-level entrepreneurial and innovative talents introduction of Jiangsu Province (individual and group program). Natural Science Foundation of Jiangsu Province (Grant No. BK20200009), Excellent Research Program of Nanjing University (Grant No. ZYJH004), State Key Laboratory of Analytical Chemistry for Life Science (Grant No. 5431ZZXM1902), Technology innovation fund program of Nanjing University and the HPC center of Nanjing University.
Example 2: Materials and Methods for Example 1
(269) 1. Materials
(270) Hexadecane, pentane, ethylenediamine tetraacetic acid (EDTA), Triton X-100, Genapol X-80, calcium chloride (CaCl.sub.2), tRNA.sup.phe from brewer's yeast, total tRNA from brewer's yeast and total tRNA from E. coli were from purchased from Sigma-Aldrich. Dioxane-free isopropyl--D-thiogalactopyranoside (IPTG), kanamycin sulfate, imidazole, N,N,N,N-tetramethyl-ethylenediamine (TEMED) and tris (hydroxymethyl) aminomethane (Tris) were from Solarbio. DNA Marker DL2000, RNA Marker RL1000, RNA Marker RL6000, RNAiso for Small RNA, MiniBEST Universal RNA Extraction Kit and RNase-free water were from Takara. ZR small-RNA PAGE Recovery Kit was from ZYMO research. Low Range ssRNA Ladder was from New England Biolabs. SYBR gold nucleic acid gel stain was from Invitrogen. Potassium chloride (KCl) was from Aladdin. 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES) was from Shanghai Yuanye Biotechnology. 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPhPC) was from Avanti Polar Lipids. E. coli strain BL21 (DE3) was from Biomed. Luria-Bertani (LB) agar and LB broth were from Hopebio. Chloroform was from Labol. Isopropanol and urea were from GHTECH. 75% ethanol (prepared with DEPC treated water) was from KeyGeN. 40% Acrylamide/methylene diacrylamide solution was from Sangon. High-performance liquid chromatography-purified hsa-miR-21, siFoxA1 and luciferase siRNA were hybridized by Sangon and delivered as a double stranded form (Table 1).
(271) 1.5 M KCl buffer (1.5 M KCl, 10 mM HEPES, pH 7.0) and 1 M CaCl.sub.2 buffer (1 M CaCl.sub.2, 10 mM HEPES, pH 7.0) were prepared and membrane-filtered (0.2 m cellulose acetate; Nalgene) prior to use. RNA was dissolved in RNase-free water before use. The M1 MspA (D90N/D91N/D93N) and M2 MspA (D90N/D91N/D93N/D118R/D134R/E139K) were expressed with E. coli BL21 (DE3) and purified by nickel affinity chromatography as described previously.sup.1. The plasmid DNAs encoding M1 or M2 MspA were custom synthesized by Genescript (New Jersey) and have been shared via https.//www.molecularcloud.org/s/shuo-huang. The access codes are MC_0101207 (M1 MspA) and MC_0101191 (M2 MspA). The majority of results were acquired with the M2 MspA. For simplicity, M2 MspA is referred to as MspA throughout the text, if not otherwise stated.
(272) 2. Methods
(273) Molecular Dynamics (MD) Simulations
(274) All molecular dynamics simulations were conducted by GROMACS 2019.sup.76 with the CHARMM36m force field.sup.77 and TIP3P water model.sup.78. The setup of the simulation system was prepared by using the CHARMM-GUI web server.sup.79. The atomic coordinates of MspA.sup.80 and tRNA.sup.81 were taken from the Protein Data Bank (PDB) with the entries 1UUN and 1EVV, respectively. Following the experimental setup, the mutations R96A, D93N, D91N, D90N, D118R, D134R and E139K were introduced to simulate the composition of an M2 MspA. A 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine (POPC) lipid bilayer with the size of 1212 nm.sup.2 was added. The resulting system was then solvated in a rectangular water box with periodic boundary condition. To simplify the simulations, the system was established in a symmetric KCl buffer electrolyte system. K.sup.+ and Cl.sup. ions were added at random positions to give a salt concentration of 1.5 M and to neutralize the simulation system. The final system is consisted of 225000 atoms. The long-range electrostatic interactions were calculated using the smooth particle-mesh Ewald method.sup.82. The cutoff distance for the calculations of the short-range part of the electrostatic interactions and the van der Waals interactions were set to 1.2 nm. The covalent bonds involving hydrogen atoms were restrained with the LINCS algorithm.sup.83.
(275) To simulate tRNA translocation, each system was firstly minimized for 1000 steps and then equilibrated at 298 K for 0.25 ns under NVT ensemble using Berendsen weak-coupling thermostat.sup.84. The heated systems were further equilibrated under NPT ensemble at 298 K and 1 atm for another 1.75 ns, with the Berendsen semi-isotropic barostat.sup.84, leading to a box size of 11.6 nm11.6 nm16.5 nm. The simulations of translocation were initiated from the final structures of the above equilibrating simulations with NVT ensemble. An external electric field of 2.0 V/10 nm was applied along the direction perpendicular to the membrane plane for 0.5 ns, then the external electric field was switched to 4.0 V/10 nm. The production simulations lasted for 100 ns with a time step of 2 fs. During the simulations, harmonic positional restraints were applied to the C atoms of MspA with a spring constant of 500 kJ/mol/nm.sup.2. Experimentally, translocation of tRNA typically lasts second, which is far beyond the accessible timescale of conventional all-atom MD simulations. In order to observe a full translocation process within a feasible simulation timescale, the external electric field of 4.0 V/10 nm used in the translocation simulations corresponds to a much higher voltage bias than that is applied in experiment. As discussed in previously reported literatures.sup.85, 86, high electric fields often result in the formation of electroporation of the lipid bilayer even in short MD simulations, which can lead to ion leakages. Consequently, different simulation strategies were used to avoid the formation of electroporation of the lipid bilayer, such as adding positional restraints.sup.87, using puling force with steered MD to drive the translocation.sup.86, or using more sophisticated Grid-steered MD.sup.89. Here we applied positional restraints to avoid the formation of electroporation, in which all the heavy atoms of the lipid molecules were restrained to the positions in the structures obtained from the minimization step by a harmonic potential with a spring constant of 1000 kJ/mol/nm.sup.2.
(276) To characterize the simulated tRNA translocation process, we used three reaction coordinates, including the number of base-pair hydrogen bonds (H-bond), the root mean square deviation (RMSD) from the native structure, and the z-coordinate of the tRNA (Z). The H-bond represents the number of hydrogen bonds between the nucleotide pairs which form base pairs in the native structure. Therefore, decrease of the H-bond corresponds to the disruption of the tRNA base pairing. The RMSD characterizes the overall structure change of the tRNA, which is not only sensitive to the structural unfolding, but is also sensitive to the overall deformation of the molecules. Therefore, the H-bond and RMSD can be applied to describe different conformational properties of the tRNA during translocation. The reaction coordinate Z is defined by the z-coordinate of the leading nucleotide during the translocation (green sphere in
(277) To simulate the ionic current, starting from the equilibrated structures with the above mentioned three different tRNA orientations, the systems were firstly relaxed for 20 ns under an external electric field of 1.0 V/10 nm, so that the tRNA makes sufficient contacts with the entrance of the MspA. The production simulations started from the relaxed structures under an external electric field of 0.09 V/10 nm, which corresponds to a voltage bias of +150 mV, similar to that used in the experiments. The production simulations lasted for 100 ns. We also repeated the simulations at higher electric fields, including 0.2 V/10 nm and 0.6 V/10 nm. As the lipid bilayer can keep stable under these electric fields within the simulation timescale, the positional restraints were applied only to the C atoms of the MspA and the lipid molecules are free to move. Following a previous study.sup.90, the instantaneous ionic current was calculated based on the coordinates of the ions. Since the instantaneous ionic current has large fluctuations, we calculated the cumulative currents. The ionic currents were derived from the slope of the cumulative currents by linear fitting. In addition to the above mentioned three simulation systems, we also performed ionic current simulations for the systems without the presence of any tRNA and the state when the tRNA is translocating through the pore (Z<0). The initial structure of the system with the tRNA translocating through the pore was extracted from the above translocation simulations. The software PyMOL was used for the structural visualization.sup.91.
(278) Similar simulations were performed for translocation of 5srRNA (
(279) RNA Recovery from Polyacrylamide Gels
(280) 30 g commercial E. coli total tRNA (Sigma-Aldrich) was loaded into a 12% denaturing urea polyacrylamide gel. Gel electrophoresis was continuously run for 100 min with a +180 V applied potential. The gel was illuminated with a portable UV lamp (254 nm). The gel fragments respectively containing 5S rRNA or tRNA were excised for further recovery. RNA recovery was performed using ZR small-RNA PAGE Recovery Kit (ZYMO research). According to the manual, crushed RNA fragment was transferred into a Zymo-Spin IV Column. 400 L RNA Recovery Buffer was add to the column and incubated at 65 C. for 15 min. The column was quickly frozen in a 80 C. freezer for 5 minutes and incubated at 65 C. for 5 min. The column was then centrifuged at 1500g for 30 sec. The filtrate was transferred to a Zymo-Spin IIICG Column and centrifuged at 1500g for 30 sec. The filtrate was added with 2 volumes of RNA MAX Buffer and thoroughly mixed. The mixture was then transferred to a Zymo-Spin IC Column and centrifuged at 12000g for 30 sec and the supernatant was discarded. The column was added with 400 L RNA Prep Buffer and centrifuged at 12000g for 1 min and the filtrate was discarded. The column was added with 800 L RNA Wash Buffer and centrifuged at 12000g for 1 min then the filtrate was discarded. The column was added with 400 L RNA Wash Buffer and centrifuged at 12000g for 1 min and the filtrate was discarded. The column was centrifuged at 12000g for 2 min to ensure complete removal of the wash buffer. The column was added with 30 L RNase-free water. After standing for 1 min, the column was centrifuged at 10000g for 1 min to elute the RNA. The eluted RNA concentration was determined by nanodrop (Thermo, USA) and the sample was further characterized using 12% denaturing urea polyacrylamide gel electrophoresis. Finally, the recovered RNA was stored at 80 C. for subsequent electrophysiology measurements. All tips and tubes used were RNase-free.
(281) Low Molecular Weight (LMW) RNA Extraction from E. coli
(282) E. coli strain BL21 (DE3) was cultured in LB broth and shaken overnight (230rpm) at 16 C. The cells were pelleted by centrifugation at 12000g for 20 min at 4 C. and washed with 1PBS to remove residual LB broth. The deposition was collected and lysed in 1 mL RNAiso for Small RNA (Takara). After vigorous vortexing, the lysis solution was placed at room temperature (rt) for 5 min. To extract LMW RNA, the lysis solution was added with 200 L chloroform and fully emulsified through vortexing. After standing for 5 min, the mixture was centrifuged at 12000g for 15 min at 4 C. When carefully removed from the centrifuge, the mixture was divided into three layers: the colorless supernatant containing LMW RNA, the white middle layer containing protein and the colored lower layer containing the organic solvent. The supernatant was transferred to a new centrifugal tube and added with 600 L isopropanol. After thorough mixing, it was set for 10 min at 15 30 C. The mixture was centrifuged at 12000g for 10 min at 4 C. to collect the pellet. The pellet was washed with 1 mL 75% ethanol and centrifuged at 12000g for 5 min at 4 C. and the supernatant was discarded. The pellet, which is the LMW RNA, was dried at room temperature for 30 min. 25 L of RNase-free water was then added to dissolve the LMW RNA. The concentration of the sample was determined by nanodrop. This LMW RNA sample was further characterized using 12% denaturing urea polyacrylamide gel electrophoresis. Finally, LMW RNA was stored at 80 C. for subsequent electrophysiology measurements. All tips and tubes used are RNase-free.
(283) High Molecular Weight (HMW) RNA Extraction from E. coli
(284) High molecular weight (HMW) RNA (>200 nt) of E. coli (BL21) DE3 was extracted using MiniBEST Universal RNA Extraction Kit. E. coli strain BL21 (DE3) was cultured in LB broth and shaken overnight (230 rpm) at 16 C. The cells were pelleted by centrifugation at 13800g for 20 min at 4 C. and washed with 1PBS water to remove residual LB broth. 350 L lysis Buffer RL was added to the collected cells. The lysate was transferred to a gDNA Eraser Spin Column and centrifuged at 13800g for 1 min at 20 C. to remove the gDNA. The filtrate was added with isopycnic 70% ethanol and mixed thoroughly. The mixture was transferred to RNA Spin Column and centrifuged at 13800g for 1 min at 20 C. The RNA Spin Column was added with 500 L Buffer RWA and centrifuged at 13800g for 30 sec at 20 C. The filtrate was discarded. The RNA Spin Column was added with 600 L buffer RWB and centrifuged at 13800g for 3 min at 20 C. The RNA Spin Column was placed onto 1.5 mL RNase Free Collection Tube and added with 30-200 L RNase free water. After 5 min, HMW RNA was eluted by centrifugation at 13800g for 2 min at 20 C. The concentration was measurement using nanodrop and the desired fraction was determined using 1% agarose gel electrophoresis. Finally, HMW RNA was stored at 80 C. for subsequent electrophysiology measurements. Tips and tubes used were RNase-free.
Example 3: miRNA Sensing
(285) MicroRNAs (miRNAs) are small RNA molecules, with their role in gene silencing and translational repression by binding to target mRNAs, and miRNAs influence essentially all developmental process and diseases. Therefore, how to quickly detect the types, mutations, and modifications of miRNAs is extremely important. As shown in
Example 4: Allosteric Switching of Calmodulin in a Mycobacterium Smegmatis Porin A (MspA) Nanopore-Trap
(286) 1. Allosterism of wtCaM Upon Ca.sup.2+ and Target Peptide Binding.
(287) The wtCaM and its D129G mutant were prepared for the measurements as described in Example 5-Methods 1 and
(288) Nanopore measurements were first carried out by adding Ca.sup.2+-free wild-type CaM (apo-wtCaM) to cis to a final concentration of 0.6 M. With a +60 mV applied potential, continuous short resident resistive pulses were observed (
(289) To describe these events quantitatively for an in-depth analysis, event parameters such as the open-pore current (I.sub.0), the blocked pore current (I.sub.b), the blocking amplitude (I), the blocking ratio (I/I.sub.0), the event dwell time (t.sub.off) and the inter-event intervals (t.sub.on) are defined in
(290) Based on three independent measurements for each condition (N=3, Table 6), trapping events of apo-wtCaM are 51.91.1% in the blocking ratio (I/I.sub.0) and 5.10.3 ms in the mean event dwell time (.sub.off). Events of Ca-wtCaM report a I/I.sub.0 of 93.00.7% and a .sub.off of 3.70.6 s (N=3) (Table 6) and events of M13-Ca-wtCaM report a I/I.sub.0 of 83.90.3% and a .sub.off of 0.180.19 s (N=3) (Table 6). Events of Ca-wtCaM report the largest level fluctuations when compared with those of apo-wtCaM and M13-Ca-wtCaM, indicating that these structures respectively report different fluctuations when confined in the pore vestibule (
(291) To fully understand the thermodynamics of the sensing processes, we further calculated the Helmholtz free energy (F) of CaM-MspA interactions which represents the entropy cost to maintain a CaM conformer in MspA..sup.170 F.sub.Ca-wtCaM was calculated to be 0.71 kcal/mol, F.sub.apo-wtCaM was 2.18 kcal/mol and F.sub.M13-ca-wtCaM was 1.73 kcal/mol (Example 5 Methods 5). Regarding the structural change of CaM before and after Ca.sup.2+ or M13 binding, the formation of the central helix of CaM upon Ca.sup.2+ binding reduces the structural flexibility of Ca-wtCaM, greatly decreasing the entropic costs of being trapped by MspA. The results of molecular dynamics (MD) simulations showed that the order of root-mean-square deviation (RMSD) of the three conformers after being trapped could be correlated with that of the reciprocal of the event duration times from experimental measurements (apo-wtCaM>M13-Ca-wtCaM>Ca-wtCaM,
(292) A voltage gradient measurement was also performed (
(293) TABLE-US-00008 TABLE 6 Statistics of blocking events. All measurements were carried out as described in Example 5 Methods 1 with M2 MspA. A +60 mV voltage was continuously applied during the measurements. Apo-wtCaM, Ca-wtCaM, apo-CaM- D129G and M13-Ca-wtCaM were applied as the analyte. All statistical results were derived from results of three independent experiments (N = 3). THE INDEPENDE CURRENT MEAN DWELL APO- 1 52.61 .sup.5.44 ms WTCAM 2 50.72 .sup.4.86 ms 3 52.49 .sup.4.88 ms mean 51.9 1.1 5.1 0.3 ms.sup. CA- 1 92.71 3.93 s WTCAM 2 93.76 3.03 s 3 92.41 4.06 s mean 93.0 0.7 3.7 0.6 s.sup. APO-CAM- 1 type 1 64.07 0.16 s D129G type 2 81.08 0.15 s 2 type 1 65.09 0.20 s type 2 78.93 0.25 s 3 type 1 64.30 0.20 s type 2 79.90 0.19 s mean type 1 64.5 0.5 0.18 0.19 s.sup. type 2 80.0 1.1 0.20 0.05 s.sup. M13-CA- 1 84.23 0.15 s WTCAM 2 83.68 0.12 s 3 83.77 0.12 s mean 83.9 0.3 0.13 0.02 s
(294) TABLE-US-00009 TABLE 7 Mean capture frequency (
(295) TABLE-US-00010 TABLE 8 Mean blockade ratio (
2. Probing the CaM Variant with a Single Mutation, D129G
(296) Recently, some CaM mutants were found to be associated with life-threatening arrhythmia syndromes..sup.171 These CaM variants showed structural deviations causing interference with the function of cardiac ion channels such as the voltage-gated Ca.sup.21 channel CaV1.2.sup.172. Here, a MspA nanopore-trap was applied to study a disease related mutant CaM-D129G, which gives rise to a long QT syndrome (LQTS) phenotype..sup.171,173
(297) According to the structures predicted by MD simulations, the D129G mutation could induce structural deviation of an EF-hand in the C-lobe of apo-wtCaM (
(298) A recent study suggested that the mutant D129G lost its ability to bind Ca.sup.2+ as a result of the separation of EF-hands within the C-lobe,.sup.174 consistent with results of the MD simulations conducted in this study (
(299) 3. Monitor the Binding Capacity of Apo-wtCaM to Divalent Ions
(300) Although Ca.sup.2+ is the most investigated factor triggering the conformational change of wtCaM and the consequent signal transduction, other evidence has shown that other ions can also activate wtCaM..sup.175 In 1983, Crowell et al. proved that different ions also can bind to wtCaM.sup.176 and Vogel et al. observed similar phenomena by NMR analysis..sup.175 With a much improved resolution to a single molecule, binding of several divalent ions (Mg.sup.2+/Ca.sup.2+/Sr.sup.2+/Ba.sup.2+/Pb.sup.2+) to wtCaM was studied by MspA nanopore trapping in this work. Limited by the poor solubility of Pb.sup.2+ in an aqueous KCl solution, the concentration applied for all divalent ions was set at 2 mM.
(301) The histogram results of I/I.sub.0 in
(302) Measurements with Mg.sup.2+ or Ba.sup.2+ however failed to report a clear distribution of the events corresponding to transient states. The proportion of the holo-wtCaM events were also extremely low, measuring only 4.0% or 4.4% (N=3,
(303) Despite of the types of the bound ions, all holo-wtCaM events have highly characteristic level fluctuations. When confined in an MspA nanopore trap, these fluctuations reflect minor structural differences of holo-wtCaM when bound with different ion types, which might be related to dynamic coordination and dissociation of divalent ions. The corresponding all-point histograms patterns generated from these fluctuations are highly conservative when ions of the same type were bound to wtCaM (
(304) TABLE-US-00011 TABLE 9 The mean blocking ratios (
4. Probing Tb.sup.3+-Bound wtCaM
(305) Many lanthanide ions were involved in the study of CaM, which acknowledges their characteristic fluorescent properties.sup.177. For example, Tb.sup.3+ is an excellent luminescent analog of Ca.sup.2+ and has been used in the study of ion coordination and activation in Ca-binding proteins, acknowledging the fact that Tb.sup.3+ and Ca.sup.2+ share a similar ionic radii and a preference for binding charged oxygen groups..sup.178,179 However, previous investigations have demonstrated that Tb.sup.3+-bound wtCaM tend to become dysfunctional when the environment concentration of Tb.sup.3+ ([Tb.sup.3+]) was dramatically increased,.sup.180 although the property of Ca-wtCaM is not affected by high Ca.sup.2+ concentrations. It was theoretically speculated that significant structural disorder and pseudobridging metal coordination may form in Tb.sup.3+ bound wtCaM (
(306) Experimentally, apo-wtCaM (0.3 M) is fully activated by 5 M Tb.sup.3+, forming the activated state induced by Tb.sup.3+ binding (Tb-wtCaM) and detectable by MspA nanopore trapping (
(307) The reciprocal of inter-event intervals (1/.sub.on) of Tb-wtCaM capture was applied to evaluate the Tb.sup.3+-induced structural change of wtCaM in the presence of different concentrations of Tb.sup.3+ (
(308) 5. Advantages of MspA as a Nanopore-Trap
(309) MspA nanopore trapping has successfully demonstrated single molecule discrimination in a variety of conformers of CaM. An immediate question is how this sensing scheme is performing when a different nanopore is applied and how future optimization should be carried out. Although we cannot compare all reported nanopores in this study, another two types of nanopores including wildtype -hemolysin (-HL WT) and Cytolysin A-RR (ClyA-RR) were used for a comparison (
(310) -HL also is thermally stable and has a capacity for long-term storage. However, thermal treatment of -HL at 85 C. or with storage for 3 months results in noticeable disassembly of the pore structure, which is a slightly worse performance than that of MspA (
(311) ClyA however has a much wider vestibule than both -HL and MspA and may be more suitable for trapping protein analytes (
(312) TABLE-US-00012 TABLE 10 The minimal capture potentials and stability of different nanopores. .sup.a NANOPORE M2 MSPA -HL WT CLYA-RR MINIMAL apo- +45 N/A N/A CAPTURE wtCaM POTENTIAL .sup.B Ca- +40 +130 N/A (MV) wtCaM NANOPORE 1. No spontaneous 1. No spontaneous 1. Spontaneous gating STABILITY .sup.C gating .sup.d gating .sup.d above +70 mV 2. Remain assembled 2. Partial 2. Completly after heating or long- deoligomerized after depolymerized in term storage heating or long-term SDS-PAGE storage .sup.a All measurements were performed as described in Example 5 Methods 4 but different voltages were applied. [wtCaM] = 0.9 M. .sup.B The lowest applied potential when trapping events could be observed. The results were extracted from FIG. 66, 67 and 69. .sup.C The conclusions are summarized from the results in FIG. 64, 65, 66 and 68. .sup.d No spontaneous gating was observed during electrophysiological measurements in this work.
6. Conclusions
(313) We have used the large vestibule of MspA in an investigation of single molecules of proteins, and different event types caused by allosteric transitions of wtCaM and a disease related mutant have been resolved. The binding capacities of wtCaM with different divalent ions such as Mg.sup.2+, Sr.sup.2+, Ba.sup.2+ and Pb.sup.2+ were evaluated, reporting a result consistent with previous conclusions drawn by NMR or fluorescence studies..sup.175,176 Direct discrimination of CaM when bound with different ions was also achieved by analyzing current fluctuations of the trapping level, indicating a high resolution offered by the conical and rigid structure of MspA. To the best of our knowledge, this is the first demonstration of single molecule protein sensing using MspA. We have observed different states of Tb.sup.3+-induced aggregation of wtCaM in a continuous real-time measurement. A pre-aggregated state of Tb.sup.3 bound to wtCaM was recognized but has not been reported previously. This concentration-dependent aggregation processes reveals the scope of application of Tb.sup.3+ when used as a luminescent Ca.sup.2+ analog.sup.179,180 in studies of Ca.sup.2+ binding proteins. The demonstrated advantages such as a high sensing resolution, a stable sensing background without spontaneous gating, a low measurement noise, a mechanical stability, a consistent pore assembly and the ease of pore preparation and engineering have suggested that MspA may be an ideal choice of nanopore in protein sensing, complementary to existing approaches of nanopore protein sensing using solid state nanopores,.sup.130,133 -HL,.sup.129,145 OmpG.sup.144, FhuA,.sup.143 ClyA,.sup.134,154 FraC.sup.152 or PlyAB..sup.151
(314) 7. Data and Code Availability Statement
(315) All data presented in this work can be provided by the corresponding authors upon reasonable requests.
(316) 8. Acknowledgments
(317) The authors acknowledge Prof Hagan Bayley (University of Oxford), Prof. Giovanni Maglia (University of Groningen), Prof. Zijian Guo (Nanjing University) and Prof Congqing Zhu (Nanjing University) for inspiring discussions and useful suggestions on manuscript submission. This project was funded by National Natural Science Foundation of China (Grant No. 31972917, No. 91753108, No. 21675083), Programs for high-level entrepreneurial and innovative talents introduction of Jiangsu Province (individual and group program). Natural Science Foundation of Jiangsu Province (Grant No. BK20200009), Excellent Research Program of Nanjing University (Grant No. ZYJH004), State Key Laboratory of Analytical Chemistry for Life Science (Grant No. 5431ZZXM1902), Technology innovation fund program of Nanjing University.
Example 5: Materials and Methods for Example 4
(318) 1. Materials
(319) Hexadecane, pentane, ethylenediamine tetraacetic acid (EDTA) and Genapol X-80 were purchased from Sigma-Aldrich. Dioxane-free isopropyl--D-thiogalactopyranoside (IPTG), kanamycin sulfate, ampicillin sodium salt, tris (hydroxymethyl)aminomethane (Tris) and imidazole were from Solarbio. PreScission Protease and PBS (phosphate-buffered saline) was from Beyotime. Pre-stained protein standards and 4-20% SDS-polyacrylamide precast gel was from Bio-Rad and color-coded pre-stained low range protein marker was from Cell Signaling. Instant Blue staining solution for protein gels was from Expedeon. Potassium chloride (KCl), calcium chloride (CaCl.sub.2), sodium chloride (NaCl), magnesium chloride (MgCl.sub.2), strontium chloride (SrCl.sub.2), barium chloride (BaCl.sub.2), lead chloride (PbCl.sub.2), terbium chloride (TbCl.sub.3) and potassium hydroxide (KOH) were from Aladdin. 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES) was from Shanghai Yuanye Biotechnology. Ethylenediaminetetraacetic acid disodium salt (EDTA) was from Sigma-Aldrich. 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPhPC) was from Avanti Polar Lipids. E. coli BL21 (DE3) was from TransGen Biotech. Luria-Bertani (LB) agar and LB broth were from Hopebio. The potassium chloride buffer (1.5M KCl, 10 mM HEPES, pH 7.0) was prepared with Milli-Q water and membrane (0.2 m, Whatman) and filtered prior to use. Metal chlorides were dissolved in Milli-Q water as a stock solution for subsequent measurements. The stock solution of PbCl.sub.2 was prepared with a 100 mM concentration. All other stock solutions were prepared with a 1M concentration.
(320) 2. Methods
(321) The Preparation of Calmodulin (CaM)
(322) The genes coding for CaM, including the wildtype calmodulin (wtCaM) and the CaM-D129G mutant, were respectively synthesized and cloned into separate pET-20b (+) plasmids by Genescript. The overproduction and purification of these two types of CaM were carried out identically in separate batches. Briefly, the corresponding plasmid was first transformed into E. coli BL21 (DE3), which were cultivated on LB agar plates with 100 g/ml Ampicillin at 37 C. overnight. Then, the cells were transferred into a 300 mL LB medium and shaken at 170 rpm until reaching OD.sub.600=0.6. The medium was added with 1 mM IPTG and shaken for 2 h at 37 C. to induce protein overexpression. The cells were harvested, resuspended in the extraction buffer A1 (50 mM Tris-HCl, pH 8.0) and sonicate lysed. The lysate was centrifuged at 15,871 g for 30 min at 4 C. The supernatant, which contained the CaM, was collected and applied on a Hi-Trap (GE Healthcare) anion exchange column for purification. The column was sequentially eluted with 2.5%, 5%, 10%, 15% and 25% concentration of the elution buffer B1 (50 mM Tris-HCl, 2 M NaCl, pH 7.0). All eluted fractions were collected for further characterizations. CaM is a typical acidic protein (isoelectric point=4.3, MW: 16.8 kDa), which has a stronger binding capacity to the anion exchange resin than other proteins in the lysates. It was thus expected to be eluted by 25% elution buffer B1.
(323) The Preparation of M13 Peptide
(324) The M13 peptide was obtained by protease treatment of the GST-M13 fusion protein. The gene coding for the M13 peptide (with a terminator at the end of the sequence) was custom synthesized and cloned into a pGEX-6p-1 plasmid (a bacterial vector for expressing GST fusion proteins with a PreScission protease site) by Genescript. After being transformed with the plasmid, the E. coli BL21 (DE3) cells were cultivated on an LB agar plate with 100 g/ml Ampicillin at 37 C. overnight. A single colony was transferred into a 300 ml LB medium. The medium was shaken at 170 rpm at 37 C. until OD.sub.600=0.8. The overproduction was induced by the addition of 1 mM IPTG and the cultures were incubated at 28 C. for a further 5 h. The cells were harvested, resuspended in a 20 mL extraction buffer A2 (PBS: 135 mM NaCl, 4.7 mM KCl, 10 mM Na.sub.2HPO.sub.4, 2 mM NaH.sub.2PO.sub.4, pH 7.4) and lysed by sonication. Afterwards, the solution was centrifuged at 15,871 g for 30 min at 4 C. to collect the supernatant. The supernatant was applied to a GSTrap (GE Healthcare) column. Then the column was washed with a PBS buffer. Afterwards, the buffer in the column was changed to the PreScission cleavage buffer (50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 1 mM dithiothreitol, pH 7.0). The PreScission Protease mix (with a GST-tag in the N-terminal) was loaded to the column and incubated at 4 C. for 8 h. The M13 peptide, which is the desired protein, was eluted with a 15 ml PreScission cleavage buffer and the GST moiety of the fusion protein and the PreScission Protease remained on the column. The column was eventually washed with the elution buffer B2 (50 mM Tris-HCl 10 mM glutathione, pH 8.0) to remove the bound GST moiety of the fusion protein and the PreScission Protease so that the column was re-initiated for future use. All eluates were characterized by 4-20% SDS-PAGE (
(325) Nanopore Preparations.
(326) The majority of measurements in this work were performed with an MspA mutant, previously named as M2 MspA (D90N/D91N/D93N/D118R/D134R/E139K).sup.182. For simplicity, M2 MspA is referred to as MspA all through this manuscript, if not otherwise stated. Other biological nanopores, including wild-type -HL (WT -HL) and ClyA-RR (D64R/C87A/L99Q/E103G/S110R/F166Y/1203V/C285S/K294R/H307Y) were also used in this work. All the aforementioned nanopores were expressed with E. Coli BL21 (DE3) and purified using nickel affinity chromatography, as described previously..sup.183,184 All plasmid DNAs encoding these nanopores were shared in the Molecular Cloud repository (https://www.molecularcloud.org/s/shuo-huang).
(327) Nanopore Measurements and Data Analysis
(328) Nanopore measurements were performed as described previously..sup.185 The measurement device is composed of two custom polyformaldehyde chambers separated by a 20 m-thick Teflon film with a drilled aperture (100 m in diameter). Before the measurement, the aperture was first treated with 0.5% (v/v) hexadecane in pentane and set for pentane evaporation. Afterward, 500 L electrolyte buffers were added to both chambers, respectively. The buffered solution used for all electrical recordings is composed of 1.5 M KCl and 10 mM HEPES at pH 7.0. Two custom made Ag/AgCl electrodes, electrically connected to the patch-clamp amplifier, were placed in the chambers, in contact with the buffers. Conventionally, the electrically grounded chamber was defined as the cis chamber, while the opposing chamber was defined as the trans chamber. After adding 100 L pentane solution of DPhPC (5 mg/mL) to both chambers, a lipid bilayer was formed by pipetting the electrolyte buffer in either chamber up and down several times. Upon bilayer formation, the acquired current immediately drops to 0 pA indicating that the aperture connecting both chambers has been sealed. MspA was added to the cis chamber to initiate spontaneous pore insertion. Upon a single nanopore insertion, the buffer in the cis chamber was manually exchanged to avoid further pore insertions.
(329) To avoid interferences of external electromagnetic and vibration noises, the device was shielded in a custom Faraday cage (34 cm by 23 cm by 15 cm) mounted on a floating optical table (Jiangxi Liansheng Technology). All electrophysiology measurements were performed with an Axonpatch 200B patch-clamp amplifier paired with a Digidata 1550B digitizer (Molecular Devices). Unless otherwise stated, the voltage applied during all measurements is +60 mV. All measurements were carried out at room temperature (rt) (25 C.). All single-channel recordings were sampled at 25 kHz and low-pass filtered with a corner frequency of 1 kHz.
(330) Calmodulin (CaM) trapping events were detected by the single channel research function in Clampfit 10.7. Subsequent analyses, including histogram plotting, scatter plotting and curve fitting, were performed by Origin 9.2 (Origin Lab).
(331) Molecular Dynamics (MD) Simulations
(332) All molecular dynamics simulations were conducted by Amber20 with the Amber ff14SB force field. The crystal structure of the MspA nanopore was adapted from the Protein Data Bank (PDB) file (1UUN, containing an A96R mutation) by the mutation module of PyMOL (R96A, D93N, D91N, D90N, D118R, D134R and E139K). The initial structures of Ca-wtCaM, apo-wtCaM or M13-Ca-wtCaM were derived from the PDB files 3CLN, 1CFC or 2BBN, respectively. The D129G mutation of CaM was introduced by the mutation module of PyMOL based on the crystal structures of wtCaM for further equilibration. The docking of wtCaM conformers to an MspA was generated by SwarmDock server to set the initial relative positions of Ca-wtCaM and MspA..sup.186 The preprocessing stage of SwarmDock involves repairing disordered loops, modelling missing atoms and posttranslational modifications and minimizing the input structures using the CHARMM molecular mechanics package..sup.187 A 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine (POPC) lipid bilayer and 1.5 M KCl were added by CHARMM-GUI server..sup.188 The tleap module provided by Amber20 was used to fill in the missing hydrogen atoms in the composite system and the system was neutralized by adding K.sup.+ ions. The systems of the MspA-wtCaM complexes were immersed in a 113 113 113 periodic TIP3P cubic water box. The tleap program was used to generate the topology files needed for MD simulation.
(333) To simulate wtCaM-trapping in an MspA, the trapped apo-wtCaM, Ca-wtCaM or M13-Ca-wtCaM conformers with MspA were firstly minimized for 10,000 steps with a 2.0 fs time step. Then the heating process was conducted with Langevin dynamics at 300 K and 1.0 atm for 5 ns. In the production simulations, the SHAKE algorithm was applied to all hydrogen-containing bonds to allow a 2.0 fs time step. Particle Mesh Ewald was utilized for electrostatics and the van der Waals interactions with a real-space cutoff of 12 was applied. Also, the position restraint with a force constant of 5 kcal/mol/.sup.2 was applied to the MspA nanopore to restrain the pore shape. The free energy of the protein-pore interaction F to overcome the entropic costs of squeezing a CaM into a narrow pore were estimated by the equation:
(334)
where T.sub.t is the measurable characteristic temporal parameters, T.sub.total is the total recording time and T.sub.t/T.sub.total is the measured residence probability (Pr) of the protein within the pore. Accordingly, weak constant force pulling simulations (0.012-0.060 kcal/mol/A) were performed continuously along the direction perpendicular to the membrane plane to mimic the constant flow in the experiments according to the F from experiments. Each production simulation lasted for 100 ns.
(335) To compare the trapping capacity of MspA to different wtCaM conformers, the root-mean-square deviations (RMSD) from the initial structures were summarized for the quantitative comparison of conformational fluctuation (
(336) Movie S1. Stochastic sensing of apo-wtCaM. The electrophysiology recording (Example 5 Methods) was carried out with an M2 MspA. Apo-wtCaM was added to cis at a final concentration of 0.6 M. At a +60 mV continuously applied potential, highly consistent resistive pulses caused by apo-wtCaM trapping were observed. For demonstration, the movie is replayed with a speed of data acquisition.
Movie S2. Stochastic sensing of Ca-wtCaM. The electrophysiology recording (Example 5 Methods) was carried out with an M2 MspA. Apo-wtCaM and CaCl.sub.2) was added to cis with a final concentration of 0.6 M and 4 mM for each component. Spontaneous binding between apo-wtCaM and Ca.sup.2+ forms Ca-wtCaM. At a +60 mV continuously applied potential, consistent resistive pulses caused by Ca-wtCaM trapping were observed. For demonstration, the movie was replayed with a speed of data acquisition.
Movie S3. Stochastic sensing of M13-Ca-wtCaM. The electrophysiology recording (Example 5 Methods) was carried out with an M2 MspA. Ca-wtCaM and M13 peptide was added to cis with a final concentration of 0.6 M and 1.0 M for each component. Spontaneous biding between a Ca-wtCaM and an M13 peptide forms the complex M13-Ca-wtCaM. At a +60 mV continuously applied potential, consistent resistive pulses caused by M13-Ca-wtCaM trapping were observed. For demonstration, the movie was replayed with a speed of data acquisition.
Movie S4. Stochastic sensing of Pb-wtCaM. The electrophysiology recording (Example 5 Methods) was carried out with an M2 MspA. Apo-wtCaM and PbCl.sub.2 was added to cis with a final concentration of 0.6 M and 2 mM. Spontaneous binding between apo-wtCaM and Pb.sup.2+ forms Pb-wtCaM. For demonstration, the movie was replayed with a speed of data acquisition.
Movies S5-S7. Simulated trajectories of CaM trapping. MD simulations were performed as described in Example 3 Methods. An octameric M2 MspA was applied as the nanopore trap (a grey goblet shaped porin). An apo-wtCaM (Movie S5), a Ca-wtCaM (Movie S6) or a M13-Ca-wtCaM (Movie S7) was respectively applied as the analyte to be trapped. According to results in
Example 6: General Protein Sensing
(337) As shown in
Example 7: Machine Learning Assisted Simultaneous Structural Profiling of Differently Charged Proteins in a Mycobacterium Smegmatis Porin a (MspA) Electroosmotic Trap
(338) Nanopore is emerging as a means of single molecule protein sensing. However, proteins demonstrate different charge properties, which complicates the design of a sensor that can achieve simultaneous sensing of differently charged proteins. In this example, we introduce an asymmetric electrolyte buffer combined with the Mycobacterium smegmatis porin A (MspA) nanopore to form an electroosmotic flow (EOF) trap. Apo and holo-myoglobin, which differ in only a single heme, can be fully distinguished with the superior resolution provided by MspA. Direct discrimination of lysozyme, apo/holo-myoglobin and the ACTR/NCBD protein complex, which are basic, neutral and acidic proteins respectively, was simultaneously achieved by the MspA EOF trap. To automate event classification, multiple event features were extracted to build a machine learning model, with which a 99.9% accuracy is achieved. The demonstrated method was also applied to identify single molecules of -lactalbumin and -lactoglobulin directly from the whey protein powder. This protein sensing strategy is useful in direct recognition of a protein from a mixture, suggesting its prospective use in rapid and sensitive detection of biomarkers or real-time protein structural analysis.
(339) We applied the asymmetric electrolyte combination to the MspA nanopore-trap for protein structural profiling. The accumulated multivalent cations bound tightly to the negatively charged pore lumen were expected to switch the effective surface charge and to trigger the generation of EOF in nanopores. With an iso-osmotic asymmetric electrolyte buffer combination (cis: 1.5 M KCl/trans: 1 M CaCl.sub.2), the capture efficiencies of proteins with different charges were significantly improved and the duration of single protein trapping was significantly extended, providing rich information for protein recognition, assisted by a machine learning algorithm.
(340) Results and Discussion
(341) MspA nanopore-trap in the presence of calcium flux. All electrophysiology measurements were performed using an M2 MspA mutant (D90N/D91N/D93N/D118R/D134R/E139K, Example 8-Methods 2) (
(342) Lysozyme, an antimicrobial enzyme that forms part of the innate immune system of animals, was employed as a representative basic protein with an isoelectric point (pI) of 11..sup.228 To demonstrate the effect of an asymmetric electrolyte combination, the sensing performance was evaluated with a symmetric electrolyte combination of 1.5 M KCl (cis)/1.5 M KCl (trans) and an asymmetric electrolyte combination of 1.5 M KCl (cis)/1.0 M CaCl.sub.2 (trans). With a +100 mV potential continuously applied and an addition of lysozyme to a final concentration of 0.42 M, sequential appearance of resistive pules was observed in both measurement conditions (
(343) Recent studies indicated that the use of polyvalent cations such as Mg.sup.2+ and La.sup.3+ in the electrophysiology measurements could produce localized charge inversion in a nanopore,.sup.229-232 because the accumulated multivalent ions can change the nanopore surface charge profile. The surface charge profile in the pore lumen is relevant to the generation of the EOF, a potential driving force distinct from the electrophoretic force to trap an analyte in the nanopore..sup.209-212 Consequently, the asymmetric electrolyte combination may optimize the protein sensing capacity of MspA. To eliminate the interference of the electrophoretic force, trimethyl--cyclodextrin (trimethyl-3-CD), an electrically neutral molecule.sup.233-234 was applied as a test analyte to probe the EOF generation in MspA (
(344) Results of lysozyme trapping were as well analyzed (
(345) Discrimination of apo-myoglobin and holo-myoglobin. Myoglobin, an electrically neutral protein found in the human bloodstream after skeletal muscle injury or renal insufficiency, is a sensitive disease marker..sup.236-237 Subtle differences in the structure and charge properties between the heme-free (apo-) and heme-bound (holo-) forms of myoglobin make it a suitable model protein for structural methodology studies (
(346) Nanopore measurements were carried out by adding apo-myoglobin to cis with a final concentration of 0.14 M. Under a +100 mV applied potential, continuous current blockage was observed (
(347) A cofactor of myoglobin heme was further added to cis to coordinate with the apo-myoglobin. When the final concentration of heme was increased from 0 to 0.15 M, a different type of sensing events began to appear (
(348) By applying a larger potential, the .sub.off and 1/.sub.off values of the holo-myoglobin events were increased (
(349) Single-molecule trapping of the ACTR/NCBD complex. The p160 steroid receptor coactivator (ACTR, theoretical pI=4.1, Example 8-Method 3) and the nuclear coactivator binding domain of CREB-binding protein (NCBD, theoretical pI=11.1, Example 8-Method 3) were then adopted as representative intrinsic disordered proteins (IDP) to be probed by the nanopore trap. The mutual-induced folding process of these IDPs is activated only by mixing.sup.241, causing formation of the ACTR/NCBD complex (theoretical pI=5.75, Example 8-Method 3) (
(350) ACTR and NCBD were obtained by enzymolysis of corresponding GST fusion proteins (Example 8-Methods 3,
(351) After mixing ACTR and NCBD in an equimolar ratio for 5 min, the mixture was added to cis. The folded ACTR/NCBD complex was formed and during subsequent nanopore measurements exhibited a new type of single conformational state, different from that of either ACTR or NCBD (
(352) Artificial intelligence assisted profiling of differently charged proteins. Assisted by the asymmetric electrolyte buffer combination, lysozyme (pI=11), holo-myoglobin (pI=7.3), apo-myoglobin (pI=8.5) and ACTR/NCBD complex (theoretical pI=5.75) which have different charge and structural properties, were all detectable in the same measurement buffer condition (
(353) We established an artificial intelligence (AI) algorithm which assists automated protein recognition (Example 8-Methods 1). The strategy was to train AI to learn from the training data to build an optimum classification model to classify unknown nanopore events, similarly to those applied in previous nanopore researches..sup.227, 242-244 This strategy is particularly useful when events caused by different analytes are only distinguishable by simultaneously analyzing multiple event features. To train the model, several training data sets were assembled. Nanopore events were first extracted from raw time current traces (
(354) Model training was performed using the Classification Learner toolbox of MATLAB. A set of classifiers including decision trees, discriminant analysis, support vector machines (SVM), K nearest neighbors (KNN), naive Bayes, ensemble, and neural network classifiers were estimated (
(355) The trained model was then exported to predict events with unknown identities, as demonstrated in
(356) Machine Learning Assisted Whey Protein Identification.
(357) The MspA EOF trap and the machine learning algorithm was further applied to the identification of protein ingredients in commercial whey protein powder. Whey protein accounts for about 18%-20% of all milk protein. It is widely used as a protein supplement to improve athletic performance. The major protein components of whey protein include -lactalbumin and -lactoglobulin along with a minor amount of other proteins and peptides..sup.247
(358) Experimentally, -lactalbumin or -lactoglobulin were first respectively analyzed as the sole analyte during each measurement with a +30 mV continually applied potential. The corresponding nanopore events were collected to form the training dataset (
(359) Seven event features were extracted from events of -lactalbumin standards (n=301 events), -lactoglobulin standards (n=253 events) and others (n=109 events) to form the training dataset (
(360) The bagged tree model was then employed to identify the ingredients in whey protein (
CONCLUSIONS
(361) An electroosmotic trap based on Mycobacterium smegmatis porin A (MspA) has been demonstrated. The application of an asymmetric buffer combination is critical in the generation of an EOF, which improves the efficiency of protein trapping by a factor of 7-18 and can extend the event dwell time by a factor of up to 159 (holo-myoglobin) (Table 11).
(362) Our results demonstrate a balance between EOF and EPF in the pore lumen, which is qualitatively consistent with that predicted by a recently published theoretical model.sup.235. However to quantitatively describe the results of acquired with the specific pore and analyte, an all atom molecular dynamics simulation may be required.
(363) Acknowledging the conical lumen geometry which enables a high resolution of sensing, MspA clearly discriminates between apo- and holo-myoglobin.sup.239. The structural difference between the intrinsically disordered proteins (ACTR and NCBD) and their bimolecular complex was also clearly identified. Generally, the MspA EOF trap demonstrates a structural consistency down to an atomic precition, which is not yet achieved by any solid state nanopores. This is important to guarantee the measurement consistency between different batches of pores. Compared with other biological nanopores such as ClyA.sup.248, FraC.sup.209 and PlyAB.sup.213, an advantage of MspA is that it has a much enhanced assembly stability and structural rigidity, which is free of spontaneous gating and provides a low noise and highly consistent measurement performance. The conical lumen geometry of MspA also provides an advantage to simultaneously deal with a wider size range of protein analytes.
(364) The EOF trap also demonstrates simultaneous sensing of representative acidic proteins such as the ACTR/NCBD complex, basic proteins (lysozyme) and neutral proteins (apo- and holo-myoglobin). This is the first time that proteins with an obvious difference in charge properties have been analyzed simultaneously. Previously reported nanopore traps such as ClyA.sup.219 and FraC.sup.209 have proved to be more suitable for the analysis of positively charged proteins. The unfavorable signal from negatively charged proteins usually needs to be eliminated by lowering the pH of the test buffer or introducing a charged dipole to the protein analyte. However, proteins with pI=5.75, 7.3, 8.5 or 11 can be simultaneously captured by a MspA nanopore-trap in a buffer condition at pH=7.0 and the protein identities can be recognized reliably. These results indicate that the combination of 1.5 M KCl in cis and 1 M CaCl.sub.2 in trans could optimize the MspA trapping for protein structure profiling. By performing realtime observation of a single trapped protein, valuable information such as the kinetics of ligand/protein interaction or conformational change of the protein may be obtained with a high resolution, useful in fundamental research of protein science.
(365) A machine learning based protein classifier has also been developed to automate data analysis. The classification algorithm is based on simultaneous consideration of multiple event features. It is thus advantageous to discriminate between events that are however difficult to be distinguished solely based on the blockage amplitude. An impressive 99.9% validation accuracy was also reported in the distinguishment between lysozyme, ACTR/NCBD complex, holo-myoglobin and apo-myoglobin. The MspA EOF trap and the machine learning classifier has also been applied to identify -lactalbumin and -lactoglobulin directly from whey protein powder, suggesting that the developed method and the classifier algorithm is generic to a wide variety of protein types as an analytical tool. The automatic algorithm also saves human labor and avoids errors caused by subjective human judgments.
(366) Data Availability Statement
(367) All data presented in this work can be provided by the corresponding authors upon reasonable requests.
(368) Acknowledgment
(369) This project was funded by National Natural Science Foundation of China (Grant No. 31972917, No. 91753108, No. 21675083), Supported by the Fundamental Research Funds for the Central Universities (Grant No. 020514380257, No. 020514380261), Programs for high-level entrepreneurial and innovative talents introduction of Jiangsu Province (individual and group program), Natural Science Foundation of Jiangsu Province (Grant No. BK20200009), Excellent Research Program of Nanjing University (Grant No. ZYJH004), Shanghai Municipal Science and Technology Major Project, State Key Laboratory of Analytical Chemistry for Life Science (Grant No. 5431ZZXM1902), Technology innovation fund program of Nanjing University, China Postdoctoral Science Foundation (Grant No. 2021M691508).
Example 8: Materials and Methods for Example 7
(370) Materials
(371) Hexadecane, pentane, ethylenediamine tetraacetic acid (EDTA), glutathione (GSH), apo-myoglobin (from equine skeletal muscle), lysozyme (from chicken egg white), -lactalbumin (from bovine milk) and Genapol X-80 were purchased from Sigma-Aldrich. -lactoglobulin (from bovine milk) was purchased from RHAWN. Whey protein powder was purchased from Swisse. Ferroheme was purchased from CSNpharm. Dioxane-free isopropyl--D-thiogalactopyranoside (IPTG), kanamycin sulfate, ampicillin sodium salt, tris (hydroxymethyl)aminomethane (Tris) and imidazole were from Solarbio. PreScission Protease and PBS (phosphate-buffered saline) were from Beyotime. Pre-stained protein standards and 4-20% SDS-polyacrylamide precast gel was from Bio-Rad. Instant Blue staining solution was from Expedeon. Potassium chloride (KCl), calcium chloride (CaCl.sub.2), sodium chloride (NaCl) and magnesium chloride (MgCl.sub.2) were from Aladdin. 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES) and holo-myoglobin (from equine skeletal muscle) were from Shanghai Yuanye Biotechnology. Ethylenediaminetetraacetic acid disodium salt (EDTA) was from Sigma-Aldrich. 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPhPC) was from Avanti Polar Lipids. E. coli BL21 (DE3) was from TransGen Biotech. Luria-Bertani (LB) agar and LB broth were from Hopebio. The potassium chloride buffer (1.5M KCl, 10 mM HEPES, pH 7.0) was prepared with Milli-Q water and membrane (0.2 m, Whatman) filtered prior to use. The stock solution of lysozyme, holo-myoglobin and apo-myoglobin were prepared with a 1 mg/mL concentration for subsequent measurements. The stock solution of -lactalbumin, -lactoglobulin and whey protein were prepared with a concentration of 2.5 mg/mL for subsequent measurements.
(372) Methods
(373) 1. Nanopore Measurements and Data Analysis
(374) All nanopore measurements were performed as described previously..sup.249 Briefly, the measurement device is composed of two custom polyformaldehyde chambers separated by a 20 m-thick Teflon film with a drilled aperture (100 m in diameter). Before the measurement, the aperture was first treated with 0.5% (v/v) hexadecane in pentane and allowed to stand for pentane evaporation. Conventionally, the electrically grounded chamber was defined as the cis chamber, while the opposing chamber was defined as the trans chamber. Afterwards, 500 L electrolyte buffers were respectively added to both chambers. Unless otherwise stated, all nanopore measurements in this paper were performed with a 1.5 M KCl buffer (1.5 M KCl, 10 mM HEPES, pH 7.0) in cis and a 1.0 M CaCl.sub.2 buffer (1.0 M CaCl.sub.2, 10 mM HEPES, pH 7.0) in trans. Two custom-made Ag/AgCl electrodes, electrically connected to the patch-clamp amplifier, were placed in both chambers, in contact with the buffers to form a closed circuit. After adding 100 L pentane solution of DPhPC (5 mg/mL) to both chambers, a lipid bilayer was formed by pipetting the electrolyte buffer in either chamber up and down several times. Upon bilayer formation, the acquired current immediately drops to 0 pA indicating that the aperture has been sealed by the formed lipid bilayer. MspA was then added to the cis chamber to initiate spontaneous pore insertion. Upon a single nanopore insertion, the buffer in the cis chamber was manually exchanged to avoid further pore insertions.
(375) To avoid interferences from external electromagnetic and vibration noises, the device was shielded in a custom Faraday cage (34 cm by 23 cm by 15 cm) mounted on a floating optical table (Jiangxi Liansheng Technology). All electrophysiology results were acquired with an Axonpatch 200B patch-clamp amplifier paired with a Digidata 1550B digitizer (Molecular Devices). Unless otherwise stated, the voltage applied during all measurements was +100 mV and all measurements were carried out at room temperature (rt) (25 C.). All single-channel recordings were sampled at 25 kHz and low-pass filtered with a corner frequency of 1 kHz.
(376) All protein trapping events were detected by the single channel research function in Clampfit 10.7. The Axon abf files are imported into MATLAB using a abfload algorithm (Harald Hentschke (2021). abfload (https://www.mathworks.com/matlabcentral/fileexchange/6190-abfload), MATLAB Central File Exchange. Retrieved Sep. 1, 2021) to read the features of blocking current. The machine learning model training process were performed using the Classification Learner toolbox of MATLAB. The prediction process was performed using a custom algorithm in MATLAB. Subsequent analyses, including histogram plotting, scatter plot generation and curve fitting were performed by Origin 9.2 (Origin Lab).
(377) 2. Nanopore Preparations.
(378) All measurements in this work were performed with an MspA mutant named M2 MspA (D90N/D91N/D93N/D118R/D134R/E139K). For simplicity, M2 MspA is referred to as MspA all through this manuscript, if not otherwise stated. The monomeric MspA was expressed with E. Co/i BL21 (DE3) and purified using nickel affinity chromatography..sup.250 The plasmid DNA coding for M2 MspA was shared in the Molecular Cloud repository (https://www.noleculalogorg/s/shuo-huang, access code: MC_0101191).
(379) 3. The Preparation of ACTR and NCBD Peptides
(380) The ACTR and NCBD peptides were both prepared by protease treatment of the GST-peptide fusion protein. The gene coding for the ACTR or NCBD peptide (with a terminator at the end of the sequence) was custom-synthesized and cloned into a pGEX-6p-1 plasmid (a bacterial vector for expressing GST fusion proteins with a PreScission protease site) by Genescript. After being transformed with the plasmid, the E. coli BL21 (DE3) cells were cultivated on an LB agar plate with 100 g/ml Ampicillin at 37 C. for 10 h. A single colony was transferred into a 300 mL LB medium with 100 g/ml Ampicillin. The medium was shaken at 170 rpm at 37 C. until OD.sub.600=0.8. Overproduction was induced by the addition of 1 mM IPTG and the cultures were incubated at 28 C. for another 5 h. The cells were harvested, resuspended in a 20 mL extraction buffer A1 (135 mM NaCl, 4.7 mM KCl, 10 mM Na.sub.2HPO.sub.4, 2 mM NaH.sub.2PO.sub.4, pH 7.4) and lysed by sonication. Afterwards, the solution was centrifuged at 15,871 g for 30 min at 4 C. to collect the supernatant. The supernatant was applied to a GSTrap (GE Healthcare) column. Then the column was washed with PBS buffer. Subsequently, the buffer in the column was changed to the PreScission cleavage buffer (50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 1 mM dithiothreitol, pH=7.0). The PreScission Protease mix with a GST-tag in the N-terminal was loaded to the column and incubated at 4 C. for 8 h. The ACTR peptide (or NCBD peptide), which is the target protein, was eluted with a 15 mL PreScission cleavage buffer while the GST moiety of the fusion protein and the PreScission Protease remained on the column. The column was eventually washed with elution buffer B1 (50 mM Tris-HCl 10 mM glutathione, pH 8.0) to remove the bound GST moiety of the fusion protein and the PreScission Protease so that the column was re-initiated for future use. All eluates were characterized by 4-20% SDS-PAGE (
(381) The isoelectric points (pI) of ACTR, NCBD and their complex have never been reported. Their theoretical pI values, as referenced in this article, were calculated by Expasy, (https://web.expasy.org/protparam/) based on their amino acid sequence.
(382) TABLE-US-00013 TABLE 11 Mean dwell time (.sub.off) and mean interevent duration (.sub.on) of the protein trapping with different electrolyte combinations. All measurements were carried out as described in Example 8 Methods 1 with M2 MspA. A +100 mV voltage was continuously applied during the measurements. Lysozyme, holo-myoglobin, apo-myoglobin, ACTR peptide, NCBD peptide and ACTR/NCBD complex were applied as the analytes. All statistical results were derived from results of three independent measurements (N = 3). MEAN MEAN INTEREVENT THE ELECTROLYTE INDEPENDENT DWELL TIME DURATION TIME ANALYTE CIS/TRANS MEASUREMENTS (.sub.off, MS) (.sub.on, MS) LYSOZYME 1.5M KCl/1.0M 1 50.8 27.5 CaCl.sub.2 2 47.5 49.4 3 43.7 37.3 mean std 47.3 3.5 38.0 11.0 1.5M KCl/1.5M 1 5.4 492.6 KCl 2 5.6 487.8 3 5.3 401.6 mean std 5.4 0.2 460.7 51.2 HOLO- 1.5M KCl/1.0M 1 598.8 248.1 MYOGLOBIN CaCl.sub.2 2 625.0 186.9 3 540.5 152.0 mean std 588.1 43.2 195.7 48.7 1.5M KCl/1.5M 1 3.8 1470.6 KCl 2 4.1 1111.1 3 3.2 1694.9 mean std 3.7 0.4 1319.2 321.1 APO- 1.5M KCl/1.0M 1 552.5 389.1 MYOGLOBIN CaCl.sub.2 2 500.0 371.7 3 540.5 334.4 mean std 531.0 27.5 365.1 27.9 1.5M KCl/1.5M 1 8.7 3125.0 KCl 2 7.1 4347.8 3 6.0 3448.3 mean std 7.3 1.3 3640.4 633.6 ACTR/NCBD 1.5M KCl/1.0M 1 15.5 194.9 COMPLEX CaCl.sub.2 2 15.8 166.7 3 17.3 129.2 mean std 16.2 0.9 163.6 33.0 1.5M KCl/1.5M 1 7.1 3448.3 KCl 2 6.8 2857.1 3 7.2 2613.6 mean std 7.0 0.2 2979.0 421.8 ACTR 1.5M KCl/1.0M 1 0.1 246.3 PEPTIDE CaCl.sub.2 2 0.1 363.6 3 0.1 333.3 mean std 0.1 0.01 314.4 60.9 NCBD 1.5M KCl/1.0M 1 1.0 322.6 PEPTIDE CaCl.sub.2 2 1.2 352.1 3 1.3 234.2 mean std 1.2 0.1 303.0 61.35
(383) TABLE-US-00014 TABLE 12 Mean current blockade ratio (
(384) TABLE-US-00015 TABLE 13 Correlation analysis between
(385) TABLE-US-00016 TABLE 14 Mean dwell time (
Movie S8. Stochastic sensing of apo-myoglobin and holo-myoglobin. The electrophysiology recording was carried out as described in Example 8 Methods 1. The measurements were carried out in a buffer of 1.5 M KCl/1.0 M CaCl.sub.2 (pH=7.0). Apo-myoglobin and holo-myoglobin were added to cis with a final concentration of 0.18 M and 0.35 M, respectively. A transmembrane potential of +100 mV was continuously applied, during which highly consistent resistive pulses caused by apo- or holo-myoglobin trapping were observed. Event identification was carried out by machine learning prediction. The identified events were labelled as AM (apo-myoglobin) and HM (holo-myoglobin), respectively. For the demonstration, the movie is played back with 0.5 speed of the actual data acquisition.
Movie S9. Stochastic sensing of lysozyme, apo-myoglobin, holo-myoglobin and ACTR/NCBD complex. The electrophysiology recording was carried out as described in Example 8 Methods 1. The measurements were carried out in the buffer of 1.5 M KCl/1.0 M CaCl.sub.2 (pH=7.0). Lysozyme, apo-myoglobin, holo-myoglobin and ACTR/NCBD were added to the cis chamber with a final concentration of 0.16, 0.18, 0.35 and 1.28 M, respectively. A transmembrane potential of +100 mV was continuously applied, during which highly consistent resistive pulses caused by different proteins are observed. Event identification was carried out by machine learning prediction (
Movie S10. Stochastic sensing of whey proteins. The electrophysiology recording was carried out as described in Example 8 Methods 1. The measurements were carried out in the buffer of 1.5 M KCl/1.0 M CaCl.sub.2 (pH=7.0). Whey protein was added to cis with a final concentration of 25 g/ml. A transmembrane potential of +30 mV was continually applied, during which highly consistent resistive pulses caused by different components were observed. Event identification was carried out by machine learning (
Example 9: Stochastic Sensing of Lysozyme-Substrate Complex with MsPA Electroosmotic Trap
(386) The structure changes of lysozyme after binding with n-acetylchitohexaose (substrate of lysozyme) could been clearly distinguished with the MspA electroosmotic trap under this asymmetric electrolyte buffer condition (
REFERENCE
(387) 1. Mortimer, S. A., Kidwell, M. A. & Doudna, J. A. Insights into RNA structure and function from genome-wide studies. Nat. Rev. Genet. 15, 469-479 (2014). 2. Batey, R. T., Rambo, R. P. & Doudna, J. A. Tertiary motifs in RNA structure and folding. Angewandte Chemie-International Edition 38, 2327-2343 (1999). 3. Zhuang, X. W. et al. A single-molecule study of RNA catalysis and folding. Science 288, 2048-2051 (2000). 4. Lee, J. T. Epigenetic Regulation by Long Noncoding RNAs. Science 338, 1435-1439 (2012). 5. Keel, A. Y., Rambo, R. P., Batey, R. T. & Kieft, J. S. A general strategy to solve the phase problem in RNA crystallography. Structure 15, 761-772 (2007). 6. Lukavsky, P. J., Kim, I., Otto, G. A. & Puglisi, J. D. Structure of HCVIRES domain II determined by NMR. Nature Structural Biology 10, 1033-1038 (2003). 7. Varani, G., Aboulela, F. & Allain, F. H. T. NMR investigation of RNA structure. Progress in Nuclear Magnetic Resonance Spectroscopy 29, 51-127 (1996). 8. Zhang, H. & Keane, S. C. Advances that facilitate the study of large RNA structure and dynamics by nuclear magnetic resonance spectroscopy. Wiley Interdisciplinary Reviews-Rna 10, e1541 (2019). 9. Zhang, K. et al. Structure of the 30 kDa HIV-1 RNA Dimerization Signal by a Hybrid Cryo-EM, NMR, and Molecular Dynamics Approach. Structure 26, 490-498 (2018). 10. Zhang, K. et al. Cryo-EM structure of a 40 kDa SAM-IV riboswitch RNA at 3.7 angstrom resolution. Nature Communications 10, 5511 (2019). 11. Zhao, R. & Rueda, D. RNA folding dynamics by single-molecule fluorescence resonance energy transfer. Methods 49, 112-117 (2009). 12. Williams, M. C. & Rouzina, I. Force spectroscopy of single DNA and RNA molecules. Current Opinion in Structural Biology 12, 330-336 (2002). 13. Henley, R. Y. et al. Electrophoretic Deformation of Individual Transfer RNA Molecules Reveals Their Identity. Nano Letters 16, 138-144 (2016). 14. Rozevsky, Y. et al. Quantification of mRNA expression using single-molecule nanopore sensing. ACS nano 14, 13964-13974 (2020). 15. Shasha, C. et al. Nanopore-Based Conformational Analysis of a Viral RNA Drug Target. ACS Nano 8, 6425-6430 (2014). 16. Wanunu, M. et al. Nanopore analysis of individual RNA/antibiotic complexes. ACS Nano 5, 9345-9353 (2011). 17. Skinner, G. M., van den Hout, M., Broekmans, O., Dekker, C. & Dekker, N. H. Distinguishing single-and double-stranded nucleic acid molecules using solid-state nanopores. Nano Letters 9, 2953-2960 (2009). 18. Ying, Y.-L., Cao, C. & Long, Y.-T. Single molecule analysis by biological nanopore sensors. Analyst 139, 3826-3835 (2014). 19. Cao, C. et al. Discrimination of oligonucleotides of different lengths with a wild-type aerolysin nanopore. Nature Nanotechnology 11, 713-718 (2016). 20. Thakur, A. K. & Movileanu, L. Real-time measurement of protein-protein interactions at single-molecule resolution using a biological nanopore. Nature biotechnology 37, 96-101 (2019). 21. Ouldali, H. et al. Electrical recognition of the twenty proteinogenic amino acids using an aerolysin nanopore. Nature Biotechnology 38, 176-181 (2020). 22. Zhang, X. et al. Nanopore electric snapshots of an RNA tertiary folding pathway. Nature Communications 8, 1458 (2017). 23. Lu, B. et al. Protein Motion and Configurations in a Form-Fitting Nanopore: Avidin in CIyA. Biophysical Journal 115, 801-808 (2018). 24. Jing, P., Haque, F., Vonderheide, A. P., Montemagno, C. & Guo, P. Robust properties of membrane-embedded connector channel of bacterial virus phi29 DNA packaging motor. Molecular Biosystems 6, 1844-1852 (2010). 25. Tanaka, K., Caaveiro, J. M. M., Morante, K., Manuel Gonzalez-Manas, J. & Tsumoto, K. Structural basis for self-assembly of a cytolytic pore lined by protein and lipid. Nature Communications 6, 6337 (2015). 26. Huang, G. et al. Electro-Osmotic Vortices Promote the Capture of Folded Proteins by PlyAB Nanopores. Nano Letters 20, 3819-3827 (2020). 27. Soskine, M., Biesemans, A., De Maeyer, M. & Maglia, G. Tuning the Size and Properties of CIyA Nanopores Assisted by Directed Evolution. J Am Chem Soc 135, 13456-13463 (2013). 28. Faller, M., Niederweis, M. & Schulz, G. E. The structure of a mycobacterial outer-membrane channel. Science 303, 1189-1192 (2004). 29. Heinz, C., Engelhardt, H. & Niederweis, M. The core of the tetrameric mycobacterial porin MspA is an extremely stable beta-sheet domain. Journal of Biological Chemistry 278, 8678-8685 (2003). 30. Manrao, E. A. et al. Reading DNA at single-nucleotide resolution with a mutant MspA nanopore and phi29 DNA polymerase. Nature Biotechnology 30, 349-353 (2012). 31. Craig, J. M. et al. Determining the effects of DNA sequence on Hel308 helicase translocation along single-stranded DNA using nanopore tweezers. Nucleic Acids Research 47, 2506-2513 (2019). 32. Butler, T. Z., Pavlenok, M., Derrington, I. M., Niederweis, M. & Gundlach, J. H. Single-molecule DNA detection with an engineered MspA protein nanopore. Proceedings of the National Academy of Sciences of the United States of America 105, 20647-20652 (2008). 33. Wang, S. et al. Retarded Translocation of Nucleic Acids through alpha-Hemolysin Nanopore in the Presence of a Calcium Flux. ACS Applied Materials & Interfaces 12, 26926-26935 (2020). 34. Chan, J. A., Krichevsky, A. M. & Kosik, K. S. MicroRNA-21 is an antiapoptotic factor in human glioblastoma cells. Cancer Research 65, 6029-6033 (2005). 35. Elbashir, S. M. et al. Duplexes of 21-nucleotide RNAs mediate RNA interference in cultured mammalian cells. Nature 411, 494-498 (2001). 36. Pan, Y. P. & MacKerell, A. D. Altered structural fluctuations in duplex RNA versus DNA: a conformational switch involving base pair opening. Nucleic Acids Research 31, 7131-7140 (2003). 37. Perera, R. T. et al. Unzipping of A-Form DNA-RNA, A-Form DNA-PNA, and B-Form DNA-DNA in the alpha-Hemolysin Nanopore. Biophysical Journal 110, 306-314 (2016). 38. Carroll, J. S. et al. Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1. Cell 122, 33-43 (2005). 39. Sano, M. et al. Effect of asymmetric terminal structures of short RNA duplexes on the RNA interference activity and strand selection. Nucleic Acids Research 36, 5812-5821 (2008). 40. Ghosh, P. et al. Comparing 2-nt 3 overhangs against blunt-ended siRNAs: a systems biology based study. BMC genomics 10, S17 (2009). 41. Sponer, J. et al. RNA Structural Dynamics As Captured by Molecular Simulations: A Comprehensive Overview. Chemical Reviews 118, 4177-4338 (2018). 42. Wimmer, E., Maxwell, I. H. & Tener, G. M. A Simple Method for Isolating Highly Purified Yeast Phenylalanine Transfer Ribonucleic Acid. Biochemistry-Us 7, 2623-2628 (1968). 43. Yatime, L. et al. Structural basis for the targeting of complement anaphylatoxin C5a using a mixed L-RNA/L-DNA aptamer. Nature Communications 6, 6481 (2015). 44. Correll, C. C., Freeborn, B., Moore, P. B. & Steitz, T. A. Metals, motifs, and recognition in the crystal structure of a 5S rRNA domain. Cell 91, 705-712 (1997). 45. Steitz, J. A. et al. A 5S rRNA/L5 complex is a precursor to ribosome assembly in mammalian cells. The Journal of cell biology 106, 545-556 (1988). 46. Mueller, F. et al. The 3D arrangement of the 23 S and 5 S rRNA in the Escherichia coli 50 S ribosomal subunit based on a cryo-electron microscopic reconstruction at 7.5 resolution. Journal of molecular biology 298, 35-59 (2000). 47. Friebe, P., Boudet, J., Simorre, J. P. & Bartenschlager, R. Kissing-loop interaction in the 3 end of the hepatitis C virus genome essential for RNA replication. Journal of Virology 79, 380-392 (2005). 48. Shu, D., Shu, Y., Haque, F., Abdelmawla, S. & Guo, P. Thermodynamically stable RNA three-way junction for constructing multifunctional nanoparticles for delivery of therapeutics. Nature Nanotechnology 6, 658-667 (2011). 49. Namy, O., Moran, S. J., Stuart, D. I., Gilbert, R. J. C. & Brierley, I. A mechanical explanation of RNA pseudoknot function in programmed ribosomal frameshifting. Nature 441, 244-247 (2006). 50. Klein, D. J., Schmeing, T. M., Moore, P. B. & Steitz, T. A. The kink-turn: a new RNA secondary structure motif. Embo Journal 20, 4214-4221 (2001). 51. Kumari, S., Bugaut, A., Huppert, J. L. & Balasubramanian, S. An RNA G-quadruplex in the 5 UTR of the NRAS proto-oncogene modulates translation. Nature Chemical Biology 3, 218-221 (2007). 52. Schreiber, J. et al. Error rates for nanopore discrimination among cytosine, methylcytosine, and hydroxymethylcytosine along individual DNA strands. Proceedings of the National Academy of Sciences of the United States of America 110, 18910-18915 (2013). 53. Smith, A. M., Abu-Shumays, R., Akeson, M. & Bernick, D. L. Capture, Unfolding, and Detection of Individual tRNA Molecules Using a Nanopore Device. Frontiers in bioengineering and biotechnology 3, 91 (2015). 54. Misiunas, K., Ermann, N. & Keyser, U. F. QuipuNet: Convolutional Neural Network for Single-Molecule Nanopore Sensing. Nano Letters 18, 4040-4045 (2018). 55. Cardozo, N. et al. Multiplexed direct detection of barcoded protein reporters on a nanopore array. bioRxiv, 837542 (2019). 56. Bhattacharya, S. et al. Molecular Dynamics Study of MspA Arginine Mutants Predicts Slow DNA Translocations and Ion Current Blockades Indicative of DNA Sequence. ACS Nano 6, 6960-6968 (2012). 57. Aksimentiev, A., Heng, J. B., Timp, G. & Schulten, K. Microscopic kinetics of DNA translocation through synthetic nanopores. Biophysical journal 87, 2086-2097 (2004). 58. Leehey, M. A., Squassoni, C. A., Friederich, M. W., Mills, J. B. & Hagerman, P. J. A noncanonical tertiary conformation of a human mitochondrial transfer RNA. Biochemistry-Us 34, 16235-16239 (1995). 59. Farnsworth, R. W., Keating, J., McAuley, M. & Smith, R. Optimization of a Protocol for Escherichia coli RNA Extraction and Visualization. Journal of Experimental Microbiology and Immunology 5, 87-94 (2004). 60. Hingerty, B., Brown, R. S. & Jack, A. Further refinement of structure of yeast transfer-RNA phe. Journal of Molecular Biology 124, 523-534 (1978). 61. Sussman, J. L., Holbrook, S. R., Warrant, R. W., Church, G. M. & Kim, S. H. Crystal structure of yeast phenylalanine transfer RNA. I. Crystallographic refinement. Journal of Molecular Biology 123, 607-630 (1978). 62. Schevitz, R. W., Podjarny, A. D., Krishnamachari, N., Hughes, J. J. & Sigler, P. B. Crystal-structure of a eukaryotic initiator transfer-RNA. Nature 278, 188-190 (1979). 63. Woo, N. H., Roe, B. A. & Rich, A. 3-dimensional structure of Escherichia-coli initiator transfer RNA-f(met). Nature 286, 346-351 (1980). 64. Westhof, E., Dumas, P. & Moras, D. Crystallographic refinement of yeast aspartic-acid transfer-RNA. Journal of Molecular Biology 184, 119-145 (1985). 65. Huang, Q., Mao, Z., Li, S., Hu, J. & Zhu, Y. A non-radioactive method for small RNA detection by northern blotting. Rice 7, 26 (2014). 66. Guo, C. et al. Silica nanoparticles induce oxidative stress, inflammation, and endothelial dysfunction in vitro via activation of the MAPK/Nrf2 pathway and nuclear factor-kappa B signaling. International Journal of Nanomedicine 10, 1463-1477 (2015). 67. Grosshans, H., Hurt, E. & Simos, G. An aminoacylation-dependent nuclear tRNA export pathway in yeast. Genes & Development 14, 830-840 (2000). 68. Dittmar, K. A., Goodenbour, J. M. & Pan, T. Tissue-specific differences in human transfer RNA expression. Plos Genetics 2, 2107-2115 (2006). 69. Honda, S., Shigematsu, M., Morichika, K., Telonis, A. G. & Kirino, Y. Four-leaf clover qRT-PCR: A convenient method for selective quantification of mature tRNA. Rna Biology 12, 501-508 (2015). 70. Zheng, G. et al. Efficient and quantitative high-throughput tRNA sequencing. Nature Methods 12, 835-837 (2015). 71. Torrent, M., Chalancon, G., de Groot, N. S., Wuster, A. & Babu, M. M. Cells alter their tRNA abundance to selectively regulate protein synthesis during stress conditions. Science Signaling 11, eaat6409 (2018). 72. Fu, H. et al. Stress induces tRNA cleavage by angiogenin in mammalian cells. Febs Letters 583, 437-442 (2009). 73. Wang, Y. et al. Electrode-free nanopore sensing by DiffusiOptoPhysiology. Science Advances 5, eaar3309 (2019). 74. Krishnan, S. et al. Molecular transport through large-diameter DNA nanopores. Nature Communications 7, 12787 (2016). 75. Wang, Y. et al. Osmosis-Driven Motion-Type Modulation of Biological Nanopores for Parallel Optical Nucleic Acid Sensing. ACS applied materials & interfaces 10, 7788-7797 (2018). 76. Abraham, M. J. et al. GROMACS: High performance molecular simulations through multi-level parallelism from laptops to supercomputers. SoftwareX 1, 19-25 (2015). 77. Huang, J. et al. CHARMM36m: an improved force field for folded and intrinsically disordered proteins. Nature methods 14, 71-73 (2017). 78. Jorgensen, W. L., Chandrasekhar, J., Madura, J. D., Impey, R. W. & Klein, M. L. Comparison of simple potential functions for simulating liquid water. The Journal of chemical physics 79, 926-935 (1983). 79. Jo, S., Kim, T., lyer, V. G. & Im, W. CHARMM-GUI: a web-based graphical user interface for CHARMM. Journal of computational chemistry 29, 1859-1865 (2008). 80. Faller, M., Niederweis, M. & Schulz, G. E. The structure of a mycobacterial outer-membrane channel. Science 303, 1189-1192 (2004). 81. Jovine, L., Djordjevic, S. & Rhodes, D. The crystal structure of yeast phenylalanine tRNA at 2.0 resolution: cleavage by Mg2+ in 15-year old crystals. Journal of molecular biology 301, 401-414 (2000). 82. Hess, B., Bekker, H., Berendsen, H. J. & Fraaije, J. G. LINCS: a linear constraint solver for molecular simulations. Journal of computational chemistry 18, 1463-1472 (1997). 83. Darden, T., York, D. & Pedersen, L. Particle mesh Ewald: An N log (N) method for Ewald sums in large systems. The Journal of chemical physics 98, 10089-10092 (1993). 84. Berendsen, H. J., Postma, J. v., van Gunsteren, W. F., DiNola, A. & Haak, J. R. Molecular dynamics with coupling to an external bath. The Journal of chemical physics 81, 3684-3690 (1984). 85. Tarek, M. Membrane electroporation: a molecular dynamics simulation. Biophysical journal 88, 4045-4053 (2005). 86. Aksimentiev, A. Deciphering ionic current signatures of DNA transport through a nanopore. Nanoscale 2, 468-483 (2010). 87. Bjelkmar, P., Niemel, P. S., Vattulainen, I. & Lindahl, E. Conformational changes and slow dynamics through microsecond polarized atomistic molecular simulation of an integral Kv1. 2 ion channel. PLoS Comput Biol 5, e1000289 (2009). 88. Isralewitz, B., Izrailev, S. & Schulten, K. Binding pathway of retinal to bacterio-opsin: a prediction by molecular dynamics simulations. Biophysical journal 73, 2972 (1997). 89. Wells, D. B., Abramkina, V. & Aksimentiev, A. Exploring transmembrane transport through -hemolysin with grid-steered molecular dynamics. The Journal of chemical physics 127, 09B619 (2007). 90. Aksimentiev, A., Heng, J. B., Timp, G. & Schulten, K. Microscopic kinetics of DNA translocation through synthetic nanopores. Biophysical journal 87, 2086-2097 (2004). 91. DeLano, W. L. Pymol: An open-source molecular graphics tool. CCP4 Newsletter on protein crystallography 40, 82-92 (2002). 92. Boukhet, M. et al. Probing driving forces in aerolysin and -hemolysin biological nanopores: electrophoresis versus electroosmosis. Nanoscale 8, 18352-18359 (2016). 93. Piguet, F. et al. Electroosmosis through -hemolysin that depends on alkali cation type. The journal of physical chemistry letters 5, 4362-4367 (2014). 94. Wimmer, E., Maxwell, I. H. & Tener, G. M. A Simple Method for Isolating Highly Purified Yeast Phenylalanine Transfer Ribonucleic Acid. Biochemistry-Us 7, 2623-2628 (1968). 95. Celander, D. W. & Cech, T. R. Visualizing the higher order folding of a catalytic RNA molecule. Science 251, 401-407 (1991). 96. Cate, J. H., Hanna, R. L. & Doudna, J. A. A magnesium ion core at the heart of a ribozyme domain. Nature structural biology 4, 553-558 (1997). 97. Farnsworth, R. W., Keating, J., McAuley, M. & Smith, R. Optimization of a Protocol for Escherichia coli RNA Extraction and Visualization. Journal of Experimental Microbiology and Immunology 5, 87-94 (2004). 98. Guo, C. et al. Silica nanoparticles induce oxidative stress, inflammation, and endothelial dysfunction in vitro via activation of the MAPK/Nrf2 pathway and nuclear factor-kappa B signaling. International Journal of Nanomedicine 10, 1463-1477 (2015). 99. Di Cello, F., Xie, Y., Paul-Satyaseela, M. & Kim, K. S. Approaches bacterial RNA isolation and purification for microarray analysis of Escherichia coli K1 interaction with human brain microvascular endothelial cells. Journal of Clinical Microbiology 43, 4197-4199 (2005). 100. Summer, H., Gramer, R. & Droge, P. Denaturing urea polyacrylamide gel electrophoresis (Urea PAGE). Journal of visualized experiments, e1485 (2009). 101. Simanshu, D. K., Nissley, D. V. & McCormick, F. RAS Proteins and Their Regulators in Human Disease. Cell 170, 17-33 (2017). 102. Kim, E. et al. A single-molecule dissection of ligand binding to a protein with intrinsic dynamics. Nature Chemical Biology 9, 313-318 (2013). 103. de Boer, M. et al. Conformational and dynamic plasticity in substrate-binding proteins underlies selective transport in ABC importers. eLife 8, e44652 (2019). 104. Boehr, D. D., Nussinov, R. & Wright, P. E. The role of dynamic conformational ensembles in biomolecular recognition. Nature Chemical Biology 5, 789-796 (2009). 105. Papaleo, E. et al. The Role of Protein Loops and Linkers in Conformational Dynamics and Allostery. Chemical Reviews 116, 6391-6423 (2016). 106. Orellana, L. Large-Scale Conformational Changes and Protein Function: Breaking the in silico Barrier. Frontiers in molecular biosciences 6, 117-117 (2019). 107. Park, S. J., Borin, B. N., Martinez-Yamout, M. A. & Dyson, H. J. The client protein p53 adopts a molten globule-like state in the presence of Hsp90. Nature Structural & Molecular Biology 18, 537-541 (2011). 108. Shim, S.-H., Strasfeld, D. B., Ling, Y. L. & Zanni, M. T. Automated 2D IR spectroscopy using a mid-IR pulse shaper and application of this technology to the human islet amyloid polypeptide. Proceedings of the National Academy of Sciences 104, 14197-14202 (2007). 109. Bertini, I. et al. Accurate Solution Structures of Proteins from X-ray Data and a Minimal Set of NMR Data: Calmodulin-Peptide Complexes As Examples. Journal of the American Chemical Society 131, 5134-5144 (2009). 110. Sedlak, S. M., Schendel, L. C., Gaub, H. E. & Bernardi, R. C. Streptavidin/biotin: Tethering geometry defines unbinding mechanics. Science Advances 6, eaay5999 (2020). 111. Krieg, M. et al. Atomic force microscopy-based mechanobiology. Nature Reviews Physics 1, 41-57 (2019). 112. Rivas-Pardo, J. A., Alegre-Cebollada, J., Ramirez-Sarmiento, C. A., Fernandez, J. M. & Guix6, V. Identifying Sequential Substrate Binding at the Single-Molecule Level by Enzyme Mechanical Stabilization. ACS Nano 9, 3996-4005 (2015). 113. Inkpen, M. S. & Albrecht, T. Probing Electron Transport in Proteins at Room Temperature with Single-Molecule Precision. ACS Nano 6, 13-16 (2012). 114. Margittai, M. et al. Single-molecule fluorescence resonance energy transfer reveals a dynamic equilibrium between closed and open conformations of syntaxin 1. Proceedings of the National Academy of Sciences 100, 15516-15521 (2003). 115. Lerner, E. et al. Toward dynamic structural biology: Two decades of single-molecule Frster resonance energy transfer. Science 359, eaan1133 (2018). 116. Yoo, D. et al. Low-Power Optical Trapping of Nanoparticles and Proteins with Resonant Coaxial Nanoaperture Using 10 nm Gap. Nano Letters 18, 3637-3642 (2018). 117. Pang, Y. & Gordon, R. Optical Trapping of a Single Protein. Nano Letters 12, 402-406 (2012). 118. Hong, C., Yang, S. & Ndukaife, J. C. Stand-off trapping and manipulation of sub-10 nm objects and biomolecules using opto-thermo-electrohydrodynamic tweezers. Nature Nanotechnology (2020). 119. Tapia-Rojo, R., Alonso-Caballero, A. & Fernandez, J. M. Direct observation of a coil-to-helix contraction triggered by vinculin binding to talin. Science Advances 6, eaaz4707 (2020). 120. Eckels, E. C., Tapia-Rojo, R., Rivas-Pardo, J. A. & Fernandez, J. M. The Work of Titin Protein Folding as a Major Driver in Muscle Contraction. Annual Review of Physiology 80, 327-351 (2018). 121. Popa, I. et al. A HaloTag Anchored Ruler for Week-Long Studies of Protein Dynamics. Journal of the American Chemical Society 138, 10546-10553 (2016). 122. Frsnzl, M. et al. Thermophoretic trap for single amyloid fibril and protein aggregation studies. Nature Methods 16, 611-614 (2019). 123. Ruggeri, F. et al. Single-molecule electrometry. Nature Nanotechnology 12, 488-495 (2017). 124. Talaga, D. S. & Li, J. Single-Molecule Protein Unfolding in Solid State Nanopores. Journal of the American Chemical Society 131, 9287-9297 (2009). 125. Stefureac, R. I. & Lee, J. S. Nanopore Analysis of the Folding of Zinc Fingers. Small 4, 1646-1650 (2008). 126. Nivala, J., Marks, D. B. & Akeson, M. Unfoldase-mediated protein translocation through an -hemolysin nanopore. Nature Biotechnology 31, 247-250 (2013). 127. Pastoriza-Gallego, M. et al. Dynamics of Unfolded Protein Transport through an Aerolysin Pore. Journal of the American Chemical Society 133, 2923-2931 (2011). 128. Hu, Z.-L., Huo, M.-Z., Ying, Y.-L. & Long, Y.-T. Biological Nanopore Approach for Single-Molecule Protein Sequencing. Angewandte Chemie International Edition n/a. 129. Wang, H.-Y., Ying, Y.-L., Li, Y., Kraatz, H.-B. & Long, Y.-T. Nanopore Analysis of 03-Amyloid Peptide Aggregation Transition Induced by Small Molecules. Analytical Chemistry 83, 1746-1752 (2011). 130. Yusko, E. C. et al. Real-time shape approximation and fingerprinting of single proteins using a nanopore. Nature Nanotechnology 12, 360-367 (2017). 131. Fologea, D., Ledden, B., McNabb, D. S. & Li, J. Electrical characterization of protein molecules by a solid-state nanopore. Applied Physics Letters 91, 053901 (2007). 132. Sha, J. et al. Identification of Spherical and Nonspherical Proteins by a Solid-State Nanopore. Analytical Chemistry 90, 13826-13831 (2018). 133. Houghtaling, J. et al. Estimation of Shape, Volume, and Dipole Moment of Individual Proteins Freely Transiting a Synthetic Nanopore. ACS Nano 13, 5231-5242 (2019). 134. Galenkamp, N. S., Biesemans, A. & Maglia, G. Directional conformer exchange in dihydrofolate reductase revealed by single-molecule nanopore recordings. Nature Chemistry (2020). 135. Hu, R. et al. Differential Enzyme Flexibility Probed Using Solid-State Nanopores. ACS Nano 12, 4494-4502 (2018). 136. Plesa, C. et al. Fast Translocation of Proteins through Solid State Nanopores. Nano Letters 13, 658-663 (2013). 137. Varongchayakul, N., Song, J., Meller, A. & Grinstaff, M. W. Single-molecule protein sensing in a nanopore: a tutorial. Chemical Society Reviews 47, 8512-8524 (2018). 138. Diederichs, T. et al. Synthetic protein-conductive membrane nanopores built with DNA. Nature Communications 10, 5018 (2019). 139. Fragasso, A., Schmid, S. & Dekker, C. Comparing Current Noise in Biological and Solid-State Nanopores. ACS Nano 14, 1338-1349 (2020). 140. Varongchayakul, N., Huttner, D., Grinstaff, M. W. & Meller, A. Sensing Native Protein Solution Structures Using a Solid-state Nanopore: Unraveling the States of VEGF. Scientific Reports 8, 1017 (2018). 141. Han, A. et al. Sensing protein molecules using nanofabricated pores. Applied Physics Letters 88, 093901 (2006). 142. Schmid, S. & Dekker, C. Nanopores: a versatile tool to study protein dynamics. Essays in Biochemistry (2020). 143. Thakur, A. K. & Movileanu, L. Real-time measurement of protein-protein interactions at single-molecule resolution using a biological nanopore. Nature Biotechnology 37, 96-101 (2019). 144. Fahie, M., Chisholm, C. & Chen, M. Resolved Single-Molecule Detection of Individual Species within a Mixture of anti-Biotin Antibodies Using an Engineered Monomeric Nanopore. ACS Nano 9, 1089-1098 (2015). 145. Rotem, D., Jayasinghe, L., Salichou, M. & Bayley, H. Protein Detection by Nanopores Equipped with Aptamers. Journal of the American Chemical Society 134, 2781-2787 (2012). 146. Rodriguez-Larrea, D. & Bayley, H. Multistep protein unfolding during nanopore translocation. Nature Nanotechnology 8, 288-295 (2013). 147. Zhang, S. et al. Bottom-up fabrication of a multi-component nanopore sensor that unfolds, processes and recognizes single proteins. bioRxiv, 2020.12.04.411884 (2020). 148. Wang, S., Haque, F., Rychahou, P. G., Evers, B. M. & Guo, P. Engineered Nanopore of Phi29 DNA-Packaging Motor for Real-Time Detection of Single Colon Cancer Specific Antibody in Serum. ACS Nano 7, 9814-9822 (2013). 149. Peng, W., de Souza Santos, M., Li, Y., Tomchick, D. R. & Orth, K. High-resolution cryo-EM structures of the E. coli hemolysin CIyA oligomers. PLOS ONE 14, e0213423 (2019). 150. Tanaka, K., Caaveiro, J. M. M., Morante, K., Gonzalez-Manas, J. M. & Tsumoto, K. Structural basis for self-assembly of a cytolytic pore lined by protein and lipid. Nature Communications 6, 6337 (2015). 151. Huang, G. et al. Electro-Osmotic Vortices Promote the Capture of Folded Proteins by PlyAB Nanopores. Nano Lett (2020). 152. Huang, G., Willems, K., Soskine, M., Wloka, C. & Maglia, G. Electro-osmotic capture and ionic discrimination of peptide and protein biomarkers with FraC nanopores. Nature Communications 8, 935 (2017). 153. Galenkamp, N. S., Soskine, M., Hermans, J., Wloka, C. & Maglia, G. Direct electrical quantification of glucose and asparagine from bodily fluids using nanopores. Nat Commun 9, 4085 (2018). 154. Zernia, S., van der Heide, N. J., Galenkamp, N. S., Gouridis, G. & Maglia, G. Current Blockades of Proteins inside Nanopores for Real-Time Metabolome Analysis. ACS Nano (2020). 155. Soskine, M., Biesemans, A. & Maglia, G. Single-Molecule Analyte Recognition with CIyA Nanopores Equipped with Internal Protein Adaptors. Journal of the American Chemical Society 137, 5793-5797 (2015). 156. Wloka, C. et al. Label-Free and Real-Time Detection of Protein Ubiquitination with a Biological Nanopore. ACS Nano 11, 4387-4394 (2017). 157. Soskine, M., Biesemans, A., De Maeyer, M. & Maglia, G. Tuning the size and properties of CIyA nanopores assisted by directed evolution. J Am Chem Soc 135, 13456-63 (2013). 158. Lu, B. et al. Protein Motion and Configurations in a Form-Fitting Nanopore: Avidin in CIyA. Biophysical Journal 115, 801-808 (2018). 159. Faller, M., Niederweis, M. & Schulz, G. E. The Structure of a Mycobacterial Outer-Membrane Channel. Science 303, 1189 (2004). 160. Heinz, C., Engelhardt, H. & Niederweis, M. The Core of the Tetrameric Mycobacterial Porin MspA Is an Extremely Stable -Sheet Domain. Journal of Biological Chemistry 278, 8678-8685 (2003). 161. Manrao, E. A. et al. Reading DNA at single-nucleotide resolution with a mutant MspA nanopore and phi29 DNA polymerase. Nat Biotechnol 30, 349-53 (2012). 162. Craig, J. M. et al. Revealing dynamics of helicase translocation on single-stranded DNA using high-resolution nanopore tweezers. Proceedings of the National Academy of Sciences 114, 11932 (2017). 163. Wang, S. et al. Single molecule observation of hard-soft-acid-base (HSAB) interaction in engineered Mycobacterium smegmatis porin A (MspA) nanopores. Chemical Science 11, 879-887 (2020). 164. Cao, J. et al. Giant single molecule chemistry events observed from a tetrachloroaurate(III) embedded Mycobacterium smegmatis porin A nanopore. Nature Communications 10, 5668 (2019). 165. Zhang, M., Tanaka, T. & Ikura, M. Calcium-induced conformational transition revealed by the solution structure of apo calmodulin. Nature Structural Biology 2, 758-767 (1995). 166. Kursula, P. The many structural faces of calmodulin: a multitasking molecular jackknife. Amino Acids 46, 2295-304 (2014). 167. Waduge, P. et al. Nanopore-Based Measurements of Protein Size, Fluctuations, and Conformational Changes. ACS Nano 11, 5706-5716 (2017). 168. Ma, G. et al. Optical imaging of single-protein size, charge, mobility, and binding. Nature Communications 11, 4768 (2020). 169. Ikura, M. et al. Solution structure of a calmodulin-target peptide complex by multidimensional NMR. Science 256, 632-638 (1992). 170. Oukhaled, A., Bacri, L., Pastoriza-Gallego, M., Betton, J.-M. & Pelta, J. Sensing Proteins through Nanopores: Fundamental to Applications. ACS Chemical Biology 7, 1935-1949 (2012). 171. Crotti, L. et al. Calmodulin mutations and life-threatening cardiac arrhythmias: insights from the International Calmodulinopathy Registry. European heart journal 40, 2964-2975 (2019). 172. Pipilas, D. C. et al. Novel calmodulin mutations associated with congenital long QT syndrome affect calcium current in human cardiomyocytes. Heart Rhythm 13, 2012-2019 (2016). 173. Wren, L. M. et al. Genetic Mosaicism in Calmodulinopathy. Circulation: Genomic and Precision Medicine 12, e002581 (2019). 174. Wang, K. et al. Arrhythmia mutations in calmodulin can disrupt cooperativity of Ca.sup.2+ binding and cause misfolding. The Journal of Physiology 598, 1169-1186 (2020). 175. Ouyang, H. & Vogel, H. J. Metal ion binding to calmodulin: NMR and fluorescence studies. Biometals 11, 213-222 (1998). 176. Habermann, E., Crowell, K. & Janicki, P. Lead and Other Metals can Substitute for Ca 2+ in Caimodulin. Archives of Toxicology 54, 61 (1983). 177. Hemmils, I. & Laitala, V. Progress in Lanthanides as Luminescent Probes. Journal of Fluorescence 15, 529-542 (2005). 178. Martin, B. & Richardson, F. S. Lanthanides as probes for calcium in biological systems. Quarterly Reviews of Biophysics 12, 181-209 (1979). 179. Brittain, H. G., Richardson, F. S. & Martin, R. B. Terbium(III) emission as a probe of calcium(II) binding sites in proteins. Journal of the American Chemical Society 98, 8255-8260 (1976). 180. Wallace, R. W., Tallant, E. A., Dockter, M. E. & Cheung, W. Y. Calcium binding domains of calmodulin. Sequence of fill as determined with terbium luminescence. Journal of Biological Chemistry 257, 1845-1854 (1982). 181. Edington, S. C. et al. Coordination to lanthanide ions distorts binding site conformation in calmodulin. Proceedings of the National Academy of Sciences 115, E3126 (2018). 182. Butler, T. Z., Pavlenok, M., Derrington, I. M., Niederweis, M. & Gundlach, J. H. Single-molecule DNA detection with an engineered MspA protein nanopore. Proceedings of the National Academy of Sciences 105, 20647-20652 (2008). 183. Yan, S. et al. Direct sequencing of 2-deoxy-2-fluoroarabinonucleic acid (FANA) using nanopore-induced phase-shift sequencing (NIPSS). Chemical Science 10, 3110-3117 (2019). 184. Wang, Y. et al. Electrode-free nanopore sensing by DiffusiOptoPhysiology. Science Advances 5, eaar3309 (2019). 185. Wang, Y. et al. Osmosis-Driven Motion-Type Modulation of Biological Nanopores for Parallel Optical Nucleic Acid Sensing. ACS Applied Materials & Interfaces 10, 7788-7797 (2018). 186. Torchala, M., Moal, I. H., Chaleil, R. A. G., Fernandez-Recio, J. & Bates, P. A. SwarmDock: a server for flexible protein-protein docking. Bioinformatics 29, 807-809 (2013). 187. Torchala, M. & Bates, P. A. Predicting the Structure of Protein-Protein Complexes Using the SwarmDock Web Server. in Protein Structure Prediction (ed. Kihara, D.) 181-197 (Springer New York, New York, NY, 2014). 188. Jo, S., Kim, T., Iyer, V. G. & Im, W. CHARMM-GUI: A web-based graphical user interface for CHARMM. Journal of Computational Chemistry 29, 1859-1865 (2008). 189. Oukhaled, A., Bacri, L., Pastoriza-Gallego, M., Betton, J.-M. & Pelta, J. Sensing Proteins through Nanopores: Fundamental to Applications. ACS Chemical Biology 7, 1935-1949 (2012). 190. Zhang, M., Tanaka, T. & Ikura, M. Calcium-induced conformational transition revealed by the solution structure of apo calmodulin. Nature Structural Biology 2, 758-767 (1995). 191. Ikura, M. et al. Solution structure of a calmodulin-target peptide complex by multidimensional NMR. Science 256, 632-638 (1992). 192. Soskine, M., Biesemans, A., De Maeyer, M. & Maglia, G. Tuning the size and properties of ClyA nanopores assisted by directed evolution. Journal of the American Chemical Society 135, 13456-63 (2013). 193. Wang, W.-Q.; Jensen, O. N.; Mller, I. M.; Hebelstrup, K. H.; Rogowska-Wrzesinska, A., Evaluation of sample preparation methods for mass spectrometry-based proteomic analysis of barley leaves. Plant Methods 2018, 14 (1), 72. 194. Timp, W.; Timp, G., Beyond mass spectrometry, the next step in proteomics. Sci. Adv. 2020, 6 (2), eaax8978. 195. Nakayasu, E. S.; Gritsenko, M.; Piehowski, P. D.; Gao, Y.; Orton, D. J.; Schepmoes, A. A.; Fillmore, T. L.; Frohnert, B. I.; Rewers, M.; Krischer, J. P.; Ansong, C.; Suchy-Dicey, A. M.; Evans-Molina, C.; Qian, W.-J.; Webb-Robertson, B.-J. M.; Metz, T. O., Tutorial: best practices and considerations for mass-spectrometry-based protein biomarker discovery and validation. Nat. Protoc. 2021, 16 (8), 3737-3760. 196. Hnasko, R.; Lin, A.; McGarvey, J. A.; Stanker, L. H., A rapid method to improve protein detection by indirect ELISA. Biochem. Biophys. Res. Commun. 2011, 410 (4), 726-731. 197. de Lannoy, C. V.; Filius, M.; van Wee, R.; Joo, C.; de Ridder, D., Evaluation of FRET X for single-molecule protein fingerprinting. iScience 2021, 24 (11), 103239. 198. Tripathi, P.; Benabbas, A.; Mehrafrooz, B.; Yamazaki, H.; Aksimentiev, A.; Champion, P. M.; Wanunu, M., Electrical unfolding of cytochrome c during translocation through a nanopore constriction. Proc. Natl. Acad. Sci. U.S.A. 2021, 118 (17), e2016262118. 199. Mitscha-Baude, G.; Stadlbauer, B.; Howorka, S.; Heitzinger, C., Protein Transport through Nanopores Illuminated by Long-Time-Scale Simulations. ACS Nano 2021, 15 (6), 9900-9912. 200. Gu, L.-Q.; Shim, J. W., Single molecule sensing by nanopores and nanopore devices. Analyst 2010, 135 (3), 441-451. 201. Alfaro, J. A.; Bohlsnder, P.; Dai, M.; Filius, M.; Howard, C. J.; van Kooten, X. F.; Ohayon, S.; Pomorski, A.; Schmid, S.; Aksimentiev, A.; Anslyn, E. V.; Bedran, G.; Cao, C.; Chinappi, M.; Coyaud, E.; Dekker, C.; Dittmar, G.; Drachman, N.; Eelkema, R.; Goodlett, D.; Hentz, S.; Kalathiya, U.; Kelleher, N. L.; Kelly, R. T.; Kelman, Z.; Kim, S. H.; Kuster, B.; Rodriguez-Larrea, D.; Lindsay, S.; Maglia, G.; Marcotte, E. M.; Marino, J. P.; Masselon, C.; Mayer, M.; Samaras, P.; Sarthak, K.; Sepiashvili, L.; Stein, D.; Wanunu, M.; Wilhelm, M.; Yin, P.; Meller, A.; Joo, C., The emerging landscape of single-molecule protein sequencing technologies. Nat. Methods 2021, 18 (6), 604-617. 202. Cao, C.; Cirauqui, N.; Marcaida, M. J.; Buglakova, E.; Duperrex, A.; Radenovic, A.; Dal Peraro, M., Single-molecule sensing of peptides and nucleic acids by engineered aerolysin nanopores. Nat. Commun. 2019, 10 (1), 4918-4918. 203. Quick, J.; Loman, N. J.; Duraffour, S.; Simpson, J. T.; Severi, E.; Cowley, L.; Bore, J. A.; Koundouno, R.; Dudas, G.; Mikhail, A.; Oudraogo, N.; Afrough, B.; Bah, A.; Baum, J. H. J.; Becker-Ziaja, B.; Boettcher, J. P.; Cabeza-Cabrerizo, M.; Camino-Sanchez, A.; Carter, L. L.; Doerrbecker, J.; Enkirch, T.; Dorival, I. G.; Hetzelt, N.; Hinzmann, J.; Holm, T.; Kafetzopoulou, L. E.; Koropogui, M.; Kosgey, A.; Kuisma, E.; Logue, C. H.; Mazzarelli, A.; Meisel, S.; Mertens, M.; Michel, J.; Ngabo, D.; Nitzsche, K.; Pallasch, E.; Patrono, L. V.; Portmann, J.; Repits, J. G.; Rickett, N. Y.; Sachse, A.; Singethan, K.; Vitoriano, I.; Yemanaberhan, R. L.; Zekeng, E. G.; Racine, T.; Bello, A.; Sall, A. A.; Faye, O.; Faye, O.; Magassouba, N. F.; Williams, C. V.; Amburgey, V.; Winona, L.; Davis, E.; Gerlach, J.; Washington, F.; Monteil, V.; Jourdain, M.; Bererd, M.; Camara, A.; Somlare, H.; Camara, A.; Gerard, M.; Bado, G.; Baillet, B.; Delaune, D.; Nebie, K. Y.; Diarra, A.; Savane, Y.; Pallawo, R. B.; Gutierrez, G. J.; Milhano, N.; Roger, I.; Williams, C. J.; Yattara, F.; Lewandowski, K.; Taylor, J.; Rachwal, P.; J. Turner, D.; Pollakis, G.; Hiscox, J. A.; Matthews, D. A.; Shea, M. K. O.; Johnston, A. M.; Wilson, D.; Hutley, E.; Smit, E.; Di Caro, A.; Wlfel, R.; Stoecker, K.; Fleischmann, E.; Gabriel, M.; Weller, S. A.; Koivogui, L.; Diallo, B.; Keita, S.; Rambaut, A.; Formenty, P.; Gunther, S.; Carroll, M. W., Real-time, portable genome sequencing for Ebola surveillance. Nature 2016, 530 (7589), 228-232. 204. Plesa, C.; Kowalczyk, S. W.; Zinsmeester, R.; Grosberg, A. Y.; Rabin, Y.; Dekker, C., Fast Translocation of Proteins through Solid State Nanopores. Nano Lett. 2013, 13 (2), 658-663. 205. Cardozo, N.; Zhang, K.; Doroschak, K.; Nguyen, A.; Siddiqui, Z.; Bogard, N.; Strauss, K.; Ceze, L.; Nivala, J., Multiplexed direct detection of barcoded protein reporters on a nanopore array. Nat. Biotechnol. 2021, DOI: 10.1038/s41587-021-01002-6. 206. Palla, M.; Punthambaker, S.; Stranges, B.; Vigneault, F.; Nivala, J.; Wiegand, D.; Ayer, A.; Craig, T.; Gremyachinskiy, D.; Franklin, H.; Sun, S.; Pollard, J.; Trans, A.; Arnold, C.; Schwab, C.; McGaw, C.; Sarvabhowman, P.; Dalal, D.; Thai, E.; Amato, E.; Lederman, I.; Taing, M.; Kelley, S.; Qwan, A.; Fuller, C. W.; Roever, S.; Church, G. M., Multiplex Single-Molecule Kinetics of Nanopore-Coupled Polymerases. ACS Nano 2021, 15 (1), 489-502. 207. Nivala, J.; Mulroney, L.; Li, G.; Schreiber, J.; Akeson, M., Discrimination among Protein Variants Using an Unfoldase-Coupled Nanopore. ACS Nano 2014, 8 (12), 12365-12375. 208. Bell, N. A. W.; Keyser, U. F., Digitally encoded DNA nanostructures for multiplexed, single-molecule protein sensing with nanopores. Nat. Nanotechnol. 2016, 11 (7), 645-651. 209. Huang, G.; Willems, K.; Soskine, M.; Wloka, C.; Maglia, G., Electro-osmotic capture and ionic discrimination of peptide and protein biomarkers with FraC nanopores. Nat. Commun. 2017, 8 (1), 935. 210. Schmid, S.; Dekker, C., Nanopores: a versatile tool to study protein dynamics. Essays Biochem. 2021, 65 (1), 93-107. 211. Boukhet, M.; Piguet, F.; Ouldali, H.; Pastoriza-Gallego, M.; Pelta, J.; Oukhaled, A., Probing driving forces in aerolysin and alpha-hemolysin biological nanopores: electrophoresis versus electroosmosis. Nanoscale 2016, 8 (43), 18352-18359. 212. Bhamidimarri, S. P.; Prajapati, J. D.; van den Berg, B.; Winterhalter, M.; Kleinekathfer, U., Role of Electroosmosis in the Permeation of Neutral Molecules: CymA and Cyclodextrin as an Example. Biophys. J. 2016, 110 (3), 600-611. 213. Huang, G.; Willems, K.; Bartelds, M.; van Dorpe, P.; Soskine, M.; Maglia, G., Electro-Osmotic Vortices Promote the Capture of Folded Proteins by PlyAB Nanopores. Nano Lett. 2020, 20 (5), 3819-3827. 214. Soskine, M.; Biesemans, A.; Maglia, G., Single-Molecule Analyte Recognition with CIyA Nanopores Equipped with Internal Protein Adaptors. J. Am. Chem. Soc. 2015, 137 (17), 5793-5797. 215. Li, X.; Lee, K. H.; Shorkey, S.; Chen, J.; Chen, M., Different Anomeric Sugar Bound States of MBP Resolved by a Cytolysin A Nanopore Tweezer. ACS Nano 2020, 14 (2), 1727-1737. 216. Van Meervelt, V.; Soskine, M.; Maglia, G., Detection of Two Isomeric Binding Configurations in a Protein-Aptamer Complex with a Biological Nanopore. ACS Nano 2014, 8 (12), 12826-12835. 217. Galenkamp, N. S.; Biesemans, A.; Maglia, G., Directional conformer exchange in dihydrofolate reductase revealed by single-molecule nanopore recordings. Nat. Chem. 2020, 12 (5), 481-488. 218. Galenkamp, N. S.; Soskine, M.; Hermans, J.; Wloka, C.; Maglia, G., Direct electrical quantification of glucose and asparagine from bodily fluids using nanopores. Nat. Commun. 2018, 9 (1), 4085. 219. Zernia, S.; van der Heide, N. J.; Galenkamp, N. S.; Gouridis, G.; Maglia, G., Current Blockades of Proteins inside Nanopores for Real-Time Metabolome Analysis. ACS Nano 2020, 14 (2), 2296-2307. 220. Restrepo-Prez, L.; Wong, C. H.; Maglia, G.; Dekker, C.; Joo, C., Label-Free Detection of Post-translational Modifications with a Nanopore. Nano Lett. 2019, 19 (11), 7957-7964. 221. Lucas, F. L. R.; Piso, T. R. C.; van der Heide, N. J.; Galenkamp, N. S.; Hermans, J.; Wloka, C.; Maglia, G., Automated Electrical Quantification of Vitamin B1 in a Bodily Fluid using an Engineered Nanopore-Sensor. Angew. Chem. Int. Ed. 2021, 60 (42), 22849-22855. 222. Fragasso, A.; Schmid, S.; Dekker, C., Comparing Current Noise in Biological and Solid-State Nanopores. ACS Nano 2020, 14 (2), 1338-1349. 223. Soskine, M.; Biesemans, A.; De Maeyer, M.; Maglia, G., Tuning the size and properties of CIyA nanopores assisted by directed evolution. J. Am. Chem. Soc. 2013, 135 (36), 13456-13463. 224. Liu, Y.; Pan, T.; Wang, K.; Wang, Y.; Yan, S.; Wang, L.; Zhang, S.; Du, X.; Jia, W.; Zhang, P.; Chen, H.-Y.; Huang, S., Allosteric Switching of Calmodulin in a Mycobacterium smegmatis porin A (MspA) Nanopore-Trap. Angew. Chem. Int. Ed. 2021, 60 (44), 23863-23870. 225. Shorkey, S. A.; Du, J.; Pham, R.; Strieter, E. R.; Chen, M., Real-Time and Label-Free Measurement of Deubiquitinase Activity with a MspA Nanopore. ChemBioChem 2021, 22 (17), 2688-2692. 226. Wang, S.; Wang, Y.; Yan, S.; Du, X.; Zhang, P.; Chen, H.-Y.; Huang, S., Retarded Translocation of Nucleic Acids through -Hemolysin Nanopore in the Presence of a Calcium Flux. ACS Appl. Mater. Interfaces 2020, 12 (24), 26926-26935. 227. Wang, Y.; Guan, X.; Zhang, S.; Liu, Y.; Wang, S.; Fan, P.; Du, X.; Yan, S.; Zhang, P.; Chen, H.-Y.; Li, W.; Zhang, D.; Huang, S., Structural-profiling of low molecular weight RNAs by nanopore trapping/translocation using Mycobacterium smegmatis porin A. Nat. Commun. 2021, 12 (1), 3368. 228. Postnikova, G. B.; Tselikova, S. V.; Shekhovtsova, E. A., Myoglobin and mitochondria: Oxymyoglobin interacts with mitochondrial membrane during deoxygenation. Biochemistry (Moscow) 2009, 74 (11), 1211. 229. Fologea, D.; Krueger, E.; Al Faori, R.; Lee, R.; Mazur, Y. I.; Henry, R.; Arnold, M.; Salamo, G. J., Multivalent ions control the transport through lysenin channels. Biophys. Chem. 2010, 152 (1), 40-45. 230. He, Y.; Gillespie, D.; Boda, D.; Vlassiouk, I.; Eisenberg, R. S.; Siwy, Z. S., Tuning Transport Properties of Nanofluidic Devices with Local Charge Inversion. J. Am. Chem. Soc. 2009, 131 (14), 5194-5202. 231. Ramirez, P.; Manzanares, J. A.; Cervera, J.; Gomez, V.; Ali, M.; Pause, I.; Ensinger, W.; Mafe, S., Nanopore charge inversion and current-voltage curves in mixtures of asymmetric electrolytes. J. Membr. Sci. 2018, 563, 633-642. 232. Alcaraz, A.; Nestorovich, E. M.; Lpez, M. L.; Garci-Gimnez, E.; Bezrukov, S. M.; Aguilella, V. M., Diffusion, Exclusion, and Specific Binding in a Large Channel: A Study of OmpF Selectivity Inversion. Biophys. J. 2009, 96 (1), 56-66. 233. Piguet, F.; Discala, F.; Breton, M.-F.; Pelta, J.; Bacri, L.; Oukhaled, A., Electroosmosis through -Hemolysin That Depends on Alkali Cation Type. J. Phys. Chem. Lett. 2014, 5 (24), 4362-4367. 234. Gu, L.-Q.; Cheley, S.; Bayley, H., Electroosmotic enhancement of the binding of a neutral molecule to a transmembrane pore. Proc. Natl. Acad. Sci. U.S.A. 2003, 100 (26), 15498-15503. 235. Chinappi, M.; Yamaji, M.; Kawano, R.; Cecconi, F., Analytical Model for Particle Capture in Nanopores Elucidates Competition among Electrophoresis, Electroosmosis, and Dielectrophoresis. ACS Nano 2020, 14 (11), 15816-15828. 236. Sekhon, N.; Peacock, W. F., Chapter 11Biomarkers to Assist in the Evaluation of Chest Pain: A Practical Guide. In Biomarkers in Cardiovascular Disease, Nambi, V., Ed. Elsevier: 2019; pp 115-128. 237. Chung, M. J.; Brown, D. L., 9Diagnosis of Acute Myocardial Infarction. In Cardiac Intensive Care (Third Edition), Brown, D. L., Ed. Elsevier: Philadelphia, 2019; pp 91-98.e3. 238. Cammarata, M. B.; Brodbelt, J. S., Structural characterization of holo- and apo-myoglobin in the gas phase by ultraviolet photodissociation mass spectrometry. Chem. Sci. 2015, 6 (2), 1324-1333. 239. Lin, L.; Pinker, R. J.; Forde, K.; Rose, G. D.; Kallenbach, N. R., Molten globular characteristics of the native state of apomyoglobin. Nat. Struct. Biol. 1994, 1 (7), 447-452. 240. Sankaranarayanan, K., Studies on pH-Controlled Transition of Myoglobin Capsules from Hollow to Multilayered Structures. Adsorpt. Sci. Technol. 2015, 33 (9), 759-768. 241. Ganguly, D.; Zhang, W.; Chen, J., Synergistic folding of two intrinsically disordered proteins: searching for conformational selection. Mol. Biosyst. 2012, 8 (1), 198-209. 242. Misiunas, K.; Ermann, N.; Keyser, U. F., QuipuNet: Convolutional Neural Network for Single-Molecule Nanopore Sensing. Nano Lett. 2018, 18 (6), 4040-4045. 243. Henley, R. Y.; Ashcroft, B. A.; Farrell, I.; Cooperman, B. S.; Lindsay, S. M.; Wanunu, M., Electrophoretic Deformation of Individual Transfer RNA Molecules Reveals Their Identity. Nano Lett. 2016, 16 (1), 138-144. 244. Barati Farimani, A.; Heiranian, M.; Aluru, N. R., Identification of amino acids with sensitive nanoporous MoS2: towards machine learning-based prediction. NPJ 2D Mater. Appl. 2018, 2 (1), 14. 245. Ohayon, S.; Girsault, A.; Nasser, M.; Shen-Orr, S.; Meller, A., Simulation of single-protein nanopore sensing shows feasibility for whole-proteome identification. PLoS Comput. Biol. 2019, 15 (5), e1007067. 246. Kolmogorov, M.; Kennedy, E.; Dong, Z.; Timp, G.; Pevzner, P. A., Single-molecule protein identification by sub-nanopore sensors. PLoS Comput. Biol. 2017, 13 (5), e1005356. 247. Goulding, D. A.; Fox, P. F.; O'Mahony, J. A., Chapter 2Milk proteins: An overview. In Milk Proteins (Third Edition), Boland, M.; Singh, H., Eds. Academic Press: 2020; pp 21-98. 248. Willems, K.; Ruic, D.; Biesemans, A.; Galenkamp, N. S.; Van Dorpe, P.; Maglia, G., Engineering and Modeling the Electrophoretic Trapping of a Single Protein Inside a Nanopore. ACS Nano 2019, 13 (9), 9980-9992 249. Wang, Y.; Yan, S.; Zhang, P.; Zeng, Z.; Zhao, D.; Wang, J.; Chen, H.; Huang, S., Osmosis-Driven Motion-Type Modulation of Biological Nanopores for Parallel Optical Nucleic Acid Sensing. ACS Appl. Mater. Interfaces 2018, 10 (9), 7788-7797. 250. Yan, S.; Li, X.; Zhang, P.; Wang, Y.; Chen, H. Y.; Huang, S.; Yu, H., Direct sequencing of 2-deoxy-2-fluoroarabinonucleic acid (FANA) using nanopore-induced phase-shift sequencing (NIPSS). Chem. Sci. 2019, 10 (10), 3110-3117.