Nanowire catalysts and methods for their use and preparation
11078132 · 2021-08-03
Assignee
Inventors
- Fabio R. Zurcher (Brisbane, CA, US)
- Erik C. Scher (San Francisco, CA, US)
- Joel M. Cizeron (Redwood City, CA, US)
- Wayne P. Schammel (Brisbane, CA, US)
- Alex Tkachenko (San Francisco, CA, US)
- Joel Gamoras (Vallejo, CA, US)
- Dmitry Karshtedt (San Francisco, CA, US)
- Greg Nyce (Pleasanton, CA, US)
- Anja Rumplecker (San Francisco, CA, US)
- Jarod McCormick (San Carlos, CA)
- Anna Merzlyak (San Francisco, CA, US)
- Marian Alcid (Sunnyvale, CA, US)
- Daniel Rosenberg (San Francisco, CA, US)
- Erik-Jan Ras (Amsterdam, NL)
Cpc classification
C01P2004/16
CHEMISTRY; METALLURGY
C01G45/1221
CHEMISTRY; METALLURGY
B01J21/066
PERFORMING OPERATIONS; TRANSPORTING
B01J37/10
PERFORMING OPERATIONS; TRANSPORTING
Y10S977/762
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C01F17/241
CHEMISTRY; METALLURGY
C01P2004/80
CHEMISTRY; METALLURGY
Y02P20/52
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C07C2523/02
CHEMISTRY; METALLURGY
B01J21/10
PERFORMING OPERATIONS; TRANSPORTING
B82Y30/00
PERFORMING OPERATIONS; TRANSPORTING
B01J23/02
PERFORMING OPERATIONS; TRANSPORTING
C01P2002/72
CHEMISTRY; METALLURGY
C01P2004/54
CHEMISTRY; METALLURGY
B01J37/0018
PERFORMING OPERATIONS; TRANSPORTING
International classification
B01J21/10
PERFORMING OPERATIONS; TRANSPORTING
B01J21/06
PERFORMING OPERATIONS; TRANSPORTING
B01J37/10
PERFORMING OPERATIONS; TRANSPORTING
B01J37/03
PERFORMING OPERATIONS; TRANSPORTING
B82Y30/00
PERFORMING OPERATIONS; TRANSPORTING
B01J23/02
PERFORMING OPERATIONS; TRANSPORTING
C01G45/12
CHEMISTRY; METALLURGY
B01J35/00
PERFORMING OPERATIONS; TRANSPORTING
B01J37/00
PERFORMING OPERATIONS; TRANSPORTING
Abstract
Nanowires useful as heterogeneous catalysts are provided. The nanowire catalysts are useful in a variety of catalytic reactions, for example, the oxidative coupling of methane to C2 hydrocarbons. Related methods for use and manufacture of the same are also disclosed.
Claims
1. A method for the preparation of ethane, ethylene or combinations thereof, the method comprising contacting a catalytic material with a gas comprising methane, wherein the catalytic material comprises a plurality of catalytic nanowires and a diluent or support, the diluent or support comprising an alkaline earth metal compound, wherein the catalytic material is in the form of a pressed pellet, extrudate or monolith, and wherein the catalytic material has a C2+ yield above 5% when employed as catalytic material in the oxidative coupling of methane at an inlet temperature of 550° C. and an inlet pressure of about 2 atm in a fixed bed reactor with a gas-hour space velocity (GHSV) of at least about 20,000/hr.
2. The method of claim 1, wherein the catalytic material is in the form of a pressed pellet.
3. The method of claim 1, wherein the catalytic material is in the form of an extrudate.
4. The method of claim 1, wherein the catalytic material is in the form of a monolith.
5. The method of claim 1, wherein the catalytic nanowires comprise one or more doping elements.
6. The method of claim 1, wherein the catalytic material is in the form of a pressure treated, pressed pellet and comprises substantially no binder material.
7. The method of claim 1, wherein the catalytic material is in the form of a pressed pellet or extrudate and comprises pores greater than 20 nm in diameter.
8. The method of claim 1, wherein the alkaline earth metal compound is an alkaline earth metal oxide, alkaline earth metal carbonate, alkaline earth metal sulfate or alkaline earth metal phosphate.
9. The method of claim 1, wherein the alkaline earth metal compound is an alkaline earth metal carbonate, alkaline earth metal sulfate or alkaline earth metal phosphate.
10. The method of claim 1, wherein the diluent or support comprises MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgAl.sub.2O.sub.4, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 or combinations thereof.
11. The method of claim 1, wherein the diluent or support comprises MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 or combinations thereof.
12. The method of claim 1, wherein the diluent or support comprises CaO, SrO, MgCO.sub.3, CaCO.sub.3, SrCO.sub.3 or combinations thereof.
13. The method of claim 1, wherein the plurality of catalytic nanowires has a ratio of average effective length to average actual length of less than one and an average aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV, wherein the plurality of catalytic nanowires comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
14. The method of claim 1, wherein the plurality of catalytic nanowires comprises substantially straight nanowires.
15. The method of claim 1, wherein the plurality of catalytic nanowires comprises at least one nanowire selected from any one of Tables 1-12.
16. The method of claim 1, wherein the catalytic material has a C2 selectivity above 50% when employed as catalytic material in the oxidative coupling of methane at an inlet temperature of 550° C. and an inlet pressure of about 2 atm in a fixed bed reactor with a gas-hour space velocity (GHSV) of at least about 20,000/hr.
17. The method of claim 1, wherein the catalytic material has a CH.sub.4 conversion above 20% when employed as catalytic material in the oxidative coupling of methane at an inlet temperature of 550° C. and an inlet pressure of about 2 atm in a fixed bed reactor with a gas-hour space velocity (GHSV) of at least about 20,000/hr.
18. The method of claim 1, wherein the catalytic material further comprises SiC or cordierite or combinations thereof.
19. The method of claim 1, wherein the catalytic material is contacted with the gas at a temperature less than 800° C.
20. The method of claim 1, wherein the catalytic material is contacted with the gas at a temperature less than 700° C.
21. The method of claim 1, having a conversion of methane to ethylene of greater than 10%.
22. The method of claim 1, having a yield of ethylene of greater than 10%.
23. The method of claim 1, having a conversion of methane of greater than 10%.
24. The method of claim 1, having a C2 yield of greater than 10%.
25. A method for the preparation of ethane, ethylene or combinations thereof, the method comprising contacting a catalytic material with a gas comprising methane, wherein the catalytic material comprises a plurality of catalytic nanowires and a diluent or support, the diluent or support comprising an alkaline earth metal compound, and wherein the catalytic material is in the form of a pressure treated, pressed pellet and comprises substantially no binder material.
26. The method of claim 25, wherein the catalytic nanowires comprise one or more doping elements.
27. The method of claim 25, wherein the catalytic material comprises pores greater than 20 nm in diameter.
28. The method of claim 25, wherein the alkaline earth metal compound is an alkaline earth metal oxide, alkaline earth metal carbonate, alkaline earth metal sulfate or alkaline earth metal phosphate.
29. The method of claim 25, wherein the diluent or support comprises MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgAl.sub.2O.sub.4, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 or combinations thereof.
30. The method of claim 25, wherein the catalytic nanowires are impregnated on the diluent or support.
31. The method of claim 25, wherein a weight percentage of the diluent or support in the catalytic material is between 0.01% and 99.9%.
32. The method of claim 25, wherein the catalytic material has a C2 selectivity of greater than 50% and a methane conversion of greater than 20% when employed as catalytic material in the oxidative coupling of methane at a temperature of 750° C. or less.
33. A method for the preparation of ethane, ethylene or combinations thereof, the method comprising contacting a catalytic material with a gas comprising methane, wherein the catalytic material comprises a plurality of catalytic nanowires and a diluent or support, the diluent or support comprising an alkaline earth metal compound, wherein the catalytic material is in the form of a pressed pellet, extrudate or monolith, and wherein the catalytic material has a C2 selectivity above 50% when employed as catalytic material in the oxidative coupling of methane at an inlet temperature of 550° C. and an inlet pressure of about 2 atm in a fixed bed reactor with a gas-hour space velocity (GHSV) of at least about 20,000/hr.
34. The method of claim 33, wherein the catalytic nanowires are polycrystalline nanowires.
35. The method of claim 33, wherein the plurality of catalytic nanowires comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
36. The method of claim 33, wherein the plurality of catalytic nanowires has a ratio of average effective length to average actual length of less than one and an average aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV.
37. The method of claim 33, wherein the catalytic nanowires comprise one or more doping elements.
38. The method of claim 33, wherein the catalytic material is in the form of a pressed pellet or extrudate and comprises pores greater than 20 nm in diameter.
39. The method of claim 33, wherein the alkaline earth metal compound is an alkaline earth metal oxide, alkaline earth metal carbonate, alkaline earth metal sulfate or alkaline earth metal phosphate.
40. The method of claim 33, wherein the diluent or support comprises MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgAl.sub.2O.sub.4, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 or combinations thereof.
41. The method of claim 33, wherein the catalytic material has a C2 selectivity of greater than 50% and a methane conversion of greater than 20% when employed as catalytic material in the oxidative coupling of methane at a temperature of 750° C. or less.
42. A method for the preparation of ethane, ethylene or combinations thereof, the method comprising contacting a catalytic material with a gas comprising methane, wherein the catalytic material comprises a plurality of catalytic nanowires and a diluent or support, the diluent or support comprising an alkaline earth metal compound, wherein the catalytic material is in the form of a pressed pellet, extrudate or monolith, and wherein the catalytic material has a CH.sub.4 conversion above 20% when employed as catalytic material in the oxidative coupling of methane at an inlet temperature of 550° C. and an inlet pressure of about 2 atm in a fixed bed reactor with a gas-hour space velocity (GHSV) of at least about 20,000/hr.
43. The method of claim 42, wherein the catalytic nanowires are polycrystalline nanowires.
44. The method of claim 42, wherein the plurality of catalytic nanowires comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
45. The method of claim 42, wherein the plurality of catalytic nanowires has a ratio of average effective length to average actual length of less than one and an average aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV.
46. The method of claim 42, wherein the catalytic nanowires comprise one or more doping elements.
47. The method of claim 42, wherein the catalytic material is in the form of a pressed pellet or extrudate and comprises pores greater than 20 nm in diameter.
48. The method of claim 42, wherein the alkaline earth metal compound is an alkaline earth metal oxide, alkaline earth metal carbonate, alkaline earth metal sulfate or alkaline earth metal phosphate.
49. The method of claim 42, wherein the diluent or support comprises MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgAl.sub.2O.sub.4, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 or combinations thereof.
50. The method of claim 42, wherein the catalytic material has a C2 selectivity of greater than 50% and a methane conversion of greater than 20% when employed as catalytic material in the oxidative coupling of methane at a temperature of 750° C. or less.
51. A method for the preparation of ethane, ethylene or combinations thereof, the method comprising contacting a catalytic material with a gas comprising methane, wherein the catalytic material comprises a plurality of catalytic nanowires and a diluent or support, the diluent or support comprising an alkaline earth metal compound, wherein the catalytic material further comprises SiC or cordierite or combinations thereof, and wherein the catalytic material is in the form of a pressed pellet, extrudate or monolith.
52. The method of claim 51, wherein the catalytic nanowires comprise one or more doping elements.
53. The method of claim 51, wherein the catalytic material is in the form of a pressure treated, pressed pellet and comprises substantially no binder material.
54. The method of claim 51, wherein the catalytic material is in the form of a pressed pellet or extrudate and comprises pores greater than 20 nm in diameter.
55. The method of claim 51, wherein the alkaline earth metal compound is an alkaline earth metal oxide, alkaline earth metal carbonate, alkaline earth metal sulfate or alkaline earth metal phosphate.
56. The method of claim 51, wherein the diluent or support comprises MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgAl.sub.2O.sub.4, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 or combinations thereof.
57. The method of claim 51, wherein the catalytic material has a C2 selectivity of greater than 50% and a methane conversion of greater than 20% when employed as catalytic material in the oxidative coupling of methane at a temperature of 750° C. or less.
58. The method of claim 51, wherein the plurality of catalytic nanowires comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
(1) In the drawings, the sizes and relative positions of elements in the drawings are not necessarily drawn to scale. For example, the various elements and angles are not drawn to scale, and some of these elements are arbitrarily enlarged and positioned to improve drawing legibility. Further, the particular shapes of the elements as drawn are not intended to convey any information regarding the actual shape of the particular elements, and have been selected solely for ease of recognition in the drawings.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
DETAILED DESCRIPTION OF THE INVENTION
(26) In the following description, certain specific details are set forth in order to provide a thorough understanding of various embodiments. However, one skilled in the art will understand that the invention may be practiced without these details. In other instances, well-known structures have not been shown or described in detail to avoid unnecessarily obscuring descriptions of the embodiments. Unless the context requires otherwise, throughout the specification and claims which follow, the word “comprise” and variations thereof, such as, “comprises” and “comprising” are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed invention.
(27) Reference throughout this specification to “one embodiment” or “an embodiment” means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment. Thus, the appearances of the phrases “in one embodiment” or “in an embodiment” in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments. Also, as used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. It should also be noted that the term “or” is generally employed in its sense including “and/or” unless the content clearly dictates otherwise.
(28) As discussed above, heterogeneous catalysis takes place between several phases. Generally, the catalyst is a solid, the reactants are gases or liquids and the products are gases or liquids. Thus, a heterogeneous catalyst provides a surface that has multiple active sites for adsorption of one more gas or liquid reactants. Once adsorbed, certain bonds within the reactant molecules are weakened and dissociate, creating reactive fragments of the reactants, e.g., in free radical forms. One or more products are generated as new bonds between the resulting reactive fragments form, in part, due to their proximity to each other on the catalytic surface.
(29) As an example,
(30) It is generally recognized that the catalytic properties of a catalyst strongly correlate to its surface morphology. Typically, the surface morphology can be defined by geometric parameters such as: (1) the number of surface atoms (e.g., the surface oxygen of
(31) Catalysts in nano-size dimensions have substantially increased surface areas compared to their counterpart bulk materials. The catalytic properties are expected to be enhanced as more surface active sites are exposed to the reactants. Typically in traditional preparations, a top-down approach (e.g., milling) is adopted to reduce the size of the bulk material. However, the surface morphologies of such catalysts remain largely the same as those of the parent bulk material.
(32) Various embodiments described herein are directed to nanowires with controllable or tunable surface morphologies. In particular, nanowires synthesized by a “bottom up” approach, by which inorganic polycrystalline nanowires are nucleated from solution phase in the presence of a template, e.g., a linear or anisotropic shaped biological template. By varying the synthetic conditions, nanowires having different compositions and/or different surface morphologies are generated.
(33) In contrast to a bulk catalyst of a given elemental composition, which is likely to have a particular corresponding surface morphology, diverse nanowires with different surface morphologies can be generated despite having the same elemental composition. In this way, morphologically diverse nanowires can be created and screened according to their catalytic activity and performance parameters in any given catalytic reaction. Advantageously, the nanowires disclosed herein and methods of producing the same have general applicability to a wide variety of heterogeneous catalyses, including without limitation: oxidative coupling of methane (e.g.,
(34)
(35) More specifically, the work flow 100 begins with designing synthetic experiments based on solution phase template formations (block 110). The synthesis, subsequent treatments and screenings can be manual or automated. As will be discussed in more detail herein, by varying the synthetic conditions, nanowires can be prepared with various surface morphologies and/or compositions in respective microwells (block 114). The nanowires are subsequently calcined and then optionally doped (block 120). Optionally, the doped and calcined nanowires are further mixed with a catalyst support (block 122). Beyond the optional support step, all subsequent steps are carried out in a “wafer” format, in which nanowire catalysts are deposited in a quartz wafer that has been etched to create an ordered array of microwells. Each microwell is a self-contained reactor, in which independently variable processing conditions can be designed to include, without limitation, respective choices of elemental compositions, catalyst support, reaction precursors, templates, reaction durations, pH values, temperatures, ratio between reactants, gas flows, and calcining conditions (block 124). Due to design constraints of some wafers, in some embodiments calcining and other temperature variables are identical in all microwells. A wafer map 130 can be created to correlate the processing conditions to the nanowire in each microwell. A library of diverse nanowires can be generated in which each library member corresponds to a particular set of processing conditions and corresponding compositional and/or morphological characteristics.
(36) Nanowires obtained under various synthetic conditions are thereafter deposited in respective microwells of a wafer (140) for evaluating their respective catalytic properties in a given reaction (blocks 132 and 134). The catalytic performance of each library member can be screened serially by several known primary screening technologies, including scanning mass spectroscopy (SMS) (Symyx Technologies Inc., Santa Clara, Calif.). The screening process is fully automated, and the SMS tool can determine if a nanowire is catalytically active or not, as well as its relative strength as a catalyst at a particular temperature. Typically, the wafer is placed on a motion control stage capable of positioning a single well below a probe that flows the feed of the starting material over the nanowire surface and removes reaction products to a mass spectrometer and/or other detector technologies (blocks 134 and 140). The individual nanowire is heated to a preset reaction temperature, e.g., using a CO.sub.2 IR laser from the backside of the quartz wafer and an IR camera to monitor temperature and a preset mixture of reactant gases. The SMS tool collects data with regard to the consumption of the reactant(s) and the generation of the product(s) of the catalytic reaction in each well (block 144), and at each temperature and flow rate.
(37) The SMS data obtained as described above provide information on relative catalytic properties among all the library members (block 150). In order to obtain more quantitative data on the catalytic properties of the nanowires, possible hits that meet certain criteria are subjected to a secondary screening (block 154). Typically, secondary screening technologies include a single, or alternatively multiple channel fixed-bed or fluidized bed reactors (as described in more detail herein). In parallel reactor systems or multi-channel fixed-bed reactor system, a single feed system supplies reactants to a set of flow restrictors. The flow restrictors divide the flows evenly among parallel reactors. Care is taken to achieve uniform reaction temperature between the reactors such that the various nanowires can be differentiated solely based on their catalytic performances. The secondary screening allows for accurate determination of catalytic properties such as selectivity, yield and conversion (block 160). These results serve as a feedback for designing further nanowire libraries.
(38) Secondary screening is also schematically depicted in
(39) Thus, in accordance with various embodiments described herein, compositional and morphologically diverse nanowires can be rationally synthesized to meet catalytic performance criteria. These and other aspects of the present disclosure are described in more detail below.
(40) Definitions
(41) As used herein, and unless the context dictates otherwise, the following terms have the meanings as specified below.
(42) “Catalyst” means a substance that alters the rate of a chemical reaction. A catalyst may either increase the chemical reaction rate (i.e. a “positive catalyst”) or decrease the reaction rate (i.e. a “negative catalyst”). Catalysts participate in a reaction in a cyclic fashion such that the catalyst is cyclically regenerated. “Catalytic” means having the properties of a catalyst.
(43) “Nanoparticle” means a particle having at least one diameter on the order of nanometers (e.g. between about 1 and 100 nanometers).
(44) “Nanowire” means a nanowire structure having at least one diameter on the order of nanometers (e.g. between about 1 and 100 nanometers) and an aspect ratio greater than 10:1. The “aspect ratio” of a nanowire is the ratio of the actual length (L) of the nanowire to the diameter (D) of the nanowire. Aspect ratio is expressed as L:D.
(45) “Polycrystalline nanowire” means a nanowire having multiple crystal domains. Polycrystalline nanowires generally have different morphologies (e.g. bent vs. straight) as compared to the corresponding “single-crystalline” nanowires.
(46) “Effective length” of a nanowire means the shortest distance between the two distal ends of a nanowire as measured by transmission electron microscopy (TEM) in bright field mode at 5 keV. “Average effective length” refers to the average of the effective lengths of individual nanowires within a plurality of nanowires.
(47) “Actual length” of a nanowire means the distance between the two distal ends of a nanowire as traced through the backbone of the nanowire as measured by TEM in bright field mode at 5 keV. “Average actual length” refers to the average of the actual lengths of individual nanowires within a plurality of nanowires.
(48) The “diameter” of a nanowire is measured in an axis perpendicular to the axis of the nanowire's actual length (i.e. perpendicular to the nanowires backbone). The diameter of a nanowire will vary from narrow to wide as measured at different points along the nanowire backbone. As used herein, the diameter of a nanowire is the most prevalent (i.e. the mode) diameter.
(49) The “ratio of effective length to actual length” is determined by dividing the effective length by the actual length. A nanowire having a “bent morphology” will have a ratio of effective length to actual length of less than one as described in more detail herein. A straight nanowire will have a ratio of effective length to actual length equal to one as described in more detail herein.
(50) “Inorganic” means a substance comprising a metal element or semi-metal element. In certain embodiments, inorganic refers to a substance comprising a metal element. An inorganic compound can contain one or more metals in its elemental state, or more typically, a compound formed by a metal ion (M.sup.n+, wherein n 1, 2, 3, 4, 5, 6 or 7) and an anion (X.sup.m+, m is 1, 2, 3 or 4), which balance and neutralize the positive charges of the metal ion through electrostatic interactions. Non-limiting examples of inorganic compounds include oxides, hydroxides, halides, nitrates, sulfates, carbonates, phosphates, acetates, oxalates, and combinations thereof, of metal elements. Other non-limiting examples of inorganic compounds include Li.sub.2CO.sub.3, Li.sub.2PO.sub.4, LiOH, Li.sub.2O, LiCl, LiBr, LiI, Li.sub.2C.sub.2O.sub.4, Li.sub.2SO.sub.4, Na.sub.2CO.sub.3,Na.sub.2PO.sub.4, NaOH, Na.sub.2O, NaCl, NaBr, NaI, Na.sub.2C.sub.2O.sub.4, Na.sub.2SO.sub.4, K.sub.2CO.sub.3, K.sub.2PO.sub.4, KOH, K.sub.2O, KCl, KBr, KI, K.sub.2C.sub.2O.sub.4, K.sub.2SO.sub.4, Cs.sub.2CO.sub.3, CsPO.sub.4, CsOH, Cs.sub.2O, CsCl, CsBr, CsI, CsC.sub.2O.sub.4, CsSO.sub.4, Be(OH).sub.2, BeCO.sub.3, BePO.sub.4, BeO, BeCl.sub.2, BeBr.sub.2, BeI.sub.2, BeC.sub.2O.sub.4. BeSO.sub.4, Mg(OH).sub.2, MgCO.sub.3, MgPO.sub.4, MgO, MgCl.sub.2, MgBr.sub.2, MgI.sub.2, MgC.sub.2O.sub.4. MgSO.sub.4, Ca(OH).sub.2, CaO, CaCO.sub.3, CaPO.sub.4, CaCl.sub.2, CaBr.sub.2, CaI.sub.2, Ca(OH).sub.2, CaC.sub.2O.sub.4, CaSO.sub.4, Y.sub.2O.sub.3, Y.sub.2(CO.sub.3).sub.3, Y.sub.2(PO.sub.4).sub.3, Y(OH).sub.3, YCl.sub.3, YBr.sub.3, YI.sub.3, Y.sub.2(C.sub.2O4).sub.3, Y.sub.2(SO4).sub.3, Zr(OH).sub.4, Zr(CO.sub.3).sub.2, Zr(PO.sub.4).sub.2, ZrO(OH).sub.2, ZrO2, ZrCl.sub.4, ZrBr.sub.4, ZrI.sub.4, Zr(C.sub.2O.sub.4).sub.2, Zr(SO.sub.4).sub.2, Ti(OH).sub.4, TiO(OH).sub.2, Ti(CO.sub.3).sub.2, Ti(PO.sub.4).sub.2, TiO2, TiCl.sub.4, TiBr.sub.4, TiI.sub.4, Ti(C.sub.2O.sub.4).sub.2, Ti(SO.sub.4).sub.2,BaO, Ba(OH).sub.2, BaCO.sub.3, BaPO.sub.4, BaCl.sub.2, BaBr.sub.2, BaI.sub.2, BaC.sub.2O.sub.4, BaSO.sub.4, La(OH).sub.3, La.sub.2(CO.sub.3).sub.3, La.sub.2(PO.sub.4).sub.3, La.sub.2O.sub.3, LaCl.sub.3, LaBr.sub.3, LaI.sub.3, La.sub.2(C.sub.2O.sub.4).sub.3, La.sub.2(SO.sub.4).sub.3, Ce(OH).sub.4, Ce(CO.sub.3).sub.2, Ce(PO.sub.4).sub.2, CeO.sub.2, Ce.sub.2O.sub.3, CeCl.sub.4, CeBr.sub.4, CeI.sub.4, Ce(C.sub.2O.sub.4).sub.2, Ce(SO.sub.4).sub.2, ThO.sub.2, Th(CO.sub.3).sub.2, Th(PO.sub.4).sub.2, ThCl.sub.4, ThBr.sub.4, ThI.sub.4, Th(OH).sub.4, Th(C.sub.2O.sub.4).sub.2, Th(SO.sub.4).sub.2, Sr(OH).sub.2, SrCO.sub.3, SrPO.sub.4, SrO, SrCl.sub.2, SrBr.sub.2, SrI.sub.2, SrC.sub.2O.sub.4, SrSO.sub.4, Sm.sub.2O.sub.3, Sm.sub.2(CO.sub.3).sub.3, Sm.sub.2(PO.sub.4).sub.3, SmCl.sub.3, SmBr.sub.3, SmI.sub.3, Sm(OH).sub.3, Sm.sub.2(CO3).sub.3, Sm.sub.2(C.sub.2O.sub.3).sub.3, Sm.sub.2(SO.sub.4).sub.3, LiCa.sub.2Bi.sub.3O.sub.4Cl.sub.6, Na.sub.2WO.sub.4, K/SrCoO.sub.3, K/Na/SrCoO.sub.3, Li/SrCoO.sub.3, SrCoO.sub.3, molybdenum oxides, molybdenum hydroxides, molybdenum carbonates, molybdenum phosphates, molybdenum chlorides, molybdenum bromides, molybdenum iodides, molybdenum oxalates, molybdenum sulfates, manganese oxides, manganese chlorides, manganese bromides, manganese iodides, manganese hydroxides, manganese oxalates, manganese sulfates, manganese tugstates, vanadium oxides, vanadium carbonates, vanadium phosphates, vanadium chlorides, vanadium bromides, vanadium iodides, vanadium hydroxides, vanadium oxalates, vanadium sulfates, tungsten oxides, tungsten carbonates, tungsten phosphates, tungsten chlorides, tungsten bromides, tungsten iodides, tungsten hydroxides, tungsten oxalates, tungsten sulfates, neodymium oxides, neodymium carbonates, neodymium phosphates, neodymium chlorides, neodymium bromides, neodymium iodides, neodymium hydroxides, neodymium oxalates, neodymium sulfates, europium oxides, europium carbonates, europium phosphates, europium chlorides, europium bromides, europium iodides, europium hydroxides, europium oxalates, europium sulfates rhenium oxides, rhenium carbonates, rhenium phosphates, rhenium chlorides, rhenium bromides, rhenium iodides, rhenium hydroxides, rhenium oxalates, rhenium sulfates, chromium oxides, chromium carbonates, chromium phosphates, chromium chlorides, chromium bromides, chromium iodides, chromium hydroxides, chromium oxalates, chromium sulfates, potassium molybdenum oxides and the like.
(51) “Salt” means a compound comprising negative and positive ions. Salts are generally comprised of cations and counter ions. Under appropriate conditions, e.g., the solution also comprises a template, the metal ion (M.sup.n+) and the anion (X.sup.m−) bind to the template to induce nucleation and growth of a nanowire of M.sub.mX.sub.n on the template. “Anion precursor” thus is a compound that comprises an anion and a cationic counter ion, which allows the anion (X.sup.m−) to dissociate from the cationic counter ion in a solution. Specific examples of the metal salt and anion precursors are described in further detail herein.
(52) “Oxide” refers to a metal compound comprising oxygen. Examples of oxides include, but are not limited to, metal oxides (M.sub.xO.sub.y), metal oxyhalides (M.sub.xO.sub.yX.sub.z), metal oxynitrates (M.sub.xO.sub.y(NO.sub.3).sub.z), metal phosphates (M.sub.x(PO.sub.4).sub.y, metal oxycarbonates (M.sub.xO.sub.y(CO.sub.3).sub.z), metal carbonates, metal oxyhydroxides (M.sub.xO.sub.y(OH).sub.z) and the like, wherein X is independently, at each occurrence, fluoro, chloro, bromo or iodo, and x, y and z are numbers from 1 to 100.
(53) “Mixed oxide” or “mixed metal oxide” refers to a compound comprising two or more oxidized metals and oxygen (i.e., M1.sub.xM2.sub.yO.sub.z, wherein M1 and M2 are the same or different metal elements, O is oxygen and x, y and z are numbers from 1 to 100). A mixed oxide may comprise metal elements in various oxidation states and may comprise more than one type of metal element. For example, a mixed oxide of manganese and magnesium comprises oxidized forms of magnesium and manganese. Each individual manganese and magnesium atom may or may not have the same oxidation state. Mixed oxides comprising 2, 3, 4, 5, 6 or more metal elements can be represented in an analogous manner. Mixed oxides also include oxy-hydroxides (e.g., M.sub.xO.sub.yOH.sub.z, wherein M is a metal element, O is oxygen, x, y and z are numbers from 1 to 100 and OH is hydroxy). Mixed oxides may be represented herein as M1-M2, wherein M1 and M2 are each independently a metal element.
(54) “Rare earth oxide” refers to an oxide of an element from group 3, lanthanides or actinides. Rare earth oxides include mixed oxides containing a rare earth element. Examples of rare earth oxides include, but are not limited to, La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3, Pr.sub.2O.sub.3, Ln1.sub.4-xLn2.sub.xO.sub.6, La.sub.4-xLn1.sub.xO.sub.6, La.sub.4-xNd.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4, La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, Y—La, Zr—La, Pr—La and Ce—La.
(55) “Crystal domain” means a continuous region over which a substance is crystalline.
(56) “Single-crystalline nanowires” means a nanowire having a single crystal domain.
(57) “Template” is any synthetic and/or natural material that provides at least one nucleation site where ions can nucleate and grow to form nanoparticles. In certain embodiments, the templates can be a multi-molecular biological structure comprising one or more biomolecules. Typically, the biological template comprises multiple binding sites that recognize certain ions and allow for the nucleation and growth of the same. Non-limiting examples of biological templates include bacteriophages, amyloid fibers, viruses and capsids.
(58) “Biomolecule” refers to any organic molecule of a biological origin. Biomolecule includes modified and/or degraded molecules of a biological origin. Non-limiting examples of biomolecules include peptides, proteins (including cytokines, growth factors, etc.), nucleic acids, polynucleotides, amino acids, antibodies, enzymes, and single-stranded or double-stranded nucleic acid, including any modified and/or degraded forms thereof.
(59) “Amyloid fibers” refers to proteinaceous filaments of about 1-25 nm in diameter.
(60) A “bacteriophage” or “phage” is any one of a number of viruses that infect bacteria. Typically, bacteriophages consist of an outer protein coat or “major coat protein” enclosing genetic material. A non-limiting example of a bacteriophage is the M13 bacteriophage. Non-limiting examples of bacteriophage coat proteins include the pIII, pV, pVIII, etc. protein as described in more detail below.
(61) A “capsid” is the protein shell of a virus. A capsid comprises several oligomeric structural subunits made of proteins.
(62) “Nucleation” refers to the process of forming a solid from solubilized particles, for example forming a nanowire in situ by converting a soluble precursor (e.g. metal and hydroxide ions) into nanocrystals in the presence of a template.
(63) “Nucleation site” refers to a site on a template, for example a bacteriophage, where nucleation of ions may occur. Nucleation sites include, for example, amino acids having carboxylic acid (—COOH), amino (—NH.sub.3.sup.+ or —NH.sub.2), hydroxyl (—OH), and/or thiol (—SH) functional groups.
(64) A “peptide” refers to two or more amino acids joined by peptide (amide) bonds. The amino-acid building blocks (subunits) include naturally occurring α-amino acids and/or unnatural amino acids, such as β-amino acids and homoamino acids. An unnatural amino acid can be a chemically modified form of a natural amino acid. Peptides can be comprised of 2 or more, 5 or more, 10 or more, 20 or more, or 40 or more amino acids.
(65) “Peptide sequence” refers to the sequence of amino acids within a peptide or protein.
(66) “Protein” refers to a natural or engineered macromolecule having a primary structure characterized by peptide sequences. In addition to the primary structure, proteins also exhibit secondary and tertiary structures that determine their final geometric shapes.
(67) “Polynucleotide” means a molecule comprised of two or more nucleotides connected via an internucleotide bond (e.g. a phosphate bond). Polynucleotides may be comprised of both ribose and/or deoxy ribose nucleotides. Examples of nucleotides include guanosine, adenosine, thiamine, and cytosine, as well as unnatural analogues thereof.
(68) “Nucleic acid” means a macromolecule comprised of polynucleotides. Nucleic acids may be both single stranded and double stranded, and, like proteins, can exhibit secondary and tertiary structures that determine their final geometric shapes.
(69) “Nucleic acid sequence” of “nucleotide sequence” refers to the sequence of nucleotides within a polynucleotide or nucleic acid.
(70) “Anisotropic” means having an aspect ratio greater than one.
(71) “Anisotropic biomolecule” means a biomolecule, as defined herein, having an aspect ratio greater than 1. Non-limiting examples of anisotropic biomolecules include bacteriophages, amyloid fibers, and capsids.
(72) “Turnover number” is a measure of the number of reactant molecules a catalyst can convert to product molecules per unit time.
(73) “Active” or “catalytically active” refers to a catalyst which has substantial activity in the reaction of interest. For example, in some embodiments a catalyst which is OCM active (i.e., has activity in the OCM reaction) has a C2 selectivity of 5% or more and/or a methane conversion of 5% or more when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less.
(74) “Inactive” or “catalytically inactive” refers to a catalyst which does not have substantial activity in the reaction of interest. For example, in some embodiments a catalyst which is OCM inactive has a C2 selectivity of less than 5% and/or a methane conversion of less than 5% when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less.
(75) “Activation temperature” refers to the temperature at which a catalyst becomes catalytically active.
(76) “OCM activity” refers to the ability of a catalyst to catalyse the OCM reaction.
(77) A catalyst having “high OCM activity” refers to a catalyst having a C2 selectivity of 50% or more and/or a methane conversion of 20% or more when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a specific temperature, for example 750° C. or less.
(78) A catalyst having “moderate OCM activity” refers to a catalyst having a C2 selectivity of about 20-50% and/or a methane conversion of about 10-20% or more when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less.
(79) A catalyst having “low OCM activity” refers to a catalyst having a C2 selectivity of about 5-20% and/or a methane conversion of about 5-10% or more when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less.
(80) “Dopant” or “doping agent” is an impurity added to or incorporated within a catalyst to optimize catalytic performance (e.g. increase or decrease catalytic activity). As compared to the undoped catalyst, a doped catalyst may increase or decrease the selectivity, conversion, and/or yield of a reaction catalyzed by the catalyst.
(81) “Atomic percent” (at % or at/at) or “atomic ratio” when used in the context of nanowire dopants refers to the ratio of the total number of dopant atoms to the total number of metal atoms in the nanowire. For example, the atomic percent of dopant in a lithium doped Mg.sub.6MnO.sub.8 nanowire is determined by calculating the total number of lithium atoms and dividing by the sum of the total number of magnesium and manganese atoms and multiplying by 100 (i.e., atomic percent of dopant=[Li atoms/(Mg atoms+Mn atoms)]×100).
(82) “Weight percent” (wt/wt)” when used in the context of nanowire dopants refers to the ratio of the total weight of dopant to the total combined weight of the dopant and the nanowire. For example, the weight percent of dopant in a lithium doped Mg.sub.6MnO.sub.8 nanowire is determined by calculating the total weight of lithium and dividing by the sum of the total combined weight of lithium and Mg.sub.6MnO.sub.8 and multiplying by 100 (i.e., weight percent of dopant=[Li weight/(Li weight+Mg.sub.6MnO.sub.8 weight)]×100).
(83) An “extrudate” refers to a material (e.g., catalytic material) prepared by forcing a semisolid material comprising a catalyst through a die or opening of appropriate shape. Extrudates can be prepared in a variety of shapes and structures by common means known in the art.
(84) A “pellet” or “pressed pellet” refers to a material (e.g., catalytic material) prepared by applying pressure to (i.e., compressing) a material comprising a catalyst into a desired shape. Pellets having various dimensions and shapes can be prepared according to common techniques in the art.
(85) “Monolith” or “monolith support” is generally a structure formed from a single structural unit preferably having passages disposed through it in either an irregular or regular pattern with porous or non-porous walls separating adjacent passages. Examples of such monolithic supports include, e.g., ceramic or metal foam-like or porous structures. The single structural unit may be used in place of or in addition to conventional particulate or granular catalysts (e.g., pellets or extrudates). Examples of such irregular patterned monolith substrates include filters used for molten metals. Monoliths generally have a porous fraction ranging from about 60% to 90% and a flow resistance substantially less than the flow resistance of a packed bed of similar volume (e.g., about 10% tp 30% of the flow resistance of a packed bed of similar volume). Examples of regular patterned substrates include monolith honeycomb supports used for purifying exhausts from motor vehicles and used in various chemical processes and ceramic foam structures having irregular passages. Many types of monolith support structures made from conventional refractory or ceramic materials such as alumina, zirconia, yttria, silicon carbide, and mixtures thereof, are well known and commercially available from, among others, Corning, lac.; Vesuvius Hi-Tech Ceramics, Inc.; and Porvair Advanced Materials, Inc. and SiCAT (Sicatalyst.com). Monoliths include foams, honeycombs, foils, mesh, guaze and the like.
(86) “Group 1” elements include lithium (Li), sodium (Na), potassium (K), rubidium (Rb), cesium (Cs), and francium (Fr).
(87) “Group 2” elements include beryllium (Be), magnesium (Mg), calcium (Ca), strontium (Sr), barium (Ba), and radium (Ra).
(88) “Group 3” elements include scandium (Sc) and yttrium (Y).
(89) “Group 4” elements include titanium (Ti), zirconium (Zr), halfnium (Hf), and rutherfordium (Rf).
(90) “Group 5” elements include vanadium (V), niobium (Nb), tantalum (Ta), and dubnium (Db).
(91) “Group 6” elements include chromium (Cr), molybdenum (Mo), tungsten (W), and seaborgium (Sg).
(92) “Group 7” elements include manganese (Mn), technetium (Tc), rhenium (Re), and bohrium (Bh).
(93) “Group 8” elements include iron (Fe), ruthenium (Ru), osmium (Os), and hassium (Hs).
(94) “Group 9” elements include cobalt (Co), rhodium (Rh), iridium (Ir), and meitnerium (Mt).
(95) “Group 10” elements include nickel (Ni), palladium (Pd), platinum (Pt) and darmistadium (Ds).
(96) “Group 11” elements include copper (Cu), silver (Ag), gold (Au), and roentgenium (Rg).
(97) “Group 12” elements include zinc (Zn), cadmium (Cd), mercury (Hg), and copernicium (Cn).
(98) “Lanthanides” include lanthanum (La), cerium (Ce), praseodymium (Pr), neodymium (Nd), promethium (Pm), samarium (Sm), europium (Eu), gadolinium (Gd), terbium (Tb), dysprosium (Dy), holmium (Ho), erbium (Er), thulium (Tm), yitterbium (Yb), and lutetium (Lu).
(99) “Actinides” include actinium (Ac), thorium (Th), protactinium (Pa), uranium (U), neptunium (Np), plutonium (Pu), americium (Am), curium (Cm), berklelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), mendelevium (Md), nobelium (No), and lawrencium (Lr).
(100) “Rare earth” elements include Group 3, lanthanides and actinides.
(101) “Metal element” or “metal” is any element, except hydrogen, selected from Groups 1 through 12, lanthanides, actinides, aluminum (Al), gallium (Ga), indium (In), tin (Sn), thallium (TI), lead (Pb), and bismuth (Bi). Metal elements include metal elements in their elemental form as well as metal elements in an oxidized or reduced state, for example, when a metal element is combined with other elements in the form of compounds comprising metal elements. For example, metal elements can be in the form of hydrates, salts, oxides, as well as various polymorphs thereof, and the like.
(102) “Semi-metal element” refers to an element selected from boron (B), silicon (Si), germanium (Ge), arsenic (As), antimony (Sb), tellurium (Te), and polonium (Po).
(103) “Non-metal element” refers to an element selected from carbon (C), nitrogen (N), oxygen (O), fluorine (F), phosphorus (P), sulfur (S), chlorine (Cl), selenium (Se), bromine (Br), iodine (I), and astatine (At).
(104) “C2” refers to a hydrocarbon (i.e., compound consisting of carbon and hydrogen atoms) having only two carbon atoms, for example ethane and ethylene. Similarily, “C3” refers to a hydrocarbon having only 3 carbon atoms, for example propane and propylene.
(105) “Conversion” means the mole fraction (i.e., percent) of a reactant converted to a product or products.
(106) “Selectivity” refers to the percent of converted reactant that went to a specified product, e.g., C2 selectivity is the % of converted methane that formed ethane and ethylene, C3 selectivity is the % of converted methane that formed propane and propylene, CO selectivity is the % of converted methane that formed CO.
(107) “Yield” is a measure of (e.g. percent) of product obtained relative to the theoretical maximum product obtainable. Yield is calculated by dividing the amount of the obtained product in moles by the theoretical yield in moles. Percent yield is calculated by multiplying this value by 100. C2 yield is defined as the sum of the ethane and ethylene molar flow at the reactor outlet multiplied by two and divided by the inlet methane molar flow. C3 yield is defined as the sum of propane and propylene molar flow at the reactor outlet multiplied by three and divided by the inlet methane molar flow. C2+ yield is the sum of the C2 yield and C3 yield. Yield is also calculable by multiplying the methane conversion by the relevant selectivity, e.g. C2 yield is equal to the methane conversion times the C2 selectivity.
(108) “Bulk catalyst” or “bulk material” means a catalyst prepared by traditional techniques, for example by milling or grinding large catalyst particles to obtain smaller/higher surface area catalyst particles. Bulk materials are prepared with minimal control over the size and/or morphology of the material.
(109) “Alkane” means a straight chain or branched, noncyclic or cyclic, saturated aliphatic hydrocarbon. Alkanes include linear, branched and cyclic structures. Representative straight chain alkanes include methane, ethane, n-propane, n-butane, n-pentane, n-hexane, and the like; while branched alkanes include isopropane, sec-butane, isobutanel, tert-butane, isopentane, and the like. Representative cyclic alkanes include cyclopropane, cyclobutane, cyclopentane, cyclohexane, and the like. “Alkene” means a straight chain or branched, noncyclic or cyclic, unsaturated aliphatic hydrocarbon having at least one carbon-carbon double bond. Alkenes include linear, branched and cyclic structures. Representative straight chain and branched alkenes include ethylene, propylene, 1-butene, 2-butene, isobutylene, 1-pentene, 2-pentene, 3-methyl-1-butene, 2-methyl-2-butene, 2,3-dimethyl-2-butene, and the like. Cyclic alkenes include cyclohexene and cyclopentene and the like.
(110) “Alkyne” means a straight chain or branched, noncyclic or cyclic, unsaturated aliphatic hydrocarbon having at least one carbon-carbon triple bond. Alkynes include linear, branched and cyclic structures. Representative straight chain and branched alkynes include acetylene, propyne, 1-butyne, 2-butyne, 1-pentyne, 2-pentyne, 3-methyl-1-butyne, and the like. Representative cyclic alkynes include cycloheptyne and the like.
(111) “Alkyl,” “alkenyl” and “alkynyl” refers to an alkane, alkene or alkyne radical, respectively.
(112) “Aromatic” means a carbocyclic moiety having a cyclic system of conjugated p orbitals forming a delocalized conjugated 7C system and a number of π electrons equal to 4n+2 with n=0, 1, 2, 3, etc. Representative examples of aromatics include benzene and naphthalene and toluene. “Aryl” refers to an aromatic radical. Exemplary aryl groups include, but are not limited to, phenyl, napthyl and the like.
(113) “Carbon-containing compounds” are compounds that comprise carbon. Non-limiting examples of carbon-containing compounds include hydrocarbons, CO and CO.sub.2. Nanowires
1. Structure/Physical Characteristics
(114) As noted above, disclosed herein are nanowires useful as catalysts. Catalytic nanowires, and methods for preparing the same, are also described in PCT Pub. No. 2011/149996 and U.S. application Ser. No. 13/689,514, filed on Nov. 29, 2012 and entitled “Polymer Templated Nanowire Catalysts,” the full disclosures of which are incorporated herein by reference in their entireties.
(115) Compared to nanowire 200 of
(116) As noted above, in some embodiments nanowires having a “bent” morphology (i.e. “bent nanowires”) are provided. A “bent” morphology means that the bent nanowires comprise various twists, bends and/or kinks in their general morphology as illustrated generally in
(117) The ratio of effective length to actual length of a nanowire having a bent morphology may vary depending on the angle of observation. For example, one-skilled in the art will recognize that the same nanowire, when observed from different perspectives, can have a different effective length as determined by TEM. In addition, not all nanowires having a bent morphology will have the same ratio of effective length to actual length. Accordingly, in a population (i.e. plurality) of nanowires having a bent morphology, a range of ratios of effective length to actual length is expected. Although the ratio of effective length to actual length may vary from nanowire to nanowire, nanowires having a bent morphology will always have a ratio of effective length to actual length of less than one from any angle of observation.
(118) In various embodiments, a substantially straight nanowire is provided. A substantially straight nanowire has a ratio of effective length to actual length equal to one. Accordingly, in some embodiments, the nanowires of the present disclosure have a ratio of effective length to actual length equal to one.
(119) The actual lengths of the nanowires disclosed herein may vary. For example in some embodiments, the nanowires have an actual length of between 100 nm and 100 μm. In other embodiments, the nanowires have an actual length of between 100 nm and 10 μm. In other embodiments, the nanowires have an actual length of between 200 nm and 10 μm. In other embodiments, the nanowires have an actual length of between 500 nm and 5 μm. In other embodiments, the actual length is greater than 5 μm. In other embodiments, the nanowires have an actual length of between 800 nm and 1000 nm. In other further embodiments, the nanowires have an actual length of 900 nm. As noted below, the actual length of the nanowires may be determined by TEM, for example, in bright field mode at 5 keV.
(120) The diameter of the nanowires may be different at different points along the nanowire backbone. However, the nanowires comprise a mode diameter (i.e. the most frequently occurring diameter). As used herein, the diameter of a nanowire refers to the mode diameter. In some embodiments, the nanowires have a diameter of between 1 nm and 10 μm, between 1 nm and 1 μm, between 1 nm and 500 nm, between 1 nm and 100 nm, between 7 nm and 100 nm, between 7 nm and 50 nm, between 7 nm and 25 nm, or between 7 nm and 15 nm. On other embodiments, the diameter is greater than 500 nm. As noted below, the diameter of the nanowires may be determined by TEM, for example, in bright field mode at 5 keV.
(121) Various embodiments of the present disclosure provide nanowires having different aspect ratios. In some embodiments, the nanowires have an aspect ratio of greater than 10:1. In other embodiments, the nanowires have an aspect ratio greater than 20:1. In other embodiments, the nanowires have an aspect ratio greater than 50:1. In other embodiments, the nanowires have an aspect ratio greater than 100:1.
(122) In some embodiments, the nanowires comprise a solid core while in other embodiments, the nanowires comprise a hollow core.
(123) The morphology of a nanowire (including length, diameter, and other parameters) can be determined by transmission electron microscopy (TEM). Transmission electron microscopy (TEM) is a technique whereby a beam of electrons is transmitted through an ultra thin specimen, interacting with the specimen as it passes through. An image is formed from the interaction of the electrons transmitted through the specimen. The image is magnified and focused onto an imaging device, such as a fluorescent screen, on a layer of photographic film or detected by a sensor such as a CCD camera. TEM techniques are well known to those of skill in the art.
(124) A TEM image of nanowires may be taken, for example, in bright field mode at 5 keV (e.g., as shown in
(125) The nanowires of the present disclosure can be further characterized by powder x-ray diffraction (XRD). XRD is a technique capable of revealing information about the crystallographic structure, chemical composition, and physical properties of materials, including nanowires. XRD is based on observing the diffracted intensity of an X-ray beam hitting a sample as a function of incident and diffraction angle, polarization, and wavelength or energy.
(126) Crystal structure, composition, and phase, including the crystal domain size of the nanowires, can be determined by XRD. In some embodiments, the nanowires comprise a single crystal domain (i.e. single crystalline). In other embodiments, the nanowires comprise multiple crystal domains (i.e. polycrystalline). In some other embodiments, the average crystal domain of the nanowires is less than 100 nm, less than 50 nm, less than 30 nm, less than 20 nm, less than 10 nm, less than 5 nm, or less than 2 nm.
(127) Typically, a catalytic material described herein comprises a plurality of nanowires. In certain embodiments, the plurality of nanowires form a mesh of randomly distributed and, to various degrees, interconnected nanowires.
(128) The total surface area per gram of a nanowire or plurality of nanowires may have an effect on the catalytic performance. Pore size distribution may affect the nanowires catalytic performance as well. Surface area and pore size distribution of the nanowires or plurality of nanowires can be determined by BET (Brunauer, Emmett, Teller) measurements. BET techniques utilize nitrogen adsorption at various temperatures and partial pressures to determine the surface area and pore sizes of catalysts. BET techniques for determining surface area and pore size distribution are well known in the art.
(129) In some embodiments the nanowires have a surface area of between 0.0001 and 3000 m.sup.2/g, between 0.0001 and 2000 m.sup.2/g, between 0.0001 and 1000 m.sup.2/g, between 0.0001 and 500 m.sup.2/g, between 0.0001 and 100 m.sup.2/g, between 0.0001 and 50 m.sup.2/g, between 0.0001 and 20 m.sup.2/g, between 0.0001 and 10 m.sup.2/g or between 0.0001 and 5 m.sup.2/g.
(130) In some embodiments the nanowires have a surface area of between 0.001 and 3000 m.sup.2/g, between 0.001 and 2000 m.sup.2/g, between 0.001 and 1000 m.sup.2/g, between 0.001 and 500 m.sup.2/g, between 0.001 and 100 m.sup.2/g, between 0.001 and 50 m.sup.2/g, between 0.001 and 20 m.sup.2/g, between 0.001 and 10 m.sup.2/g or between 0.001 and 5 m.sup.2/g.
(131) In some other embodiments the nanowires have a surface area of between 2000 and 3000 m.sup.2/g, between 1000 and 2000 m.sup.2/g, between 500 and 1000 m.sup.2/g, between 100 and 500 m.sup.2/g, between 10 and 100 m.sup.2/g, between 5 and 50 m.sup.2/g, between 2 and 20 m.sup.2/g or between 0.0001 and 10 m.sup.2/g.
(132) In other embodiments, the nanowires have a surface area of greater than 2000 m.sup.2/g, greater than 1000 m.sup.2/g, greater than 500 m.sup.2/g, greater than 100 m.sup.2/g, greater than 50 m.sup.2/g, greater than 20 m.sup.2/g, greater than 10 m.sup.2/g, greater than 5 m.sup.2/g, greater than 1 m.sup.2/g, greater than 0.0001 m.sup.2/g.
2. Chemical Composition
(133) The catalytic nanowires may have any number of compositions and morphologies. In some embodiments, the nanowires are inorganic. In other embodiments, the nanowires are polycrystalline. In some other embodiments, the nanowires are inorganic and polycrystalline. In yet other embodiments, the nanowires are single-crystalline, or in other embodiments the nanowires are inorganic and single-crystalline. In still other embodiments of any of the foregoing, the nanowires may have a ratio of effective length to actual length of less than one and an aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV. In still other embodiments of any of the forgoing, the nanowires may comprise one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
(134) In one embodiment, the disclosure provides a catalyst comprising an inorganic catalytic polycrystalline nanowire, the nanowire having a ratio of effective length to actual length of less than one and an aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV, wherein the nanowire comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
(135) In some embodiments, the nanowires comprise one or more metal elements from any of Groups 1-7, lanthanides, actinides or combinations thereof, for example, the nanowires may be mono-metallic, bi-metallic, tri-metallic, etc (i.e. contain one, two, three, etc. metal elements). In some embodiments, the metal elements are present in the nanowires in elemental form while in other embodiments the metal elements are present in the nanowires in oxidized form. In other embodiments the metal elements are present in the nanowires in the form of a compound comprising a metal element. The metal element or compound comprising the metal element may be in the form of oxides, hydroxides, oxyhydroxides, salts, hydrated oxides, carbonates, oxy-carbonates, sulfates, phosphates, acetates, oxalates and the like. The metal element or compound comprising the metal element may also be in the form of any of a number of different polymorphs or crystal structures.
(136) In certain examples, metal oxides may be hygroscopic and may change forms once exposed to air, may absorb carbon dioxide, may be subjected to incomplete calcination or any combination thereof. Accordingly, although the nanowires are often referred to as metal oxides, in certain embodiments the nanowires also comprise hydrated oxides, oxyhydroxides, hydroxides, oxycarbonates (or oxide carbonates), carbonates or combinations thereof.
(137) In other embodiments, the nanowires comprise one or more metal elements from Group 1. In other embodiments, the nanowires comprise one or more metal elements from Group 2. In other embodiments, the nanowires comprise one or more metal elements from Group 3. In other embodiments, the nanowires comprise one or more metal elements from Group 4. In other embodiments, the nanowires comprise one or more metal elements from Group 5. In other embodiments, the nanowires comprise one or more metal elements from Group 6. In other embodiments, the nanowires comprise one or more metal elements from Group 7. In other embodiments, the nanowires comprise one or more metal elements from the lanthanides. In other embodiments, the nanowires comprise one or more metal elements from the actinides.
(138) In one embodiment, the nanowires comprise one or more metal elements from any of Groups 1-7, lanthanides, actinides or combinations thereof in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 1 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 2 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 3 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 4 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 5 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 6 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from Group 7 in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from the lanthanides in the form of an oxide. In another embodiment, the nanowires comprise one or more metal elements from the actinides in the form of an oxide.
(139) In other embodiments, the nanowires comprise oxides, hydroxides, sulfates, carbonates, oxide carbonates, acetates, oxalates, phosphates (including hydrogenphosphates and dihydrogenphosphates), oxyhalides, hydroxihalides, oxyhydroxides, oxysulfates or combinations thereof of one or more metal elements from any of Groups 1-7, lanthanides, actinides or combinations thereof. In some other embodiments, the nanowires comprise oxides, hydroxides, sulfates, carbonates, oxide carbonates, oxalates or combinations thereof of one or more metal elements from any of Groups 1-7, lanthanides, actinides or combinations thereof. In other embodiments, the nanowires comprise oxides, and in other embodiments, the nanowires comprise hydroxides. In other embodiments, the nanowires comprise carbonates, and in other embodiments, the nanowires comprise oxy-carbonates. In other embodiments, the nanowires comprise Li.sub.2CO.sub.3, LiOH, Li.sub.2O, Li.sub.2C.sub.2O.sub.4, Li.sub.2SO.sub.4, Na.sub.2CO.sub.3, NaOH, Na.sub.2O, Na.sub.2C.sub.2O.sub.4, Na.sub.2SO.sub.4, K.sub.2CO.sub.3, KOH, K.sub.2O, K.sub.2C.sub.2O.sub.4, K.sub.2SO.sub.4, Cs.sub.2CO.sub.3, CsOH, Cs.sub.2O, CsC.sub.2O.sub.4, CsSO.sub.4, Be(OH).sub.2, BeCO.sub.3, BeO, BeC.sub.2O.sub.4. BeSO.sub.4, Mg(OH).sub.2, MgCO.sub.3, MgO, MgC.sub.2O.sub.4. MgSO.sub.4, Ca(OH).sub.2, CaO, CaCO.sub.3, CaC.sub.2O.sub.4, CaSO.sub.4, Y.sub.2O.sub.3, Y.sub.3(CO.sub.3).sub.2, Y(OH).sub.3, Y.sub.2(C.sub.2O4).sub.3, Y.sub.2(SO4).sub.3, Zr(OH).sub.4, ZrO(OH).sub.2, ZrO2, Zr(C.sub.2O.sub.4).sub.2, Zr(SO.sub.4).sub.2, Ti(OH).sub.4, TiO(OH).sub.2, TiO2, Ti(C.sub.2O.sub.4).sub.2, Ti(SO.sub.4).sub.2,BaO, Ba(OH).sub.2, BaCO.sub.3, BaC.sub.2O.sub.4, BaSO.sub.4, La(OH).sub.3, La.sub.2O.sub.3, La.sub.2(C.sub.2O.sub.4).sub.3, La.sub.2(SO.sub.4).sub.3, La.sub.2(CO.sub.3).sub.3, Ce(OH).sub.4, CeO.sub.2, Ce.sub.2O.sub.3, Ce(C.sub.2O.sub.4).sub.2, Ce(SO.sub.4).sub.2, Ce(CO.sub.3).sub.2, ThO.sub.2, Th(OH).sub.4, Th(C.sub.2O.sub.4).sub.2, Th(SO.sub.4).sub.2, Th(CO.sub.3).sub.2, Sr(OH).sub.2, SrCO.sub.3, SrO, SrC.sub.2O.sub.4, SrSO.sub.4, Sm.sub.2O.sub.3, Sm(OH).sub.3, Sm.sub.2(CO.sub.3).sub.3, Sm.sub.2(C.sub.2O.sub.3).sub.3, Sm.sub.2(SO.sub.4).sub.3, LiCa.sub.2Bi.sub.3O.sub.4Cl.sub.6, NaMnO.sub.4, Na.sub.2WO.sub.4, NaMn/WO.sub.4, CoWO.sub.4, CuWO.sub.4, K/SrCoO.sub.3, K/Na/SrCoO.sub.3, Na/SrCoO.sub.3, Li/SrCoO.sub.3, SrCoO.sub.3, Mg.sub.6MnO.sub.8, LiMn.sub.2O.sub.4, Li/Mg.sub.6MnO.sub.8, Na.sub.10Mn/W.sub.5O.sub.17, Mg.sub.3Mn.sub.3B.sub.2O.sub.10, Mg.sub.3(BO.sub.3).sub.2, molybdenum oxides, molybdenum hydroxides, molybdenum oxalates, molybdenum sulfates, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, manganese oxides, manganese hydroxides, manganese oxalates, manganese sulfates, manganese tungstates, manganese carbonates, vanadium oxides, vanadium hydroxides, vanadium oxalates, vanadium sulfates, tungsten oxides, tungsten hydroxides, tungsten oxalates, tungsten sulfates, neodymium oxides, neodymium hydroxides, neodymium carbonates, neodymium oxalates, neodymium sulfates, europium oxides, europium hydroxides, europium carbonates, europium oxalates, europium sulfates, praseodymium oxides, praseodymium hydroxides, praseodymium carbonates, praseodymium oxalates, praseodymium sulfates, rhenium oxides, rhenium hydroxides, rhenium oxalates, rhenium sulfates, chromium oxides, chromium hydroxides, chromium oxalates, chromium sulfates, potassium molybdenum oxides/silicon oxide or combinations thereof.
(140) In other embodiments, the nanowires comprise Li.sub.2O, Na.sub.2O, K.sub.2O, Cs.sub.2O, BeO MgO, CaO, ZrO(OH).sub.2, ZrO2, TiO.sub.2, TiO(OH).sub.2, BaO, Y.sub.2O.sub.3, La.sub.2O.sub.3, CeO.sub.2, Ce.sub.2O.sub.3, ThO.sub.2, SrO, Sm.sub.2O.sub.3, Nd.sub.2O.sub.3, Eu.sub.2O.sub.3, Pr.sub.2O.sub.3, LiCa.sub.2Bi.sub.3O.sub.4Cl.sub.6, NaMnO.sub.4, Na.sub.2WO.sub.4, Na/Mn/WO.sub.4, Na/MnWO.sub.4, Mn/WO4, K/SrCoO.sub.3, K/Na/SrCoO.sub.3, K/SrCoO.sub.3, Na/SrCoO.sub.3, Li/SrCoO.sub.3, SrCoO.sub.3, Mg.sub.6MnO.sub.8, Na/B/Mg.sub.6MnO.sub.8, Li/B/Mg.sub.6MnO.sub.8, Zr.sub.2Mo.sub.2O.sub.8, molybdenum oxides, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, manganese oxides, vanadium oxides, tungsten oxides, neodymium oxides, rhenium oxides, chromium oxides, or combinations thereof.
(141) In still other aspects, the nanowires comprise lanthanide containing perovskites. A perovskite is any material with the same type of crystal structure as calcium titanium oxide (CaTiO.sub.3). Examples of perovskites within the context of the present disclosure include, but are not limited to, LaCoO.sub.3 and La/SrCoO.sub.3.
(142) In other embodiments, the nanowires comprise TiO.sub.2, Sm.sub.2O.sub.3, V.sub.2O.sub.5, MoO.sub.3, BeO, MnO.sub.2, MgO, La.sub.2O.sub.3, Nd.sub.2O.sub.3, Eu.sub.2O.sub.3, ZrO.sub.2, SrO, Na.sub.2WO.sub.4, Mn/WO.sub.4, BaO, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, Mg.sub.6MnO.sub.8, Na/B/Mg.sub.6MnO.sub.8, Li/B/Mg.sub.6MnO.sub.8, NaMnO.sub.4, CaO or combinations thereof. In further embodiments, the nanowires comprise MgO, La.sub.2O.sub.3, Nd.sub.2O.sub.3, Na.sub.2WO.sub.4, Mn/WO.sub.4, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, Mg.sub.6MnO.sub.8, Na/B/Mg.sub.6MnO.sub.8, Li/B/Mg.sub.6MnO.sub.8 or combinations thereof.
(143) In some embodiments, the nanowires comprise Mg, Ca, Sr, Ba, Y, La, W, Mn, Mo, Nd, Sm, Eu, Pr, Zr or combinations thereof, and in other embodiments the nanowire comprises MgO, CaO, SrO, BaO, Y.sub.2O.sub.3, La.sub.2O.sub.3, Na.sub.2WO.sub.4, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, Nd.sub.2O.sub.3, Sm.sub.2O.sub.3, Eu.sub.2O.sub.3, Pr.sub.2O.sub.3, Mg.sub.6MnO.sub.8, NaMnO.sub.4, Na/Mn/W/O, Na/MnWO.sub.4, MnWO.sub.4 or combinations thereof.
(144) In more specific embodiments, the nanowires comprise MgO. In other specific embodiments, the nanowires comprise CaO. In other embodiments, the nanowires comprise SrO. In other specific embodiments, the nanowires comprise La.sub.2O.sub.3. In other specific embodiments, the nanowires comprise Na.sub.2WO.sub.4 and may optionally further comprise Mn/WO.sub.4. In other specific embodiments, the nanowires comprise Mn.sub.2O.sub.3. In other specific embodiments, the nanowires comprise Mn.sub.3O.sub.4. In other specific embodiments, the nanowires comprise Mg.sub.6MnO.sub.8. In other specific embodiments, the nanowires comprise NaMnO.sub.4. In other specific embodiments, the nanowires comprise Nd.sub.2O.sub.3. In other specific embodiments, the nanowires comprise Eu.sub.2O.sub.3. In other specific embodiments, the nanowires comprise Pr.sub.2O.sub.3. In some other embodiments, the nanowires comprise Sm.sub.2O.sub.3.
(145) In certain embodiments, the nanowires comprise an oxide of a group 2 element. For example, in some embodiments, the nanowires comprise an oxide of magnesium. In other embodiments, the nanowires comprise an oxide of calcium. In other embodiments, the nanowires comprise an oxide of strontium. In other embodiments, the nanowires comprise an oxide of barium.
(146) In certain other embodiments, the nanowires comprise an oxide of a group 3 element. For example, in some embodiments, the nanowires comprise an oxide of yttrium. In other embodiments, the nanowires comprise an oxide of scandium.
(147) In yet other certain embodiments, the nanowires comprise an oxide of an early lanthanide element. For example, in some embodiments, the nanowires comprise an oxide of lanthanum. In other embodiments, the nanowires comprise an oxide of cerium. In other embodiments, the nanowires comprise an oxide of praseodymium. In other embodiments, the nanowires comprise an oxide of neodymium. In other embodiments, the nanowires comprise an oxide of promethium. In other embodiments, the nanowires comprise an oxide of samarium. In other embodiments, the nanowires comprise an oxide of europium. In other embodiments, the nanowires comprise an oxide of gadolinium.
(148) In certain other embodiments, the nanowires comprise a lanthanide in the form of an oxy-carbonate. For example, the nanowires may comprise Ln.sub.2O.sub.2(CO.sub.3), where Ln represents a lanthanide. Examples in this regard include: La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb and Lu oxy-carbonates. In other embodiments, the nanowires comprise an oxy-carbonate of one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof. Accordingly in one embodiment the nanowires comprise Li, Na, K, Rb, Cs, Fr, Be, Mg, Ca, Sr, Ba, Ra, Sc, Y, Ti, Zr, Hf, V, Nb, Ta, Cr, Mo, W, Mn, Tc or Re oxy-carbonate. In other embodiments, the nanowires comprise Ac, Th, U or Pa oxide carbonate. An oxy-carbonate may be represented by the following formula: M.sub.xO.sub.y(CO.sub.3), wherein M is a metal element from any of Groups 1 through 7, lanthanides or actinides and x, y and z are intergers such that the overall charge of the metal oxy-carbonate is neutral.
(149) In certain other embodiments, the nanowires comprise a carbonate of a group 2 element. For example, the nanowires may comprise MgCO.sub.3, CaCO.sub.3, SrCO.sub.3, BaCO.sub.3 or combination thereof. In other embodiments, the nanowires comprise a carbonate of one or more elements from any of the Group 1 through 7, lanthanides and actinides or combination thereof. Accordingly in one embodiment the nanowires comprise a Li, Na, K, Rb, Cs, Fr, Be, Mg, Ca, Sr, Ba, Ra, Sc, Y, Ti, Zr, Hf, V, Nb, Ta, Cr, Mo, W, Mn, Tc, Re, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, Ac, Th, Pa or U carbonate.
(150) In other embodiments, the nanowires comprise TiO.sub.2, Sm.sub.2O.sub.3, V.sub.2O.sub.5, MoO.sub.3, BeO, MnO.sub.2, MgO, La.sub.2O.sub.3, ZrO.sub.2, SrO, Na.sub.2WO.sub.4, BaCO.sub.3, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, Mg.sub.6MnO.sub.8, Na/B/Mg.sub.6MnO.sub.8, Li/B/Mg.sub.6MnO.sub.8, Zr.sub.2Mo.sub.2O.sub.8, NaMnO.sub.4, CaO or combinations thereof and further comprise one or more dopants comprised of metal elements, semi-metal elements, non-metal elements or combinations thereof. In some further embodiments, the nanowires comprise MgO, La.sub.2O.sub.3, Na.sub.2WO.sub.4, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, Mg.sub.6MnO.sub.8, Zr.sub.2Mo.sub.2O.sub.8, NaMnO.sub.4 or combinations thereof, and the nanowires further comprise Li, Sr, Zr, Ba, Mn or Mn/WO.sub.4.
(151) In some embodiments, the nanowires or a catalytic material comprising a plurality of the nanowires comprise a combination of one or more of metal elements from any of Groups 1-7, lanthanides or actinides and one or more of metal elements, semi-metal elements or non-metal elements. For example in one embodiment, the nanowires comprise the combinations of Li/Mg/O, Ba/Mg/O, Zr/La/O, Ba/La/O, Sr/La/O, Zr/V/P/O, Mo/V/Sb/O, V.sub.2O.sub.5/Al.sub.2O.sub.3, Mo/V/O, V/Ce/O, V/Ti/P/O, V.sub.2O.sub.5/TiO.sub.2, V/P/O/TiO.sub.2, V/P/O/Al.sub.2O.sub.3, V/Mg/O, V.sub.2O.sub.5/ZrO.sub.2, Mo/V/Te/O, V/Mo/O/Al.sub.2O.sub.3, Ni/V/Sb/O, Co/V/Sb/O, Sn/V/Sb/O, Bi/V/Sb/O, Mo/V/Te/Nb/O, Mo/V/Nb/O, V.sub.2O.sub.5/MgO/SiO.sub.2, V/Co, MoO.sub.3/Al.sub.2O.sub.3, Ni/Nb/O, NiO/Al.sub.2O.sub.3, Ga/Cr/Zr/P/O, MoO.sub.3/Cl/SiO.sub.2/TiO.sub.2, Co/Cr/Sn/W/O, Cr/Mo/O, MoO.sub.3/Cl/SiO.sub.2/TiO.sub.2, Co/Ca, NiO/MgO, MoO.sub.3/Al.sub.2O.sub.3, Nb/P/Mo/O, Mo/V/Te/Sb//Nb/O, La/Na/Al/O, Ni/Ta/Nb/O, Mo/Mn/V/W/O, Li/Dy/Mg/O, Sr/La/Nd/O, Co/Cr/Sn/W/O, MoO.sub.3/SiO.sub.2/TiO.sub.2, Sm/Na/P/O, Sm/Sr/O, Sr/La/Nd/O, Co/P/O/TiO.sub.2, La/Sr/Fe/Cl/O, La/Sr/Cu/Cl/O, Y/Ba/Cu/O, Na/Ca/O, V.sub.2O.sub.5/ZrO.sub.2, V/Mg/O, Mn/V/Cr/WO/Al.sub.2O.sub.3, V.sub.2O.sub.5/K/SiO.sub.2, V.sub.2O.sub.5/Ca/TiO.sub.2, V.sub.2O.sub.5/K/TiO.sub.2, V/Mg/Al/O, V/Zr/O, V/Nb/O, V.sub.2O.sub.5/Ga.sub.2O.sub.3, V/Mg/Al/O, V/Nb/O, V/Sb/O, V/Mn/O, V/Nb/O/Sb.sub.2O.sub.4, V/Sb/O/TiO.sub.2, V.sub.2O.sub.5/Ca, V.sub.2O.sub.5/K/Al.sub.2O.sub.3, V.sub.2O.sub.5/TiO.sub.2, V.sub.2O.sub.5/MgO/TiO.sub.2, V.sub.2O.sub.5/ZrO.sub.2, V/Al/F/O, V/Nb/O/TiO.sub.2, Ni/V/O, V.sub.2O.sub.5/SmVO.sub.4, V/W/O, V.sub.2O.sub.5/Zn/Al.sub.2O.sub.3, V.sub.2O.sub.5/CeO.sub.2, V/Sm/O, V.sub.2O.sub.5/TiO.sub.2/SiO.sub.2, Mo/Li/O/Al.sub.2O.sub.3, Mg/Dy/Li/Cl/O, Mg/Dy/Li/Cl/O, Ce/Ni/O, Ni/Mo/O/V, Ni/Mo/O/V/N, Ni/Mo/O Sb/O/N, MoO.sub.3/Cl/SiO.sub.2/TiO.sub.2, Co/Mo/O, Ni/Ti/O, Ni/Zr/O, Cr/O, MoO.sub.3/Al.sub.2O.sub.3, Mn/P/O, MoO.sub.3/K/ZrO.sub.2, Na/W/O, Mn/Na/W/O, Mn/Na//W/O/SiO.sub.2, Na/W/O/SiO.sub.2, Mn/Mo/O, Nb.sub.2O.sub.5/TiO.sub.2, Co/W/O, Ni/Mo/O, Ga/Mo/O, Mg/Mo/V/O, Cr.sub.2O.sub.3/Al.sub.2O.sub.3, Cr/Mo/Cs/O/Al.sub.2O.sub.3, Co/Sr/O/Ca, Ag/Mo/P/O, MoO.sub.3/SmVO.sub.4, Mo/Mg/Al/O, MoO.sub.3/K/SiO.sub.2/TiO.sub.2, Cr/Mo/O/Al.sub.2O.sub.3, MoO.sub.3/Al.sub.2O.sub.3, Ni/Co/Mo/O, Y/Zr/O, Y/Hf, Zr/Mo/Mn/O, Mg/Mn/O, Li/Mn/O, Mg/Mn/B/O, Mg/B/O, Na/B/Mg/Mn/O, Li/B/Mg/Mn/O, Mn/Na/P/O, Na/Mn/Mg/O, Zr/Mo/O, Mn/W/O or Mg/Mn/O.
(152) In a specific embodiment, the nanowires comprise the combinations of Li/Mg/O, Ba/Mg/O, Zr/La/O, Ba/La/O, Sr/La/O, Sr/Nd/O, La/O, Nd/O, Eu/O, Mg/La/O, Mg/Nd/O, Na/La/O, Na/Nd/O, Sm/O, Mn/Na/W/O, Mg/Mn/O, Na/B/Mg/Mn/O, Li/B/Mg/Mn/O, Zr/Mo/O or Na/Mn/Mg/O. For example, in some embodiments the nanowires comprise the combinations of Li/MgO, Ba/MgO, Sr/La.sub.2O.sub.3, Ba/La.sub.2O.sub.3, Mn/Na.sub.2WO.sub.4, Mn/Na.sub.2WO.sub.4/SiO.sub.2, Mn.sub.2O.sub.3/Na.sub.2WO.sub.4, Mn.sub.3O.sub.4/Na.sub.2WO.sub.4, Li/B/Mg.sub.6MnO.sub.8, Na/B/Mg.sub.6MnO.sub.8 or NaMnO.sub.4/MgO. In certain embodiments, the nanowire comprises Li/MgO, Ba/MgO, Sr/La.sub.2O.sub.3, Mg/Na/La.sub.2O.sub.3, Sr/Nd.sub.2O.sub.3, or Mn/Na.sub.2WO.sub.4.
(153) In some other specific embodiments, the nanowires comprise the combination of Li/MgO. In other specific embodiments, the nanowires comprise the combination of Ba/MgO. In other specific embodiments, the nanowires comprise the combination of Sr/La.sub.2O.sub.3. In other specific embodiments, the nanowires comprise the combination of Ba/La.sub.2O.sub.3. In other specific embodiments, the nanowires comprise the combination of Mn/Na.sub.2WO.sub.4. In other specific embodiments, the nanowires comprise the combination of Mn/Na.sub.2WO.sub.4/SiO.sub.2. In other specific embodiments, the nanowires comprise the combination of Mn.sub.2O.sub.3/Na.sub.2WO.sub.4. In other specific embodiments, the nanowires comprise the combination of Mn.sub.3O.sub.4/Na.sub.2WO.sub.4. In other specific embodiments, the nanowires comprise the combination of Mn/WO.sub.4/Na.sub.2WO.sub.4. In other specific embodiments, the nanowires comprise the combination of Li/B/Mg.sub.6MnO.sub.8. In other specific embodiments, the nanowires comprise the combination of Na/B/Mg.sub.6MnO.sub.8. In other specific embodiments, the nanowires comprise the combination of NaMnO.sub.4/MgO.
(154) Polyoxyometalates (POM) are a class of metal oxides that range in structure from the molecular to the micrometer scale. The unique physical and chemical properties of POM clusters, and the ability to tune these properties by synthetic means have attracted significant interest from the scientific community to create “designer” materials. For example, heteropolyanions such as the well-known Keggin [XM.sub.12O.sub.40].sup.− and Wells-Dawson [X.sub.2M1.sub.8O.sub.62].sup.− anions (where M=W or Mo; and X=a tetrahedral template such as but not limited to Si, Ge, P) and isopolyanions with metal oxide frameworks with general formulas [MO.sub.x].sub.n where M=Mo, W, V, and Nb and x=4-7 are ideal candidates for OCM/ODH catalysts. Accordingly, in one embodiment the nanowires comprise [XM.sub.12O.sub.40].sup.− or [X.sub.2M1.sub.8O.sub.62].sup.− anions (where M=W or Mo; and X=a tetrahedral template such as but not limited to Si, Ge, P) and isopolyanions with metal oxide frameworks with general formulas [MO.sub.x].sub.n where M=Mo, W, V, and Nb and x=4-7. In some embodiments, X is P or Si.
(155) These POM clusters have “lacunary” sites that can accommodate divalent and trivalent first row transition metals, the metal oxide clusters acting as ligands. These lacunary sites are essentially “doping” sites, allowing the dopant to be dispersed at the molecular level instead of in the bulk which can create pockets of unevenly dispersed doped material. Because the POM clusters can be manipulated by standard synthetic techniques, POMs are highly modular and a wide library of materials can be prepared with different compositions, cluster size, and dopant oxidation state. These parameters can be tuned to yield desired OCM/ODH catalytic properties. Accordingly, one embodiment of the present disclosure is a nanowire comprising one or more POM clusters. Such nanowires find utility as catalysts, for example, in the OCM and ODH reactions.
(156) Silica doped sodium manganese tungstate (NaMn/WO.sub.4/SiO.sub.2) is a promising OCM catalyst. The NaMn/WO.sub.4/SiO.sub.2 system is attractive due to its high C2 selectivity and yield. Unfortunately, good catalytic activity is only achievable at temperatures greater than 800° C. and although the exact active portion of the catalyst is still subject to debate, it is thought that sodium plays an important role in the catalytic cycle. In addition, the NaMn/WO.sub.4/SiO.sub.2 catalyst surface area is relatively low <2 m.sup.2/g. Manganese tungstate (Mn/WO.sub.4) nanorods (i.e., straight nanowires) can be used to model a NaMn/WO.sub.4/SiO.sub.2 based nanowire OCM catalyst. The Mn/WO.sub.4 nanorods are prepared hydro-thermally and the size can be tuned based on reaction conditions with dimensions of 25-75 nm in diameter to 200-800 nm in length. The as-prepared nano-rods have higher surface areas than the NaMn/WO.sub.4/SiO.sub.2 catalyst systems. In addition, the amount of sodium, or other elements, can be precisely doped into the Mn/WO.sub.4 nanorod material to target optimal catalytic activity. Nanorod tungstate based materials can be expanded to, but not limited to, CoWO.sub.4 or CuWO.sub.4 materials, which may serve as base materials for OCM/ODH catalysis. In addition to straight nanowires, the above discussion applies to the disclosed nanowires having a bent morphology as well. The nanowires of the disclosure may be analyzed by inductively coupled plasma mass spectrometry (ICP-MS) to determine the element content of the nanowires. ICP-MS is a type of mass spectrometry that is highly sensitive and capable of the determination of a range of metals and several non-metals at concentrations below one part in 10.sup.12. ICP is based on coupling together an inductively coupled plasma as a method of producing ions (ionization) with a mass spectrometer as a method of separating and detecting the ions. ICP-MS methods are well known in the art.
(157) In some embodiments, the nanowire comprises a combination of two or more metal compounds, for example metal oxides. For example, in some embodiments, the nanowire comprises Mn.sub.2O.sub.3/Na.sub.2WO.sub.4, Mn.sub.3O.sub.4/Na.sub.2WO.sub.4 MnWO.sub.4/Na.sub.2WO.sub.4/Mn.sub.2O.sub.3, MnWO.sub.4/Na.sub.2WO.sub.4/Mn.sub.3O.sub.4 or NaMnO.sub.4/MgO.
(158) Certain rare earth compositions have been found to be useful catalysts, for example as catalysts in the OCM reaction. Thus, in one embodiment, the nanowire catalysts comprise lanthanide oxides such as La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3 or Pr.sub.2O.sub.3. In other embodiments, the nanowires comprise mixed oxides of lanthanide metals. Such mixed oxides are represented by Ln1.sub.4-xLn2.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element and x is a number ranging from greater than 0 to less than 4. In other more specific embodiments, the lanthanide mixed oxides comprise La.sub.4-xLn1.sub.xO.sub.6, wherein Ln1 is a lanthanide element and x is a number ranging from greater than 0 to less than 4. For example, in some embodiments the lanthanide mixed oxides are mixed oxides of lanthanum and neodymium and the nanowires comprise La.sub.4-xNd.sub.xO.sub.6, wherein x is a number ranging from greater than 0 to less than 4 have also been found to be useful in the OCM reaction. For example La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, or combinations thereof have been found to be useful OCM catalyst compositions.
(159) Any of the foregoing nanowire catalysts may have any morphology (e.g., bent, straight, etc.) and may be prepared via any method described herein or known in the art. For example, these nanowires may be prepared from phage or another biological template, or the nanowires may be prepared in the absence of a template, for example by hydrothermal methods. Also as discussed below, certain dopant combinations with the above lanthanide nanowires have been found to be useful for enhancing the catalytic activity of the nanowires.
(160) In other embodiments the nanowires are in a core/shell arrangement (see below) and the nanowires comprise Eu on a MgO core; La on a MgO core; Nd on a MgO core; Sm on a MgO core; Y—Ce on a Na doped MgO core Na or Na doped Ce—Y on a MgO core.
(161) In an aspect of the invention, nanowires, and materials comprising the same, having the empirical formula M4.sub.wM5.sub.xM6.sub.yO.sub.z are provided, wherein each M4 is independently one or more elements selected from Groups 1 through 4, each M5 is independently one or more elements selected from Group 7 and M6 is independently one or more elements selected from Groups 5 through 8 and Groups 14 through 15 and w, x, y and z are integers such that the overall charge is balanced.
(162) In some embodiments, M4 comprises one or more elements selected from Group 1, such as sodium (Na), while M6 includes one or more elements selected from Group 6, such as tungsten (W) and M5 is Mn. In another embodiment, M4 is Na, M5 is Mn, M6 is W, the ratio of w:x is 10:1, and the ratio of w:y is 2:1. In such a case, the overall empirical formula of the nanowire is Na.sub.10MnW.sub.5O.sub.z. When Na is in the +1 oxidation state, W is in the +6 oxidation state, and Mn is in the +4 oxidation state, z must equal 17 so as to fill the valence requirements of Na, W and Mn. As a result, the overall empirical formula of the nanowire in this embodiment is Na.sub.10MnW.sub.5O.sub.17.
(163) In other embodiments, the ratios of w:x can be 1:1, or 5:1, or 15:1, or 25:1, or 50:1. In yet other embodiments, for any given ratio of w:x, the ratios of w:y can be 1:5, or 1:2, or 1:2, or 5:1. In still other embodiments, any nanowire of the empirical formula M4.sub.wM5.sub.xM6.sub.yO.sub.z, including the nanowire of the empirical formula M4.sub.10MnM6.sub.5O.sub.17 described above, can be supported on an oxide substrate. Oxide substrates can include silica, alumina, and titania. The reaction that anchors nanowire materials onto oxide substrates is analogous to the reaction that anchors bulk materials onto oxide substrates, such as that described in U.S. Pat. No. 4,808,563, which is entirely incorporated herein by reference. Example 18 describes the anchoring of nanowire material Na.sub.10MnW.sub.5O.sub.17 onto a silica substrate. Alternatively, non-oxide support, for example silicon carbide can be used to support nanowires of the present invention, for example Na.sub.10MnW.sub.5O.sub.17 nanowires and others. Silicon carbide has very good high temperature stability and chemical inertness toward OCM reaction intermediates and thus is particularily effective as a support in this reaction.
3. Catalytic Materials
(164) As noted above, the present disclosure provides a catalytic material comprising a plurality of nanowires. In some embodiments, the disclosure provides a catalytic material comprising a plurality of inorganic catalytic polycrystalline nanowires, the plurality of nanowires having a ratio of average effective length to average actual length of less than one and an average aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV, wherein the plurality of nanowires comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof.
(165) In certain embodiments, the catalytic material comprises a support or carrier. The support is preferably porous and has a high surface area. In some embodiments the support is active (i.e. has catalytic activity). In other embodiments, the support is inactive (i.e. non-catalytic). In some embodiments, the support comprises an inorganic oxide, Al.sub.2O.sub.3, SiO.sub.2, TiO.sub.2, MgO, CaO, SrO, ZrO.sub.2, ZnO, LiAl.sub.2, MgAl.sub.2O.sub.4, MnO, MnO.sub.2, Mn.sub.3O.sub.4, La.sub.2O.sub.3, AlPO4, SiO.sub.2/Al.sub.2O.sub.3, activated carbon, silica gel, zeolites, activated clays, activated Al.sub.2O.sub.3, SiC, diatomaceous earth, magnesia, aluminosilicates, calcium aluminate, support nanowires or combinations thereof. In some embodiments the support comprises silicon, for example SiO.sub.2. In other embodiments the support comprises magnesium, for example MgO. In other embodiments the support comprises zirconium, for example ZrO.sub.2. In yet other embodiments, the support comprises lanthanum, for example La.sub.2O.sub.3. In yet other embodiments, the support comprises lanthanum, for example Y.sub.2O.sub.3. In yet other embodiments, the support comprises hafnium, for example HfO.sub.2. In yet other embodiments, the support comprises aluminum, for example Al.sub.2O.sub.3. In yet other embodiments, the support comprises gallium, for example Ga.sub.2O.sub.3.
(166) In still other embodiments, the support material comprises an inorganic oxide, Al.sub.2O.sub.3, SiO.sub.2, TiO.sub.2, MgO, ZrO.sub.2, HfO2, CaO, SrO, ZnO, LiAl.sub.2, MgAl.sub.2O.sub.4, MnO, MnO.sub.2, Mn.sub.2O.sub.4, Mn.sub.3O.sub.4, La.sub.2O.sub.3, activated carbon, silica gel, zeolites, activated clays, activated Al.sub.2O.sub.3, diatomaceous earth, magnesia, aluminosilicates, calcium alum inate, support nanowires or combinations thereof. For example, the support material may comprise SiO.sub.2, ZrO.sub.2, CaO, La.sub.2O.sub.3 or MgO.
(167) In still other embodiments, the support material comprises a carbonate. For example, in some embodiments the support material comprises MgCO.sub.3, CaCO.sub.3, SrCO.sub.3, BaCO.sub.3, Y.sub.2(CO.sub.3).sub.3, La.sub.2(CO.sub.3).sub.3 or combinations thereof.
(168) In yet other embodiments, a nanowire may serve as a support for another nanowire. For example, a nanowire may be comprised of non-catalytic metal elements and adhered to or incorporated within the support nanowire is a catalytic nanowire. For example, in some embodiments, the support nanowires are comprised of SiO.sub.2, MgO, CaO, SrO, TiO.sub.2, ZrO.sub.2, Al.sub.2O.sub.3, ZnO MgCO.sub.3, CaCO.sub.3, SrCO.sub.3 or combinations thereof. Preparation of nanowire supported nanowire catalysts (i.e., core/shell nanowires) is discussed in more detail below. The optimum amount of nanowire present on the support depends, inter alia, on the catalytic activity of the nanowire. In some embodiments, the amount of nanowire present on the support ranges from 1 to 100 parts by weight nanowires per 100 parts by weight of support or from 10 to 50 parts by weight nanowires per 100 parts by weight of support. In other embodiments, the amount of nanowire present on the support ranges from 100-200 parts of nanowires per 100 parts by weight of support, or 200-500 parts of nanowires per 100 parts by weight of support, or 500-1000 parts of nanowires per 100 parts by weight of support. Typically, heterogeneous catalysts are used either in their pure form or blended with inert materials, such as silica, alumina, etc. The blending with inert materials is used in order to reduce and/or control large temperature non-uniformities within the reactor bed often observed in the case of strongly exothermic (or endothermic) reactions. In the case of complex multistep reactions, such as the reaction to convert methane into ethylene (OCM), typical blending materials can selectively slow down or quench one or more of the reactions of the system and promote unwanted side reactions. For example, in the case of the oxidative coupling of methane, silica and alumina can quench the methyl radicals and thus prevent the formation of ethane. In certain aspects, the present disclosure provides a catalytic material which solves these problems typically associated with catalyst support material. Accordingly, in certain embodiments the catalytic activity of the catalytic material can be tuned by blending two or more catalysts and/or catalyst support materials. The blended catalytic material may comprise a catalytic nanowire as described herein and a bulk catalyst material and/or inert support material.
(169) The blended catalytic materials comprise metal oxides, hydroxides, oxy-hydroxides, carbonates, oxalates of the groups 1-16, lanthanides, actinides or combinations thereof. For example, the blended catalytic materials may comprise a plurality of inorganic catalytic polycrystalline nanowires, as disclosed herein, and any one or more of straight nanowires, nanoparticles, bulk materials and inert support materials. Bulk materials are defined as any material in which no attempt to control the size and/or morphology was performed during its synthesis. The catalytic materials may be undoped or may be doped with any of the dopants described herein.
(170) In one embodiment, the catalyst blend comprises at least one type 1 component and at least one type 2 component. Type 1 components comprise catalysts having a high OCM activity at moderately low temperatures and type 2 components comprise catalysts having limited or no OCM activity at these moderately low temperatures, but are OCM active at higher temperatures. For example, in some embodiments the type 1 component is a catalyst (e.g., nanowire) having high OCM activity at moderately low temperatures. For example, the type 1 component may comprise a C2 yield of greater than 5% or greater than 10% at temperatures less than 800° C., less than 700° C. or less than 600° C. The type 2 component may comprise a C2 yield less than 0.1%, less than 1% or less than 5% at temperatures less than 800° C., less than 700° C. or less than 600° C. The type 2 component may comprise a C2 yield of greater than 0.1%, greater than 1%, greater than 5% or greater than 10% at temperatures greater than 800° C., greater than 700° C. or greater than 600° C. Typical type 1 components include nanowires, for example polycrystalline nanowires as described herein, while typical type 2 components include bulk OCM catalysts and nanowire catalysts which only have good OCM activity at higher temperatures, for example greater than 800° C. Examples of type 2 components may include catalysts comprising MgO. The catalyst blend may further comprise inert support materials as described above (e.g., silica, alumina, silicon carbide, etc.).
(171) In certain embodiments, the type 2 component acts as diluent in the same way an inert material does and thus helps reduce and/or control hot spots in the catalyst bed caused by the exothermic nature of the OCM reaction. However, because the type 2 component is an OCM catalyst, albeit not a particularly active one, it may prevent the occurrence of undesired side reactions, e.g. methyl radical quenching. Additionally, controlling the hotspots has the beneficial effect of extending the lifetime of the catalyst.
(172) For example, it has been found that diluting active lanthanide oxide OCM catalysts (e.g., nanowires) with as much as a 10:1 ratio of MgO, which by itself is not an active OCM catalyst at the temperature which the lanthanide oxide operates, is a good way to minimize “hot spots” in the reactor catalyst bed, while maintaining the selectivity and yield performance of the catalyst. On the other hand, doing the same dilution with quartz SiO.sub.2 is not effective because it appears to quench the methyl radicals which serves to lower the selectivity to C2s.
(173) In yet another embodiment, the type 2 components are good oxidative dehydrogenation (ODH) catalysts at the same temperature that the type 1 components are good OCM catalysts. In this embodiment, the ethylene/ethane ratio of the resulting gas mixture can be tuned in favor of higher ethylene. In another embodiment, the type 2 components are not only good ODH catalysts at the same temperature the type 1 components are good OCM catalysts, but also have limited to moderate OCM activity at these temperatures.
(174) In related embodiments, the catalytic performance of the catalytic material is tuned by selecting specific type 1 and type 2 components of a catalyst blend. In another embodiment, the catalytic performance is tuned by adjusting the ratio of the type 1 and type 2 components in the catalytic material. For example, the type 1 catalyst may be a catalyst for a specific step in the catalytic reaction, while the type 2 catalyst may be specific for a different step in the catalytic reaction. For example, the type 1 catalyst may be optimized for formation of methyl radicals and the type 2 catalyst may be optimized for formation of ethane or ethylene.
(175) In other embodiments, the catalytic material comprises at least two different components (component 1, component 2, component 3, etc.). The different components may comprise different morphologies, e.g. nanowires, nanoparticles, bulk, etc. The different components in the catalyst material can be, but not necessarily, of the same chemical composition and the only difference is in the morphology and/or the size of the particles. This difference in morphology and particle size may result in a difference in reactivity at a specific temperature. Additionally, the difference in morphology and particle size of the catalytic material components is advantageous for creating a very intimate blending, e.g. very dense packing of the catalysts particles, which can have a beneficial effect on catalyst performance. Also, the difference in morphology and particle size of the blend components would allow for control and tuning of the macro-pore distribution in the reactor bed and thus its catalytic efficiency. An additional level of micro-pore tuning can be attained by blending catalysts with different chemical composition and different morphology and/or particle size. The proximity effect would be advantageous for the reaction selectivity.
(176) Accordingly, in one embodiment the present disclosure provides the use of a catalytic material comprising a first catalytic nanowire and a bulk catalyst and/or a second catalytic nanowire in a catalytic reaction, for example the catalytic reaction may be OCM or ODH. In other embodiments, the first catalytic nanowire and the bulk catalyst and/or second catalytic nanowire are each catalytic with respect to the same reaction, and in other examples the first catalytic nanowire and the bulk catalyst and/or second catalytic nanowire have the same chemical composition.
(177) In some specific embodiments of the foregoing, the catalytic material comprises a first catalytic nanowire and a second catalytic nanowire. Each nanowire can have completely different chemical compositions or they may have the same base composition and differ only by the doping elements. In other embodiments, each nanowire can have the same or a different morphology. For example, each nanowire can differ by the nanowire size (length and/or aspect ratio), by ratio of actual/effective length, by chemical composition or any combination thereof. Furthermore, the first and second nanowires may each be catalytic with respect to the same reaction but may have different activity. Alternatively, each nanowire may catalyze different reactions.
(178) In a related embodiment, the catalytic material comprises a first catalytic nanowire and a bulk catalyst. The first nanowire and the bulk catalyst can have completely different chemical compositions or they may have the same base composition and differ only by the doping elements. Furthermore, the first nanowire and the bulk catalyst may each be catalytic with resepect to the same reaction but may have different activity. Alternatively, the first nanowire and the bulk catalyst may catalyze different reactions.
(179) In yet other embodiments of the foregoing, the catalytic nanowire has a catalytic activity in the catalytic reaction, which is greater than a catalytic activity of the bulk catalyst in the catalytic reaction at the same temperature. In still other embodiments, the catalytic activity of the bulk catalyst in the catalytic reaction increases with increasing temperature.
(180) OCM catalysts may be prone to hotspots due to the very exothermic nature of the OCM reaction. Diluting such catalysts helps to manage the hotspots. However, the diluent needs to be carefully chosen so that the overall performance of the catalyst is not degraded. Silicon carbide for example can be used as a diluent with little impact on the OCM selectivity of the blended catalytic material whereas using silica as a diluent significantly reduces OCM selectivity. The good heat conductivity of SiC is also beneficial in minimizing hot spots. As noted above, use of a catalyst diluents or support material that is itself OCM active has significant advantages over more traditional diluents such as silica and alumina, which can quench methyl radicals and thus reduce the OCM performance of the catalyst. An OCM active diluent is not expected to have any adverse impact on the generation and lifetime of methyl radicals and thus the dilution should not have any adverse impact on the catalyst performance. Thus embodiments of the invention include catalyst compositions comprising an OCM catalyst (e.g., any of the disclosed nanowire catalysts) in combination with a diluent or support material that is also OCM active. Methods for use of the same in an OCM reaction are also provided.
(181) In some embodiments, the above diluent comprises alkaline earth metal compounds, for example alkaline metal oxides, carbonates, sulfates or phosphates. Examples of diluents useful in various embodiments include, but are not limited to, MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgAl.sub.2O.sub.4, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, CaAl.sub.2O.sub.4, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrAl.sub.2O.sub.4, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaAl.sub.2O.sub.4 and the like. Most of these compounds are very cheap, especially MgO, CaO, MgCO.sub.3, CaCO.sub.3, SrO, SrCO.sub.3 and thus very attractive for use as diluents from an economic point of view. Additionally, the magnesium, calcium and strontium compounds are environmentally friendly too. Accordingly, an embodiment of the invention provides a catalytic material comprising a catalytic nanowire in combination with a diluent selected from one or more of MgO, MgCO.sub.3, MgSO.sub.4, Mg.sub.3(PO.sub.4).sub.2, CaO, CaCO.sub.3, CaSO.sub.4, Ca.sub.3(PO.sub.4).sub.2, SrO, SrCO.sub.3, SrSO.sub.4, Sr.sub.3(PO.sub.4).sub.2, BaO, BaCO.sub.3, BaSO.sub.4, Ba.sub.3(PO.sub.4).sub.2. In some specific embodiments the diluents is MgO, CaO, SrO, MgCO.sub.3, CaCO.sub.3, SrCO.sub.3 or combination thereof. Methods for use of the foregoing catalytic materials in an OCM reaction are also provided. The methods comprise converting methane to ethane and or ethylene in the presence of the catalytic materials.
(182) The above diluents and supports may be employed in any number of methods. For example, in some embodiments a support (e.g., MgO, CaO, CaCO.sub.3, SrCO.sub.3) may be used in the form of a pellet or monolith (e.g., honeycomb) structure, and the nanowire catalysts may be impregnated or supported thereon. In other embodiments, a core/shell arrangement is provided and the support material may form part of the core or shell. For example, a core of MgO, CaO, CaCO.sub.3 or SrCO.sub.3 may be coated with a shell of any of the disclosed nanowire compositions.
(183) In some embodiments, the diluent has a morphology selected from bulk (e.g. commercial grade), nano (nanowires, nanorods, nanoparticles, etc.) or combinations thereof.
(184) In some embodiments, the diluent has none to moderate catalytic activity at the temperature the OCM catalyst is operated. In some other embodiments, the diluent has moderate to large catalytic activity at a temperature higher than the temperature the OCM catalyst is operated. In yet some other embodiments, the diluent has none to moderate catalytic activity at the temperature the OCM catalyst is operated and moderate to large catalytic activity at temperatures higher than the temperature the OCM catalyst is operated. Typical temperatures for operating an OCM reaction according to the present disclosure are 800° C. or lower, 750° C. or lower, 700° C. or lower, 650° C. or lower, 600° C. or lower and 550° C. or lower.
(185) For example, CaCO.sub.3 is a relatively good OCM catalyst at T>750° C. (50% selectivity, >20% conversion) but has essentially no activity below 700° C. Experiments performed in support of the present invention showed that dilution of Nd.sub.2O.sub.3 straight nanowires with CaCO.sub.3 or SrCO.sub.3 (bulk) showed no degradation of OCM performance and, in some cases, even better performance than the neat catalyst.
(186) In some embodiments, the diluent portion in the catalyst/diluent mixture is 0.01%, 10%, 30%, 50%, 70%, 90% or 99.99% (weight percent) or any other value between 0.01% and 99.9%. In some embodiments, the dilution is performed with the OCM catalyst ready to go, e.g. after calcination. In some other embodiments, the dilution is performed prior to the final calcination of the catalyst, i.e. the catalyst and the diluent are calcined together. In yet some other embodiments, the dilution can be done during the synthesis as well, so that, for example, a mixed oxide is formed.
(187) In some embodiments, the catalyst/diluent mixture comprises more than one catalyst and/or more than one diluent. In some other embodiments, the catalyst/diluent mixture is pelletized and sized, or made into shaped extrudates or deposited on a monolith or foam, or is used as it is. Methods of the invention include taking advantage of the very exothermic nature of OCM by diluting the catalyst with another catalyst that is (almost) inactive in the OCM reaction at the operating temperature of the first catalyst but active at higher temperature. In these methods, the heat generated by the hotspots of the first catalyst will provide the necessary heat for the second catalyst to become active.
(188) For ease of illustration, the above description of catalytic materials often refers to OCM; however, such catalytic materials find utility in other catalytic reactions including but not limited to: oxidative dehydrogenation (ODH) of alkanes to their corresponding alkenes, selective oxidation of alkanes and alkenes and alkynes, oxidation of co, dry reforming of methane, selective oxidation of aromatics, Fischer-Tropsch, combustion of hydrocarbons, etc.
4. Preparation of Catalytic Materials
(189) The catalytic materials can be prepared according to any number of methods known in the art. For example, the catalytic materials can be prepared after preparation of the individual components by mixing the individual components in their dry form, e.g. blend of powders, and optionally, ball milling can be used to reduce particle size and/or increase mixing. Each component can be added together or one after the other to form layered particles. Alternatively, the individual components can be mixed prior to calcination, after calcination or by mixing already calcined components with uncalcined components. The catalytic materials may also be prepared by mixing the individual components in their dry form and optionally pressing them together into a “pill” followed by calcination to above 400° C.
(190) In other examples, the catalytic materials are prepared by mixing the individual components with one or more solvents into a suspension or slurry, and optional mixing and/or ball milling can be used to maximize uniformity and reduce particle size. Examples of slurry solvents useful in this context include, but are not limited to: water, alcohols, ethers, carboxylic acids, ketones, esters, amides, aldehydes, amines, alkanes, alkenes, alkynes, aromatics, etc. In other embodiments, the individual components are deposited on a supporting material such as silica, alumina, magnesia, activated carbon, and the like, or by mixing the individual components using a fluidized bed granulator. Combinations of any of the above methods may also be used.
(191) The catalytic materials may optionally comprise a dopant as described in more detail below. In this respect, doping material(s) may be added during preparation of the individual components, after preparation of the individual components but before drying of the same, after the drying step but before calcinations or after calcination. If more than one doping material is used, each dopant can be added together or one after the other to form layers of dopants.
(192) Doping material(s) may also be added as dry components and optionally ball milling can be used to increase mixing. In other embodiments, doping material(s) are added as a liquid (e.g. solution, suspension, slurry, etc.) to the dry individual catalyst components or to the blended catalytic material. The amount of liquid may optionally be adjusted for optimum wetting of the catalyst, which can result in optimum coverage of catalyst particles by doping material. Mixing and/or ball milling can also be used to maximize doping coverage and uniform distribution. Alternatively, doping material(s) are added as a liquid (e.g. solution, suspension, slurry, etc.) to a suspension or slurry of the catalyst in a solvent. Mixing and/or ball milling can be used to maximize doping coverage and uniform distribution. Incorporation of dopants can also be achieved using any of the methods described elsewhere herein.
(193) As noted below, an optional calcination step usually follows an optional drying step at T<200C (typically 60-120C) in a regular oven or in a vacuum oven. Calcination may be performed on the individual components of the catalytic material or on the blended catalytic material. Calcination is generally performed in an oven/furnace at a temperature higher than the minimum temperature at which at least one of the components decomposes or undergoes a phase transformation and can be performed in inert atmosphere (e.g. N.sub.2, Ar, He, etc.), oxidizing atmosphere (air, O.sub.2, etc.) or reducing atmosphere (H.sub.2, H.sub.2/N.sub.2, H.sub.2/Ar, etc.). The atmosphere may be a static atmosphere or a gas flow and may be performed at ambient pressure, at p<1 atm, in vacuum or at p>1 atm. High pressure treatment (at any temperature) may also be used to induce phase transformation including amorphous to crystalline. Calcinations may also be performed using microwave heating.
(194) Calcination is generally performed in any combination of steps comprising ramp up, dwell and ramp down. For example, ramp to 500° C., dwell at 500° C. for 5 h, ramp down to RT. Another example includes ramp to 100° C., dwell at 100° C. for 2 h, ramp to 300° C., dwell at 300° C. for 4 h, ramp to 550° C., dwell at 550° C. for 4 h, ramp down to RT. Calcination conditions (pressure, atmosphere type, etc.) can be changed during the calcination. In some embodiments, calcination is performed before preparation of the blended catalytic material (i.e., individual components are calcined), after preparation of the blended catalytic material but before doping, after doping of the individual components or blended catalytic material. Calcination may also be performed multiple times, e.g. after catalyst preparation and after doping.
(195) The catalytic materials may be incorporated into a reactor bed for performing any number of catalytic reactions (e.g., OCM, ODH and the like). Accordingly, in one embodiment the present disclosure provides a catalytic material as disclosed herein in contact with a reactor and/or in a reactor bed. For example, the reactor may be for performing an OCM reaction, may be a fixed bed reactor and may have a diameter greater than 1 inch. In this regard, the catalytic material may be packed neat (without diluents) or diluted with an inert material (e.g., sand, silica, alumina, etc.) The catalyst components may be packed uniformly forming a homogeneous reactor bed.
(196) The particle size of the individual components within a catalytic material may also alter the catalytic activity, and other properties, of the same. Accordingly, in one embodiment, the catalyst is milled to a target average particle size or the catalyst powder is sieved to select a particular particle size. In some aspects, the catalyst powder may be pressed into pellets and the catalyst pellets can be optionally milled and or sieved to obtain the desired particle size distribution.
(197) In some embodiments, the catalyst materials, alone or with binders and/or diluents, can be configured into larger aggregate forms, such as pellets, extrudates, or other aggregations of catalyst particles. For ease of duscussion, such larger forms are generally referred to herein as “pellets”. Such pellets may optionally include a binder and/or support material; however, the present inventors have surprisingly found that the disclosed nanowires are particularily suited to used in the form of a pellet without a binder and/or support material. Accordingly, one embodiment of the disclosure provides a catalytic material in the absence of a binder. In this regard, the morphology of the disclosed nanowires (either bent or straight, etc.) is believed to contribute to the nanowires' ability to be pressed into pellets without the need for a binder. Catalytic materials without binders are simpler, less complex and cheaper than corresponding materials with binders and thus offer certain advantages.
(198) In some instances, catalytic materials may be prepared using a “sacrificial binder” or support. Because of their special properties, the nanowires allow for preparation of catalytic material forms (e.g. pellets) without the use of a binder. A “sacrificial” binder can be used in order to create unique microporosity in pellets or extrudates. After removing the sacrificial binder, the structural integrity of the catalyst is ensured by the special binding properties of the nanowires and the resulting catalytic material has unique microporosity as a result of removing the binder. For example, in some embodiments a catalytic nanowire may be prepared with a binder and then the binder removed by any number of techniques (e.g., combustion, calcinations, acid erosion, etc.). This method allows for design and preparation of catalytic materials having unique microporosity (i.e., the microporosity is a function of size, etc. of the sacrificial binder). The ability to prepare different forms (e.g., pellets) of the nanowires without the use of binder is not only useful for preparation of catalytic materials from the nanowires, but also allows the nanowires to be used as support materials (or both catalytic and support material). Sacrificial binders and techniques useful inthis regard include sacrificial cellulosic fibers or other organic polymers that can be easily removed by calcination, non-sacrificial binders and techniques useful inthis regard include, colloidal oxide binders such as Ludox Silica or Nyacol colloidal zirconia that can also be added to strengthen the formed aggregate when needed. Sacrificial binders are added to increase macro-porosity (pores larger than 20 nm diameter) of the catalytic materials. Accordingly, in some embodiments the catalytic materials comprise pores greater than 20 nm in diameter, greater than 50 nm in diameter, greater than 75 nm in diameter, greater than 100 nm in diameter or greater than 150 nm in diameter.
(199) Catalytic materials also include any of the disclosed nanowires disposed on or adhered to a solid support. For example, the nanowires may be adhered to the surface of a monolith support. As with the binder-less materials discussed above, in these embodiments the nanowires may be adhered to the suface of the monolith in the absence of a binder due to their unique morphology and packing properties. Monoliths include honeycomb-type structures, foams and other catalytic support structures derivable by one skilled in the art. In one embodiment, the support is a honeycomb matrix formed from silicon carbide, and the support further comprises catalytic nanowires disposed on the surface.
(200) As the OCM reaction is very exothermic, it can be desirable to reduce the rate of conversion per unit volume of reactor in order to avoid run away temperature rise in the catalyst bed that can result in hot spots affecting performance and catalyst life. One way to reduce the OCM reaction rate per unit volume of reactor is to spread the active catalyst onto an inert support with interconnected large pores as in ceramic or metallic foams (including metal alloys having reduced reactivity with hydrocarbons under OCM reaction conditions) or having arrays of channel as in honeycomb structured ceramic or metal assembly.
(201) In one embodiment, a catalytic material comprising a catalytic nanowire as disclosed herein supported on a structured support is provided. Examples of such structure supports include, but are not limited to, metal foams, Silicon Carbide or Alumina foams, corrugated metal foil arranged to form channel arrays, extruded ceramic honeycomb, for example Cordierite (available from Corning or NGK ceramics, USA), Silicon Carbide or Alumina.
(202) Active catalyst loading on the structured support ranges from 1 to 500 mg per ml of support component, for example from 5 to 100 mg per ml of structure support. Cell densities on honeycomb structured support materials may range from 100 to 900 CPSI (cell per square inch), for example 200 to 600 CPSI. Foam densities may range from 10 to 100 PPI (pore per inch), for example 20 to 60 PPI.
(203) In other embodiments, the exotherm of the OCM reaction may be at least partially controlled by blending the active catalytic material with catalytically inert material, and pressing or extruding the mixture into shaped pellets or extrudates. In some embodiments, these mixed particles may then be loaded into a pack-bed reactor. The Extrudates or pellets comprise between 30% to 70% pore volume with 5% to 50% active catalyst weight fraction. Useful inert materials in this regard include, but are not limited to MgO, CaO, Al.sub.2O.sub.3, SiC and cordierite.
(204) In addition to reducing the potential for hot spots within the catalytic reactor, another advantage of using a structured ceramic with large pore volume as a catalytic support is reduced flow resistance at the same gas hourly space velocity versus a pack-bed containing the same amount of catalyst.
(205) Yet another advantage of using such supports is that the structured support can be used to provide features difficult to obtain in a pack-bed reactor. For example the support structure can improve mixing or enabling patterning of the active catalyst depositions through the reactor volume. Such patterning can consist of depositing multiple layers of catalytic materials on the support in addition to the OCM active component in order to affect transport to the catalyst or combining catalytic functions as adding O2-ODH activity, CO2-OCM activity or CO2-ODH activity to the system in addition to O2-OCM active material. Another patterning strategy can be to create bypass within the structure catalyst essentially free of active catalyst to limit the overall conversion within a given supported catalyst volume.
(206) Yet another advantage is reduced heat capacity of the bed of the structured catalyst over a pack bed a similar active catalyst loading therefore reducing startup time.
(207) Nanowire shaped catalysts are particularly well suited for incorporation into pellets or extrudates or deposition onto structured supports. Nanowire aggregates forming a mesh type structure can have good adhesion onto rough surfaces.
(208) The mesh like structure can also provide improved cohesion in composite ceramic improving the mechanical properties of pellets or extrudates containing the nanowire shaped catalyst particles.
(209) Alternatively, such nanowire on support or in pellet form approaches can be used for other reactions besides OCM, such as ODH, dry methane reforming, FT, and all other catalytic reactions.
(210) In yet another embodiment, the catalysts are packed in bands forming a layered reactor bed. Each layer is composed by either a catalyst of a particular type, morphology or size or a particular blend of catalysts. In one embodiment, the catalysts blend may have better sintering properties, i.e. lower tendency to sinter, then a material in its pure form. Better sintering resistance is expected to increase the catalyst's lifetime and improve the mechanical properties of the reactor bed.
(211) In yet other embodiments, the disclosure provides a catalytic material comprising one or more different catalysts. The catalysts may be a nanowire as disclosed herein and a different catalyst for example a bulk catalysts. Mixtures of two or more nanowire catalysts are also contemplated. The catalytic material may comprise a catalyst, for example a nanowire catalyst, having good OCM activity and a catalyst having good activity in the ODH reaction. Either one or both of these catalysts may be nanowires as disclosed herein.
(212) On skilled in the art will recognize that various combinations or alternatives of the above methods are possible, and such variations are also included within the scope of the present disclosure.
5. Dopants
(213) In further embodiments, the disclosure provides nanowires comprising a dopant (i.e., doped nanowires). As noted above, dopants or doping agents are impurities added to or incorporated within a catalyst to optimize catalytic performance (e.g., increase or decrease catalytic activity). As compared to the undoped catalyst, a doped catalyst may increase or decrease the selectivity, conversion, and/or yield of a catalytic reaction. In one embodiment, nanowire dopants comprise one or more metal elements, semi-metal elements, non-metal elements or combinations thereof. Although oxygen is included in the group of nonmetal elements, in certain embodiments oxygen is not considered a dopant. For example, certain embodiments are directed to nanowires comprising two, three or even four or more dopants, and the dopants are non-oxygen dopants. Thus in these embodiments, a metal oxide nanowire is not considered to be a metal nanowire doped with oxygen. Analagously, in the case of mixed oxides (i.e., M1.sub.xM2.sub.yO.sub.z), both the metal elements and oxygen are considered a part of the base catalyst (nanowire) and are not included in the total number of dopants.
(214) The dopant may be present in any form and may be derived from any suitable source of the element (e.g., chlorides, bromides, iodides, nitrates, oxynitrates, oxyhalides, acetates, formates, hydroxides, carbonates, phosphates, sulfates, alkoxides, and the like.). In some embodiments, the nanowire dopant is in elemental form. In other embodiments, the nanowire dopant is in reduced or oxidized form. In other embodiments, the nanowire dopant comprises an oxide, hydroxide, carbonate, nitrate, acetate, sulfate, formate, oxynitrate, halide, oxyhalide or hydroxyhalide of a metal element, semi-metal element or non-metal element or combinations thereof.
(215) In one embodiment, the nanowires comprise one or more metal elements selected from Groups 1-7, lanthanides, actinides or combinations thereof in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 1 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 2 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 3 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 4 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 5 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 6 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from group 7 in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from lanthanides in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof. In another embodiment, the nanowires comprise one or more metal elements selected from actinides in the form of an oxide and further comprise one or more dopants, wherein the one or more dopants comprise metal elements, semi-metal elements, non-metal elements or combinations thereof.
(216) For example, in one embodiment, the nanowire dopant comprises Li, Li.sub.2CO.sub.3, LiOH, Li.sub.2O, LiCl, LiNO.sub.3, Na, Na.sub.2CO.sub.3, NaOH, Na.sub.2O, NaCl, NaNO.sub.3, K, K.sub.2CO.sub.3, KOH, K.sub.2O, KCl, KNO.sub.3, Rb, Rb.sub.2CO.sub.3, RbOH, Rb.sub.2O, RbCl, RbNO.sub.3, Cs, Cs.sub.2CO.sub.3, CsOH, Cs.sub.2O, CsCl, CsNO.sub.3, Mg, MgCO.sub.3, Mg(OH).sub.2, MgO, MgCl.sub.2, Mg(NO.sub.3).sub.2, Ca, CaO, CaCO.sub.3, Ca(OH).sub.2, CaCl.sub.2, Ca(NO.sub.3).sub.2, Sr, SrO, SrCO.sub.3, Sr(OH).sub.2, SrCl.sub.2, Sr(NO.sub.3).sub.2, Ba, BaO, BaCO.sub.3, Ba(OH).sub.2, BaCl.sub.2, Ba(NO.sub.3).sub.2, La, La.sub.2O.sub.3, La.sub.2(CO.sub.3).sub.3, La(OH).sub.3, LaCl.sub.3, La(NO.sub.3).sub.2, Nd, Nd.sub.2O.sub.3, Nd.sub.2(CO.sub.3).sub.3, Nd(OH).sub.3, NdCl.sub.3, Nd(NO.sub.3).sub.2, Sm, Sm.sub.2O.sub.3, Sm.sub.2(CO.sub.3).sub.3, Sm(OH).sub.3, SmCl.sub.3, Sm(NO.sub.3).sub.2, Eu, Eu.sub.2O.sub.3, Eu.sub.2(CO.sub.3).sub.3, Eu(OH).sub.3, EuCl.sub.3, Eu(NO.sub.3).sub.2, Gd, Gd.sub.2O.sub.3, Gd.sub.2(CO.sub.3).sub.3, Gd(OH).sub.3, GdCl.sub.3, Gd(NO.sub.3).sub.2, Ce, Ce(OH).sub.4, CeO.sub.2, Ce.sub.2O.sub.3, Ce(CO.sub.3).sub.2, CeCl.sub.4, Ce(NO.sub.3).sub.2, Th, ThO.sub.2, ThCl.sub.4, Th(OH).sub.4, Zr, ZrO.sub.2, ZrCl.sub.4, Zr(OH).sub.4, ZrOCl.sub.2, Zr(CO.sub.3)2, ZrOCO.sub.3, ZrO(NO.sub.3).sub.2, P, phosphorous oxides, phosphorous chlorides, phosphorous carbonates, Ni, nickel oxides, nickel chlorides, nickel carbonates, nickel hydroxides, Nb, niobium oxides, niobium chlorides, niobium carbonates, niobium hydroxides, Au, gold oxides, gold chlorides, gold carbonates, gold hydroxides, Mo, molybdenum oxides, molybdenum chlorides, molybdenum carbonates, molybdenum hydroxides, tungsten chlorides, tungsten carbonates, tungsten hydroxides, Cr, chromium oxides, chromium chlorides, chromium hydroxides, Mn, manganese oxides, manganese chlorides, manganese hydroxides, Zn, ZnO, ZnCl.sub.2, Zn(OH).sub.2, B, borates, BCl.sub.3, N, nitrogen oxides, nitrates, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, In, Y, Sc, Al, Cu, Cs, Ga, Hf, Fe, Ru, Rh, Be, Co, Sb, V, Ag, Te, Pd, Tb, Ir, Rb or combinations thereof. In other embodiments, the nanowire dopant comprises Li, Na, K, Rb, Cs, Mg, Ca, Sr, Eu, In, Nd, Sm, Ce, Gd, Tb, Er, Tm, Yb, Y, Sc or combinations thereof.
(217) In other embodiments, the nanowire dopant comprises Li, Li.sub.2O, Na, Na.sub.2O, K, K.sub.2O, Mg, MgO, Ca, CaO, Sr, SrO, Ba, BaO, La, La.sub.2O.sub.3, Ce, CeO.sub.2, Ce.sub.2O.sub.3, Th, ThO.sub.2, Zr, ZrO.sub.2, P, phosphorous oxides, Ni, nickel oxides, Nb, niobium oxides, Au, gold oxides, Mo, molybdenum oxides, Cr, chromium oxides, Mn, manganese oxides, Zn, ZnO, B, borates, N, nitrogen oxides or combinations thereof. In other embodiments, the nanowire dopant comprises Li, Na, K, Mg, Ca, Sr, Ba, La, Ce, Th, Zr, P, Ni, Nb, Au, Mo, Cr, Mn, Zn, B, N or combinations thereof. In other embodiments, the nanowire dopant comprises Li.sub.2O, Na.sub.2O, K.sub.2O, MgO, CaO, SrO, BaO, La.sub.2O.sub.3, CeO.sub.2, Ce.sub.2O.sub.3, ThO.sub.2, ZrO.sub.2, phosphorous oxides, nickel oxides, niobium oxides, gold oxides, molybdenum oxides, chromium oxides, manganese oxides, ZnO, borates, nitrogen oxides or combinations thereof. In further embodiments, the dopant comprises Sr or Li. In other specific embodiments, the nanowire dopant comprises La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, In, Y, Sc or combinations thereof. In other specific embodiments, the nanowire dopant comprises Li, Na, K, Mg, Ca, Ba, Sr, Eu, Sm, Co or Mn.
(218) In certain embodiments, the dopant comprises an element from group 1. In some embodiments, the dopant comprises lithium. In some embodiments, the dopant comprises sodium. In some embodiments, the dopant comprises potassium. In some embodiments, the dopant comprises rubidium. In some embodiments, the dopant comprises caesium.
(219) In some embodiments the nanowires comprise a lanthanide element and are doped with a dopant from group 1, group 2, or combinations thereof. For example, in some embodiments, the nanowires comprise a lanthanide element and are doped with lithium. In other embodiments, the nanowires comprise a lanthanide element and are doped with sodium. In other embodiments, the nanowires comprise a lanthanide element and are doped with potassium. In other embodiments, the nanowires comprise a lanthanide element and are doped with rubidium. In other embodiments, the nanowires comprise a lanthanide element and are doped with caesium. In other embodiments, the nanowires comprise a lanthanide element and are doped with beryllium. In other embodiments, the nanowires comprise a lanthanide element and are doped with magnesium. In other embodiments, the nanowires comprise a lanthanide element and are doped with calcium. In other embodiments, the nanowires comprise a lanthanide element and are doped with strontium. In other embodiments, the nanowires comprise a lanthanide element and are doped with barium.
(220) In some embodiments the nanowires comprise a transition metal tungstate (e.g., Mn/W and the like) and are doped with a dopant from group 1, group 2, or combinations thereof. For example, in some embodiments, the nanowires comprise a transition metal tungstate and are doped with lithium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with sodium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with potassium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with rubidium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with caesium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with beryllium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with magnesium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with calcium. In other embodiments, the nanowires comprise a transition metal tungstate and are doped with strontium. In other embodiments, the nanowires comprises a transition metal tungstate and are doped with barium.
(221) In some embodiments the nanowires comprise Mn/Mg/O and are doped with a dopant from group 1, group 2, group 7, group 8, group 9 or group 10 or combinations thereof. For example, in some embodiments, the nanowires comprise Mn/Mg/O and are doped with lithium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with sodium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with potassium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with rubidium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with caesium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with beryllium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with magnesium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with calcium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with strontium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with barium.
(222) In yet some other embodiments, the nanowires comprise Mn/Mg/O and are doped with manganese. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with technetium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with rhenium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with iron. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with ruthenium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with osmium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with cobalt. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with rhodium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with iridium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with nickel. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with palladium. In other embodiments, the nanowires comprise Mn/Mg/O and are doped with platinum.
(223) As noted above, the present inventors have determined that certain nanowire catalysts comprising rare earth elements(e.g., rare earth oxides) are useful as catalysts in a number of reactions, for example the OCM reaction. In cetain embodiments the rare earth element is La, Nd, Eu, Sm, Yb, Gd or Y. In some embodiments, the rare earth element is La. In other embodiments, the rare earth element is Nd. In other embodiments, the rare earth element is Eu. In other embodiments, the rare earth element is Sm. In other embodiments, the rare earth element is Yb. In other embodiments, the rare earth element is Gd. In other embodiments, the rare earth element is Y.
(224) In certain embodiments of the nanowire catalysts comprising rare earth elements, the catalyst may further comprise a dopant selected from alkaline earth (Group 2) elements. For example, in some embodiments the dopant is selected from Be, Mg, Ca, Sr and Ba. In other embodiments, the dopant is Be. In other embodiments, the dopant is Ca. In other embodiments, the dopant is Sr. In other embodiments, the dopant is Ba.
(225) In some embodiments, these rare earth compositions comprise La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3, Pr.sub.2O.sub.3, Ln1.sub.4-xLn2.sub.xO.sub.6, La.sub.4-xLn1.sub.xO.sub.6, La.sub.4-xNd.sub.xO.sub.6, La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, Y—La, Zr—La, Pr—La or Ce—La or combinations thereof, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4.
(226) Further, Applicants have discovered that certain doping combinations, when combined with the above rare earth compositions, serve to enhance the catalytic activity of the nanowires in certain catalytic reactions, for example OCM. The dopants may be present in various levels (e.g., w/w), and the nanowires may be prepared by any number of methods. Various aspects of the above nanowires are provided in the following paragraphs and in Tables 9-12.
(227) In certain embodiments, the above rare earth compositions comprise a strontium dopant and at least one more additional dopant selected from group 1, 4-6, 13 and lanthanides. For example, in some embodiments the additional dopant is Hf, K, Zr, Ce, Tb, Pr, W, Rb, Ta, B or combinations thereof. In other embodiments, the dopant comprises Sr/Hf, Sr/Hf/K, Sr/Zr, Sr/Zr/K, Sr/Ce, Sr/Ce/K, Sr/Tb, Sr/Tb/K, Sr/Pr, Sr/Pr/K, Sr/W, Sr/Hf/Rb, Sr/Ta or Sr/B. In some other embodiments, the foregoing rare earth nanowires comprise La.sub.2O.sub.3 or La.sub.3NdO.sub.6.
(228) In other embodiments, the nanowire catalysts comprise a rare earth oxide and dopants selected from at least one of the following combinations Eu/Na, Sr/Na, Mg/Na, Sr/W, K/La, K/Na, Li/Cs, Li/Na, Zn/K, Li/K, Rb/Hf, Ca/Cs, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr, W/Ge, Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Zr/Cs, Ca/Ce, Li/Sr, Cs/Zn, Dy/K, La/Mg, In/Sr, Sr/Cs, Ga/Cs, Lu/Fe, Sr/Tm, La/Dy, Mg/K, Zr/K, Li/Cs, Sm/Cs, In/K, Lu/TI, Pr/Zn, Lu/Nb, Na/Pt, Na/Ce, Ba/Ta, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Ca/Sr, Sr/Pb and Sr/Hf.
(229) In still other embodiments, the nanowire catalysts comprise a rare earth oxide and dopants selected from at least one of the following combinations La/Nd, La/Sm, La/Ce, La/Sr, Eu/Na, Eu/Gd, Ca/Na, Eu/Sm, Eu/Sr, Mg/Sr, Ce/Mg, Gd/Sm, Sr/W, Sr/Ta, Au/Re, Au/Pb, Bi/Hf, Sr/Sn or Mg/N, Ca/S, Rb/S, Sr/Nd, Eu/Y, Mg/Nd, Sr/Na, Nd/Mg, La/Mg, Yb/S, Mg/Na, Sr/W, K/La, K/Na, Li/Cs, Li/Na, Zn/K, Li/K, Rb/Hf, Ca/Cs, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr, W/Ge, Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Zr/Cs, Ca/Ce, Li/Sr, Cs/Zn, Dy/K, La/Mg, In/Sr, Sr/Cs, Ga/Cs, Lu/Fe, Sr/Tm, La/Dy, Mg/K, Zr/K, Li/Cs, Sm/Cs, In/K, Lu/TI, Pr/Zn, Lu/Nb, Na/Pt, Na/Ce, Ba/Ta, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Ca/Sr, Sr/Pb and Sr/Hf.
(230) In other embodiments of the foregoing rare earth oxide nanowire catalysts, the nanowire catalysts comprise a combination of two doping elements. In some embodiments, the combination of two doping elements is La/Nd. In other embodiments, the combination of two doping elements is La/Sm. In other embodiments, the combination of two doping elements is La/Ce. In other embodiments, the combination of two doping elements is La/Sr. In other embodiments, the combination of two doping elements is Eu/Na. In other embodiments, the combination of two doping elements is Eu/Gd. In other embodiments, the combination of two doping elements is Ca/Na. In other embodiments, the combination of two doping elements is Eu/Sm. In other embodiments, the combination of two doping elements is Eu/Sr. In other embodiments, the combination of two doping elements is Mg/Sr. In other embodiments, the combination of two doping elements is Ce/Mg. In other embodiments, the combination of two doping elements is Gd/Sm. In other embodiments, the combination of two doping elements is Sr/W. In other embodiments, the combination of two doping elements is Sr/Ta. In other embodiments, the combination of two doping elements is Au/Re. In other embodiments, the combination of two doping elements is Au/Pb. In other embodiments, the combination of two doping elements is Bi/Hf. In other embodiments, the combination of two doping elements is Sr/Sn. In other embodiments, the combination of two doping elements is Mg/N. In other embodiments, the combination of two doping elements is Ca/S. In other embodiments, the combination of two doping elements is Rb/S. In other embodiments, the combination of two doping elements is Sr/Nd. In other embodiments, the combination of two doping elements is Eu/Y. In other embodiments, the combination of two doping elements is Mg/Nd. In other embodiments, the combination of two doping elements is Sr/Na. In other embodiments, the combination of two doping elements is Nd/Mg. In other embodiments, the combination of two doping elements is La/Mg. In other embodiments, the combination of two doping elements is Yb/S. In other embodiments, the combination of two doping elements is Mg/Na. In other embodiments, the combination of two doping elements is Sr/W. In other embodiments, the combination of two doping elements is K/La. In other embodiments, the combination of two doping elements is K/Na. In other embodiments, the combination of two doping elements is Li/Cs. In other embodiments, the combination of two doping elements is Li/Na. In other embodiments, the combination of two doping elements is Zn/K. In other embodiments, the combination of two doping elements is Li/K. In other embodiments, the combination of two doping elements is Rb/Hf. In other embodiments, the combination of two doping elements is Ca/Cs. In other embodiments, the combination of two doping elements is Hf/Bi. In other embodiments, the combination of two doping elements is Sr/Sn. In other embodiments, the combination of two doping elements is Sr/W. In other embodiments, the combination of two doping elements is Sr/Nb. In other embodiments, the combination of two doping elements is Zr/W. In other embodiments, the combination of two doping elements is Y/W. In other embodiments, the combination of two doping elements is Na/W. In other embodiments, the combination of two doping elements is Bi/W. In other embodiments, the combination of two doping elements is Bi/Cs. In other embodiments, the combination of two doping elements is Bi/Ca. In other embodiments, the combination of two doping elements is Bi/Sn. In other embodiments, the combination of two doping elements is Bi/Sb. In other embodiments, the combination of two doping elements is Ge/Hf. In other embodiments, the combination of two doping elements is Hf/Sm. In other embodiments, the combination of two doping elements is Sb/Ag. In other embodiments, the combination of two doping elements is Sb/Bi. In other embodiments, the combination of two doping elements is Sb/Au. In other embodiments, the combination of two doping elements is Sb/Sm. In other embodiments, the combination of two doping elements is Sb/Sr. In other embodiments, the combination of two doping elements is Sb/W. In other embodiments, the combination of two doping elements is Sb/Hf. In other embodiments, the combination of two doping elements is Sb/Yb. In other embodiments, the combination of two doping elements is Sb/Sn. In other embodiments, the combination of two doping elements is Yb/Au. In other embodiments, the combination of two doping elements is Yb/Ta. In other embodiments, the combination of two doping elements is Yb/W. In other embodiments, the combination of two doping elements is Yb/Sr. In other embodiments, the combination of two doping elements is Yb/Pb. In other embodiments, the combination of two doping elements is Yb/W. In other embodiments, the combination of two doping elements is Yb/Ag. In other embodiments, the combination of two doping elements is Au/Sr. In other embodiments, the combination of two doping elements is W/Ge. In other embodiments, the combination of two doping elements is Ta/Hf. In other embodiments, the combination of two doping elements is W/Au. In other embodiments, the combination of two doping elements is Ca/W. In other embodiments, the combination of two doping elements is Au/Re. In other embodiments, the combination of two doping elements is Sm/Li. In other embodiments, the combination of two doping elements is La/K. In other embodiments, the combination of two doping elements is Zn/Cs. In other embodiments, the combination of two doping elements is Zr/Cs. In other embodiments, the combination of two doping elements is Ca/Ce. In other embodiments, the combination of two doping elements is Li/Sr. In other embodiments, the combination of two doping elements is Cs/Zn. In other embodiments, the combination of two doping elements is Dy/K. In other embodiments, the combination of two doping elements is La/Mg. In other embodiments, the combination of two doping elements is In/Sr. In other embodiments, the combination of two doping elements is Sr/Cs. In other embodiments, the combination of two doping elements is Ga/Cs. In other embodiments, the combination of two doping elements is Lu/Fe. In other embodiments, the combination of two doping elements is Sr/Tm. In other embodiments, the combination of two doping elements is La/Dy. In other embodiments, the combination of two doping elements is Mg/K. In other embodiments, the combination of two doping elements is Zr/K. In other embodiments, the combination of two doping elements is Li/Cs. In other embodiments, the combination of two doping elements is Sm/Cs. In other embodiments, the combination of two doping elements is In/K. In other embodiments, the combination of two doping elements is Lu/TI. In other embodiments, the combination of two doping elements is Pr/Zn. In other embodiments, the combination of two doping elements is Lu/Nb. In other embodiments, the combination of two doping elements is Na/Pt. In other embodiments, the combination of two doping elements is Na/Ce. In other embodiments, the combination of two doping elements is Ba/Ta. In other embodiments, the combination of two doping elements is Cu/Sn. In other embodiments, the combination of two doping elements is Ag/Au. In other embodiments, the combination of two doping elements is Al/Bi. In other embodiments, the combination of two doping elements is Al/Mo. In other embodiments, the combination of two doping elements is Al/Nb. In other embodiments, the combination of two doping elements is Au/Pt. In other embodiments, the combination of two doping elements is Ga/Bi. In other embodiments, the combination of two doping elements is Mg/W. In other embodiments, the combination of two doping elements is Pb/Au. In other embodiments, the combination of two doping elements is Sn/Mg. In other embodiments, the combination of two doping elements is Zn/Bi. In other embodiments, the combination of two doping elements is Gd/Ho. In other embodiments, the combination of two doping elements is Zr/Bi. In other embodiments, the combination of two doping elements is Ho/Sr. In other embodiments, the combination of two doping elements is Ca/Sr. In other embodiments, the combination of two doping elements is Sr/Pb. In other embodiments, the combination of two doping elements is Sr/Hf.
(231) In still other embodiments, the nanowire catalysts comprise a rare earth oxide and dopants selected from at least one of the following combinations Mg/La/K, Na/Dy/K, Na/La/Dy, Na/La/Eu, Na/La/K, K/La/S, Li/Cs/La, Li/Sr/Cs, Li/Ga/Cs, Li/Na/Sr, Li/Sm/Cs, Cs/K/La, Sr/Cs/La, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Rb/Sr/Lu, Na/Eu/Hf, Dy/Rb/Gd, Na/Pt/Bi, Ca/Mg/Na, Na/K/Mg, Na/Li/Cs, La/Dy/K, Sm/Li/Sr, Li/Rb/Ga, Li/Cs/Tm, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Cs/La/Na, La/S/Sr, Rb/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, La/Dy/Gd, Gd/Li/K, Rb/K/Lu, Na/Ce/Co, Ba/Rh/Ta, Na/Al/Bi, Cs/Eu/S, Sm/Tm/Yb, Hf/Zr/Ta, Na/Ca/Lu, Gd/Ho/Sr, Ca/Sr/W, Na/Zr/Eu/Tm, Sr/W/Li, Ca/Sr/W or Mg/Nd/Fe.
(232) In more embodiments, the nanowire catalysts comprise a rare earth oxide and dopants selected from at least one of the following combinations Nd/Sr/CaO, La/Nd/Sr, La/Bi/Sr, Mg/Nd/Fe, Mg/La/K, Na/Dy/K, Na/La/Dy, Na/La/Eu, Na/La/K, K/La/S, Li/Cs/La, Li/Sr/Cs, Li/Ga/Cs, Li/Na/Sr, Li/Sm/Cs, Cs/K/La, Sr/Cs/La, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Rb/Sr/Lu, Na/Eu/Hf, Dy/Rb/Gd, Na/Pt/Bi, Ca/Mg/Na, Na/K/Mg, Na/Li/Cs, La/Dy/K, Sm/Li/Sr, Li/Rb/Ga, Li/Cs/Tm, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Cs/La/Na, La/S/Sr, Rb/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, La/Dy/Gd, Gd/Li/K, Rb/K/Lu, Na/Ce/Co, Ba/Rh/Ta, Na/Al/Bi, Cs/Eu/S, Sm/Tm/Yb, Hf/Zr/Ta, Na/Ca/Lu, Gd/Ho/Sr, Ca/Sr/W, Na/Zr/Eu/Tm, Sr/W/Li or Ca/Sr/W.
(233) In other embodiments of the foregoing rare earth oxide nanowire catalysts, the nanowire catalysts comprise a combination of at least three doping elements. In some embodiments, the combination of at least three different doping elements is Nd/Sr/CaO. In other embodiments, the combination of at least three different doping elements is La/Nd/Sr. In other embodiments, the combination of at least three different doping elements is La/Bi/Sr. In other embodiments, the combination of at least three different doping elements is Mg/Nd/Fe. In other embodiments, the combination of at least three different doping elements is Mg/La/K. In other embodiments, the combination of at least three different doping elements is Na/Dy/K. In other embodiments, the combination of at least three different doping elements is Na/La/Dy. In other embodiments, the combination of at least three different doping elements is Na/La/Eu. In other embodiments, the combination of at least three different doping elements is Na/La/K. In other embodiments, the combination of at least three different doping elements is K/La/S. In other embodiments, the combination of at least three different doping elements is Li/Cs/La. In other embodiments, the combination of at least three different doping elements is Li/Sr/Cs. In other embodiments, the combination of at least three different doping elements is Li/Ga/Cs. In other embodiments, the combination of at least three different doping elements is Li/Na/Sr. In other embodiments, the combination of at least three different doping elements is Li/Sm/Cs. In other embodiments, the combination of at least three different doping elements is Cs/K/La. In other embodiments, the combination of at least three different doping elements is Sr/Cs/La. In other embodiments, the combination of at least three different doping elements is Sr/Ho/Tm. In other embodiments, the combination of at least three different doping elements is La/Nd/S. In other embodiments, the combination of at least three different doping elements is Li/Rb/Ca. In other embodiments, the combination of at least three different doping elements is Rb/Sr/Lu. In other embodiments, the combination of at least three different doping elements is Na/Eu/Hf. In other embodiments, the combination of at least three different doping elements is Dy/Rb/Gd. In other embodiments, the combination of at least three different doping elements is Na/Pt/Bi. In other embodiments, the combination of at least three different doping elements is Ca/Mg/Na. In other embodiments, the combination of at least three different doping elements is Na/K/Mg. In other embodiments, the combination of at least three different doping elements is Na/Li/Cs. In other embodiments, the combination of at least three different doping elements is La/Dy/K. In other embodiments, the combination of at least three different doping elements is Sm/Li/Sr. In other embodiments, the combination of at least three different doping elements is Li/Rb/Ga. In other embodiments, the combination of at least three different doping elements is Li/Cs/Tm. In other embodiments, the combination of at least three different doping elements is Li/K/La. In other embodiments, the combination of at least three different doping elements is Ce/Zr/La. In other embodiments, the combination of at least three different doping elements is Ca/Al/La. In other embodiments, the combination of at least three different doping elements is Sr/Zn/La. In other embodiments, the combination of at least three different doping elements is Cs/La/Na. In other embodiments, the combination of at least three different doping elements is La/S/Sr. In other embodiments, the combination of at least three different doping elements is Rb/Sr/La. In other embodiments, the combination of at least three different doping elements is Na/Sr/Lu. In other embodiments, the combination of at least three different doping elements is Sr/Eu/Dy. In other embodiments, the combination of at least three different doping elements is La/Dy/Gd. In other embodiments, the combination of at least three different doping elements is Gd/Li/K. In other embodiments, the combination of at least three different doping elements is Rb/K/Lu. In other embodiments, the combination of at least three different doping elements is Na/Ce/Co. In other embodiments, the combination of at least three different doping elements is Ba/Rh/Ta. In other embodiments, the combination of at least three different doping elements is Na/Al/Bi. In other embodiments, the combination of at least three different doping elements is Cs/Eu/S. In other embodiments, the combination of at least three different doping elements is Sm/Tm/Yb. In other embodiments, the combination of at least three different doping elements is Hf/Zr/Ta. In other embodiments, the combination of at least three different doping elements is Na/Ca/Lu. In other embodiments, the combination of at least three different doping elements is Gd/Ho/Sr. In other embodiments, the combination of at least three different doping elements is Ca/Sr/W. In other embodiments, the combination of at least three different doping elements is Na/Zr/Eu/Tm. In other embodiments, the combination of at least three different doping elements is Sr/W/Li. In other embodiments, the combination of at least three different doping elements is Ca/Sr/W.
(234) As noted above, certain doping combinations have been found useful in various catalytic reactions, such as OCM. Thus, in one embodiment, the catalytic nanowire comprises a combination of at least four different doping elements, wherein the doping elements are selected from a metal element, a semi-metal element and a non-metal element. For example in certain embodiments the catalytic nanowire comprises a metal oxide, and in other embodiments the catalytic nanowire comprises a lanthanide metal. Still other embodiments provide a catalytic nanowire comprising La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3, Pr.sub.2O.sub.3 or combinations thereof. In still other embodiments, the doping elements do not include at least one of Li, B, Na, Co or Ga, and in other embodiments the nanowires do not comprise Mg and/or Mn.
(235) In other embodiments, the catalytic nanowire comprises a lanthanide oxide, for example a lanthanide mixed oxide, for example in some embodiments the catalytic nanowire comprises Ln1.sub.4-xLn2.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4. In other embodiments, the catalytic nanowire comprises La.sub.4-xNd.sub.xO.sub.6, wherein x is a number ranging from greater than 0 to less than 4, and in still other embodiments, the catalytic nanowire comprises La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6 or combinations thereof. In certain other embodiments the mixed oxide comprises Y—La, Zr—La, Pr—La, Ce—La or combinations thereof.
(236) In other embodiments, the doping elements are selected from Eu, Na, Sr, Ca, Mg, Sm, Ho, Tm, W, La, K, Dy, In, Li, Cs, S, Zn, Ga, Rb, Ba, Yb, Ni, Lu, Ta, P, Hf, Tb, Gd, Pt, Bi, Sn, Nb, Sb, Ge, Ag, Au, Pb, B, Re, Fe, Al, Zr, TI, Pr, Co, Ce, Rh, and Mo. For example, in some embodiments, the combination of at least four different doping elements is: Na/Zr/Eu/Ca, Sr/Sm/Ho/Tm, Na/K/Mg/Tm, Na/La/Eu/In, Na/La/Li/Cs, Li/Cs/La/Tm, Li/Cs/Sr/Tm, Li/Sr/Cs, Li/Sr/Zn/K, Li/K/Sr/La, Li/Na/Rb/Ga, Li/Na/Sr/La, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Tm/Li/Cs, Zr/Cs/K/La, Rb/Ca/In/Ni, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Na/Sr/Lu/Nb, Na/Nd/In/K, Rb/Ga/Tm/Cs, K/La/Zr/Ag, Ho/Cs/Li/La, K/La/Zr/Ag, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Mg/TI/P, Sr/La/Dy/S, Na/Ga/Gd/Al, Sm/Tm/Yb/Fe, Rb/Gd/Li/K, Gd/Ho/Al/P, Na/Zr/Eu/Tm Sr/Ho/Tm/Na or Rb/Ga/Tm/Cs or La/Bi/Ce/Nd/Sr.
(237) In other embodiments, the combination of at least four different doping elements is Sr/Sm/Ho/Tm. In other embodiments, the combination of at least four different doping elements is Na/K/Mg/Tm. In other embodiments, the combination of at least four different doping elements is Na/La/Eu/In. In other embodiments, the combination of at least four different doping elements is Na/La/Li/Cs. In other embodiments, the combination of at least four different doping elements is Li/Cs/La/Tm. In other embodiments, the combination of at least four different doping elements is Li/Cs/Sr/Tm. In other embodiments, the combination of at least four different doping elements is Li/Sr/Zn/K. In other embodiments, the combination of at least four different doping elements is Li/Ga/Cs. In other embodiments, the combination of at least four different doping elements is Li/K/Sr/La. In other embodiments, the combination of at least four different doping elements is Li/Na/Rb/Ga. In other embodiments, the combination of at least four different doping elements is Li/Na/Sr/La. In other embodiments, the combination of at least four different doping elements is Ba/Sm/Yb/S. In other embodiments, the combination of at least four different doping elements is Ba/Tm/K/La. In other embodiments, the combination of at least four different doping elements is Ba/Tm/Zn/K. In other embodiments, the combination of at least four different doping elements is Cs/La/Tm/Na. In other embodiments, the combination of at least four different doping elements is Cs/Li/K/La. In other embodiments, the combination of at least four different doping elements is Sm/Li/Sr/Cs. In other embodiments, the combination of at least four different doping elements is Sr/Tm/Li/Cs. In other embodiments, the combination of at least four different doping elements is Zr/Cs/K/La. In other embodiments, the combination of at least four different doping elements is Rb/Ca/In/Ni. In other embodiments, the combination of at least four different doping elements is Tm/Lu/Ta/P. In other embodiments, the combination of at least four different doping elements is Rb/Ca/Dy/P. In other embodiments, the combination of at least four different doping elements is Mg/La/Yb/Zn. In other embodiments, the combination of at least four different doping elements is Na/Sr/Lu/Nb. In other embodiments, the combination of at least four different doping elements is Na/Nd/In/K. In other embodiments, the combination of at least four different doping elements is K/La/Zr/Ag. In other embodiments, the combination of at least four different doping elements is Ho/Cs/Li/La. In other embodiments, the combination of at least four different doping elements is K/La/Zr/Ag. In other embodiments, the combination of at least four different doping elements is Na/Sr/Eu/Ca. In other embodiments, the combination of at least four different doping elements is K/Cs/Sr/La. In other embodiments, the combination of at least four different doping elements is Na/Mg/TI/P. In other embodiments, the combination of at least four different doping elements is Sr/La/Dy/S. In other embodiments, the combination of at least four different doping elements is Na/Ga/Gd/Al. In other embodiments, the combination of at least four different doping elements is Sm/Tm/Yb/Fe. In other embodiments, the combination of at least four different doping elements is Rb/Gd/Li/K. In other embodiments, the combination of at least four different doping elements is Gd/Ho/Al/P. In other embodiments, the combination of at least four different doping elements is Na/Zr/Eu/T. In other embodiments, the combination of at least four different doping elements is Sr/Ho/Tm/Na. In other embodiments, the combination of at least four different doping elements is Na/Zr/Eu/Ca. In other embodiments, the combination of at least four different doping elements is Rb/Ga/Tm/Cs. In other embodiments, the combination of at least four different doping elements is La/Bi/Ce/Nd/Sr.
(238) In other embodiments, the catalytic nanowire comprises at least two different doping elements, wherein the doping elements are selected from a metal element, a semi-metal element and a non-metal element, and wherein at least one of the doping elements is K, Sc, Ti, V, Nb, Ru, Os, Ir, Cd, In, TI, S, Se, Po, Pr, Tb, Dy, Ho, Er, Tm, Lu or an element selected from any of groups 6, 7, 10, 11, 14, 15 or 17. In some embodiments, at least one of the doping elements is K, Ti, V, Nb, Ru, Os, Ir, Cd, In, TI, S, Se, Po, Pr, Tb, Dy, Ho, Er, Tm, Lu or an element selected from any of groups 10, 11, 14, 15 or 17. In certain other embodiments of the foregoing catalytic nanowire, the catalytic nanowire comprises a metal oxide, and in other embodiments the catalytic nanowire comprises a lanthanide metal. In still other embodiments the catalytic nanowire comprises La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3, Pr.sub.2O.sub.3 or combinations thereof.
(239) In other embodiments of the foregoing catalytic nanowire, the catalytic nanowire comprises a lanthanide oxide, for example a lanthanide mixed oxide, for example in some embodiments the catalytic nanowire comprises Ln1.sub.4-xLn2.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4. In other embodiments, the catalytic nanowire comprises La.sub.4-xNd.sub.xO.sub.6, wherein x is a number ranging from greater than 0 to less than 4, and in still other embodiments, the catalytic nanowire comprises La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6 or combinations thereof. In certain other embodiments the mixed oxide comprises Y—La, Zr—La, Pr—La, Ce—La or combinations thereof.
(240) In other embodiments of the nanowire comprising at least two doping elements, the doping elements are selected from Eu, Na, Sr, Ca, Mg, Sm, Ho, Tm, W, La, K, Dy, In, Li, Cs, S, Zn, Ga, Rb, Ba, Yb, Ni, Lu, Ta, P, Hf, Tb, Gd, Pt, Bi, Sn, Nb, Sb, Ge, Ag, Au, Pb, B, Re, Fe, Al, Zr, TI, Pr, Co, Ce, Rh, and Mo.
(241) In yet another aspect, the present disclosure provides a catalytic nanowire comprising at least one of the following dopant combinations: Eu/Na, Sr/Na, Na/Zr/Eu/Ca, Mg/Na, Sr/Sm/Ho/Tm, Sr/W, Mg/La/K, Na/K/Mg/Tm, Na/Dy/K, Na/La/Dy, Sr/Hf/K, Na/La/Eu, Na/La/Eu/In, Na/La/K, Na/La/Li/Cs, K/La, K/La/S, K/Na, Li/Cs, Li/Cs/La, Li/Cs/La/Tm, Li/Cs/Sr/Tm, Li/Sr/Cs, Li/Sr/Zn/K, Li/Ga/Cs, Li/K/Sr/La, Li/Na, Li/Na/Rb/Ga, Li/Na/Sr, Li/Na/Sr/La, Sr/Zr, Li/Sm/Cs, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Sr/Zr/K, Cs/K/La, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Cs/La, Sr/Tm/Li/Cs, Zn/K, Zr/Cs/K/La, Rb/Ca/In/Ni, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Li/K, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Rb/Sr/Lu, Na/Sr/Lu/Nb, Na/Eu/Hf, Dy/Rb/Gd, Sr/Ce, Na/Pt/Bi, Rb/Hf, Ca/Cs, Ca/Mg/Na, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Sr/Ce/K, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr, W/Ge, Sr/Tb, Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Na/K/Mg, Zr/Cs, Ca/Ce, Na/Li/Cs, Li/Sr, Cs/Zn, La/Dy/K, Dy/K, La/Mg, Na/Nd/In/K, In/Sr, Sr/Cs, Rb/Ga/Tm/Cs, Ga/Cs, K/La/Zr/Ag, Lu/Fe, Sr/Tb/K, Sr/Tm, La/Dy, Sm/Li/Sr, Mg/K, Sr/Pr, Li/Rb/Ga, Li/Cs/Tm, Zr/K, Li/Cs, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Sr/Cs/Zn, Sm/Cs, In/K, Ho/Cs/Li/La, Sr/Pr/K, Cs/La/Na, La/S/Sr, K/La/Zr/Ag, Lu/TI, Pr/Zn, Rb/Sr/La, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, Lu/Nb, La/Dy/Gd, Na/Mg/TI/P, Na/Pt, Gd/Li/K, Rb/K/Lu, Sr/La/Dy/S, Na/Ce/Co, Na/Ce, Na/Ga/Gd/Al, Ba/Rh/Ta, Ba/Ta, Na/Al/Bi, Sr/Hf/Rb, Cs/Eu/S, Sm/Tm/Yb/Fe, Sm/Tm/Yb, Hf/Zr/Ta, Rb/Gd/Li/K, Gd/Ho/Al/P, Na/Ca/Lu, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Sr/B, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Gd/Ho/Sr, Ca/Sr, Ca/Sr/W, Sr/Ho/Tm/Na, Na/Zr/Eu/Tm, Sr/Ho/Tm/Na, Sr/Pb, Sr/W/Li, Ca/Sr/W or Sr/Hf.
(242) In other embodiments of the foregoing catalytic nanowire, the dopant is selected from Cs/Eu/S, Sm/Tm/Yb/Fe, Sm/Tm/Yb, Hf/Zr/Ta, Rb/Gd/Li/K, Gd/Ho/Al/P, Na/Ca/Lu, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Gd/Ho/Sr, Ca/Sr, Ca/Sr/W, Na/Zr/Eu/Tm, Sr/Ho/Tm/Na, Sr/Pb, Ca, Sr/W/Li, Ca/Sr/W, Sr/Hf, Eu/Na, Sr/Na, Na/Zr/Eu/Ca, Mg/Na, Sr/Sm/Ho/Tm, Sr/W, Mg/La/K, Na/K/Mg/Tm, Na/Dy/K, Na/La/Dy, Na/La/Eu, Na/La/Eu/In, Na/La/K, Na/La/Li/Cs, K/La, K/La/S, K/Na, Li/Cs, Li/Cs/La, Li/Cs/La/Tm, Li/Cs/Sr/Tm, Li/Sr/Cs, Li/Sr/Zn/K, Li/Ga/Cs, Li/K/Sr/La, Li/Na, Li/Na/Rb/Ga and Li/Na/Sr.
(243) In still other embodiments of the foregoing catalytic nanowire the dopant is selected from Li/Na/Sr/La, Li/Sm/Cs, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Cs/K/La, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Cs/La, Sr/Tm/Li/Cs, Zn/K, Zr/Cs/K/La, Rb/Ca/In/Ni, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Li/K, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Rb/Sr/Lu, Na/Sr/Lu/Nb, Na/Eu/Hf, Dy/Rb/Gd, Na/Pt/Bi, Rb/Hf, Ga/Cs, K/La/Zr/Ag, Lu/Fe, Sr/Tm, La/Dy, Sm/Li/Sr, Mg/K, Li/Rb/Ga, Li/Cs/Tm, Zr/K, Li/Cs, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Sr/Cs/Zn, Sm/Cs, In/K, Ho/Cs/Li/La, Cs/La/Na, La/S/Sr, K/La/Zr/Ag, Lu/TI, Pr/Zn, Rb/Sr/La, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, Lu/Nb, La/Dy/Gd, Na/Mg/TI/P, Na/Pt, Gd/Li/K, Rb/K/Lu, Sr/La/Dy/S, Na/Ce/Co, Na/Ce, Na/Ga/Gd/Al, Ba/Rh/Ta, Ba/Ta, Na/Al/Bi, Cs/Eu/S, Sm/Tm/Yb/Fe, Sm/Tm/Yb, Hf/Zr/Ta, Rb/Gd/Li/K, Gd/Ho/Al/P and Na/Ca/Lu.
(244) In still other embodiments of the foregoing catalytic nanowire, the dopant is selected from Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Na/K/Mg, Zr/Cs, Ca/Ce, Na/Li/Cs, Li/Sr, Cs/Zn, La/Dy/K, Dy/K, La/Mg, Na/Nd/In/K, In/Sr, Sr/Cs, Rb/Ga/Tm/Cs, Ga/Cs, K/La/Zr/Ag, Lu/Fe, Sr/Tm, La/Dy, Sm/Li/Sr, Mg/K, Li/Rb/Ga, Li/Cs/Tm, Zr/K, Li/Cs, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Sr/Cs/Zn, Sm/Cs, In/K, Ho/Cs/Li/La, Cs/La/Na, La/S/Sr, K/La/Zr/Ag, Lu/TI, Pr/Zn, Rb/Sr/La, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, Lu/Nb, La/Dy/Gd, Na/Mg/TI/P, Na/Pt, Gd/Li/K, Li/Sr/Cs, Li/Sr/Zn/K, Li/Ga/Cs, Li/K/Sr/La, Li/Na, Li/Na/Rb/Ga, Li/Na/Sr, Li/Na/Sr/La, Li/Sm/Cs, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Cs/K/La, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Cs/La, Sr/Tm/Li/Cs, Zn/K, Zr/Cs/K/La, Rb/Ca/In/Ni, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Li/K, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Rb/Sr/Lu, Na/Sr/Lu/Nb, Na/Eu/Hf, Dy/Rb/Gd, Na/Pt/Bi, Rb/Hf, Ca/Cs, Ca/Mg/Na, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr and W/Ge.
(245) For example in certain embodiments of the foregoing catalytic nanowire, the catalytic nanowire comprises a metal oxide, and in other embodiments the catalytic nanowire comprises a lanthanide metal. In still other embodiments, the catalytic nanowire comprises La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3, Pr.sub.2O.sub.3 or combinations thereof.
(246) In other embodiments of the foregoing nanowire, the catalytic nanowire comprises a lanthanide oxide, for example a lanthanide mixed oxide, for example in some embodiments the catalytic nanowire comprises Ln1.sub.4-xLn2.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4. In other embodiments, the catalytic nanowire comprises La.sub.4-xNd.sub.xO.sub.6, wherein x is a number ranging from greater than 0 to less than 4, and in still other embodiments, the catalytic nanowire comprises La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6 or combinations thereof. In certain other embodiments the mixed oxide comprises Y—La, Zr—La, Pr—La, Ce—La or combinations thereof.
(247) In still other embodiments, the disclosure provides a catalytic nanowire comprising Ln1.sub.4-xLn2.sub.xO.sub.6 and a dopant comprising a metal element, a semi-metal element, a non-metal element or combinations thereof, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4. For example, in certain embodiments the catalytic nanowire comprises La.sub.4-xLn1.sub.xO.sub.6, wherein Ln1 is a lanthanide element and x is a number ranging from greater than 0 to less than 4, and in other specific embodiments, the catalytic nanowire comprises La.sub.4-xNd.sub.xO.sub.6, wherein x is a number ranging from greater than 0 to less than 4.
(248) Still further embodiments of the foregoing nanowire include embodiments wherein the catalytic nanowire comprises comprises La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6 or combinations thereof.
(249) In other embodiments, the dopant is selected from: Eu, Na, Sr, Ca, Mg, Sm, Ho, Tm, W, La, K, Dy, In, Li, Cs, S, Zn, Ga, Rb, Ba, Yb, Ni, Lu, Ta, P, Hf, Tb, Gd, Pt, Bi, Sn, Nb, Sb, Ge, Ag, Au, Pb, B, Re, Fe, Al, Zr, TI, Pr, Co, Ce, Rh, and Mo. For example in certain embodiments, the catalytic nanowire comprises at least one of the following dopant combinations: Eu/Na, Sr/Na, Na/Zr/Eu/Ca, Mg/Na, Sr/Sm/Ho/Tm, Sr/W, Mg/La/K, Na/K/Mg/Tm, Na/Dy/K, Na/La/Dy, Sr/Hf/K, Na/La/Eu, Na/La/Eu/In, Na/La/K, Na/La/Li/Cs, K/La, K/La/S, K/Na, Li/Cs, Li/Cs/La, Li/Cs/La/Tm, Li/Cs/Sr/Tm, Li/Sr/Cs, Li/Sr/Zn/K, Li/Ga/Cs, Li/K/Sr/La, Li/Na, Li/Na/Rb/Ga, Li/Na/Sr, Li/Na/Sr/La, Sr/Zr, Li/Sm/Cs, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Sr/Zr/K, Cs/K/La, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Cs/La, Sr/Tm/Li/Cs, Zn/K, Zr/Cs/K/La, Rb/Ca/In/Ni, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Li/K, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Rb/Sr/Lu, Na/Sr/Lu/Nb, Na/Eu/Hf, Dy/Rb/Gd, Sr/Ce, Na/Pt/Bi, Rb/Hf, Ca/Cs, Ca/Mg/Na, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Sr/Ce/K, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr, W/Ge, Sr/Tb, Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Na/K/Mg, Zr/Cs, Ca/Ce, Na/Li/Cs, Li/Sr, Cs/Zn, La/Dy/K, Dy/K, La/Mg, Na/Nd/In/K, In/Sr, Sr/Cs, Rb/Ga/Tm/Cs, Ga/Cs, K/La/Zr/Ag, Lu/Fe, Sr/Tb/K, Sr/Tm, La/Dy, Sm/Li/Sr, Mg/K, Sr/Pr, Li/Rb/Ga, Li/Cs/Tm, Zr/K, Li/Cs, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Sr/Cs/Zn, Sm/Cs, In/K, Ho/Cs/Li/La, Sr/Pr/K, Cs/La/Na, La/S/Sr, K/La/Zr/Ag, Lu/TI, Pr/Zn, Rb/Sr/La, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, Lu/Nb, La/Dy/Gd, Na/Mg/TI/P, Na/Pt, Gd/Li/K, Rb/K/Lu, Sr/La/Dy/S, Na/Ce/Co, Na/Ce, Na/Ga/Gd/Al, Ba/Rh/Ta, Ba/Ta, Na/Al/Bi, Sr/Hf/Rb, Cs/Eu/S, Sm/Tm/Yb/Fe, Sm/Tm/Yb, Hf/Zr/Ta, Rb/Gd/Li/K, Gd/Ho/Al/P, Na/Ca/Lu, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Sr/B, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Gd/Ho/Sr, Ca/Sr, Ca/Sr/W, Sr/Ho/Tm/Na, Na/Zr/Eu/Tm, Sr/Ho/Tm/Na, Sr/Pb, Sr/W/Li, Ca/Sr/W or Sr/Hf.
(250) In other embodiments, the disclosure provides a nanowire comprising a mixed oxide of Y—La, Zr—La, Pr—La, Ce—La or combinations thereof and at least one dopant selected from a metal element, a semi-metal element and a non-metal element. For example, in some embodiments the at least one dopant is selected from Eu, Na, Sr, Ca, Mg, Sm, Ho, Tm, W, La, K, Dy, In, Li, Cs, S, Zn, Ga, Rb, Ba, Yb, Ni, Lu, Ta, P, Hf, Tb, Gd, Pt, Bi, Sn, Nb, Sb, Ge, Ag, Au, Pb, B, Re, Fe, Al, Zr, TI, Pr, Co, Ce, Rh, and Mo, and in even other embodiments, the catalytic nanowire comprises at least one of the following dopant combinations: Eu/Na, Sr/Na, Na/Zr/Eu/Ca, Mg/Na, Sr/Sm/Ho/Tm, Sr/W, Mg/La/K, Na/K/Mg/Tm, Na/Dy/K, Na/La/Dy, Sr/Hf/K, Na/La/Eu, Na/La/Eu/In, Na/La/K, Na/La/Li/Cs, K/La, K/La/S, K/Na, Li/Cs, Li/Cs/La, Li/Cs/La/Tm, Li/Cs/Sr/Tm, Li/Sr/Cs, Li/Sr/Zn/K, Li/Ga/Cs, Li/K/Sr/La, Li/Na, Li/Na/Rb/Ga, Li/Na/Sr, Li/Na/Sr/La, Sr/Zr, Li/Sm/Cs, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Sr/Zr/K, Cs/K/La, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Cs/La, Sr/Tm/Li/Cs, Zn/K, Zr/Cs/K/La, Rb/Ca/In/Ni, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Li/K, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Rb/Sr/Lu, Na/Sr/Lu/Nb, Na/Eu/Hf, Dy/Rb/Gd, Sr/Ce, Na/Pt/Bi, Rb/Hf, Ca/Cs, Ca/Mg/Na, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Sr/Ce/K, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr, W/Ge, Sr/Tb, Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Na/K/Mg, Zr/Cs, Ca/Ce, Na/Li/Cs, Li/Sr, Cs/Zn, La/Dy/K, Dy/K, La/Mg, Na/Nd/In/K, In/Sr, Sr/Cs, Rb/Ga/Tm/Cs, Ga/Cs, K/La/Zr/Ag, Lu/Fe, Sr/Tb/K, Sr/Tm, La/Dy, Sm/Li/Sr, Mg/K, Sr/Pr, Li/Rb/Ga, Li/Cs/Tm, Zr/K, Li/Cs, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Sr/Cs/Zn, Sm/Cs, In/K, Ho/Cs/Li/La, Sr/Pr/K, Cs/La/Na, La/S/Sr, K/La/Zr/Ag, Lu/TI, Pr/Zn, Rb/Sr/La, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, Lu/Nb, La/Dy/Gd, Na/Mg/TI/P, Na/Pt, Gd/Li/K, Rb/K/Lu, Sr/La/Dy/S, Na/Ce/Co, Na/Ce, Na/Ga/Gd/Al, Ba/Rh/Ta, Ba/Ta, Na/Al/Bi, Sr/Hf/Rb, Cs/Eu/S, Sm/Tm/Yb/Fe, Sm/Tm/Yb, Hf/Zr/Ta, Rb/Gd/Li/K, Gd/Ho/Al/P, Na/Ca/Lu, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Sr/B, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Gd/Ho/Sr, Ca/Sr, Ca/Sr/W, Sr/Ho/Tm/Na, Na/Zr/Eu/Tm, Sr/Ho/Tm/Na, Sr/Pb, Sr/W/Li, Ca/Sr/W or Sr/Hf.
(251) In still other embodiments, the invention provides a catalytic nanowire comprising a mixed oxide of a rare earth element and a Group 13 element, wherein the catalytic nanowire further comprises one or more Group 2 elements. In some embodiments, the Group 13 element is B, Al, Ga or In. In other embodiments, the Group 2 element is Ca or Sr. In still other embodiments, the rare earth element is La, Y, Nd, Yb, Sm, Pr, Ce or Eu.
(252) Examples of the foregoing catalytic nanowires include catalytic nanowires comprising CaLnBO.sub.x, CaLbAlO.sub.x, CaLnGaO.sub.x, CaLnInO.sub.x, CaLnAlSrO.sub.x and CaLnAlSrO.sub.x, wherein Ln is a lanthanide or yttrium and x is number such that all charges are balanced. For example, in some embodiments, the catalytic nanowire comprises CaLaBO.sub.4, CaLaAlO.sub.4, CaLaGaO.sub.4, CaLaInO.sub.4, CaLaAlSrO.sub.5, CaLaAlSrO.sub.5, CaNdBO.sub.4, CaNdAlO.sub.4, CaNdGaO.sub.4, CaNdInO.sub.4, CaNdAlSrO.sub.4, CaNdAlSrO.sub.4, CaYbBO.sub.4, CaYbAlO.sub.4, CaYbGaO.sub.4, CaYbInO.sub.4, CaYbAlSrO.sub.5, CaYbAlSrO.sub.5, CaEuBO.sub.4, CaEuAlO.sub.4, CaEuGaO.sub.4, CaEuInO.sub.4, CaEuAlSrO.sub.5, CaEuAlSrO.sub.5, CaSmBO.sub.4, CaSmAlO.sub.4, CaSmGaO.sub.4, CaSmInO.sub.4, CaSmAlSrO.sub.5, CaSmAlSrO.sub.5, CaYBO.sub.4, CaYAlO.sub.4, CaYGaO.sub.4, CaYInO.sub.4, CaYAISrO.sub.5, CaYAISrO.sub.5, CaCeBO.sub.4, CaCeAlO.sub.4, CaCeGaO.sub.4, CaCeInO.sub.4, CaCeAlSrO.sub.5, CaCeAlSrO.sub.5, CaPrBO.sub.4, CaPrAlO.sub.4, CaPrGaO.sub.4, CaPrInO.sub.4, CaPrAlSrO.sub.5 or CaPrAlSrO.sub.5.
(253) In still other embodiments, the invention is directed to a catalytic nanowire comprising a rare earth oxide, wherein the nanowires are doped with a dopant (or dopants) selected from Eu/Na, Sr/Na, Na/Zr/Eu/Ca, Mg/Na, Sr/Sm/Ho/Tm, Sr/W, Mg/La/K, Na/K/Mg/Tm, Na/Dy/K, Na/La/Dy, Sr/Hf/K, Na/La/Eu, Na/La/Eu/In, Na/La/K, Na/La/Li/Cs, K/La, K/La/S, K/Na, Li/Cs, Li/Cs/La, Li/Cs/La/Tm, Li/Cs/Sr/Tm, Li/Sr/Cs, Li/Sr/Zn/K, Li/Ga/Cs, Li/K/Sr/La, Li/Na, Li/Na/Rb/Ga, Li/Na/Sr, Li/Na/Sr/La, Sr/Zr, Li/Sm/Cs, Ba/Sm/Yb/S, Ba/Tm/K/La, Ba/Tm/Zn/K, Sr/Zr/K, Cs/K/La, Cs/La/Tm/Na, Cs/Li/K/La, Sm/Li/Sr/Cs, Sr/Cs/La, Sr/Tm/Li/Cs, Zn/K, Zr/Cs/K/La, Rb/Ca/In/Ni, Sr/Ho/Tm, La/Nd/S, Li/Rb/Ca, Li/K, Tm/Lu/Ta/P, Rb/Ca/Dy/P, Mg/La/Yb/Zn, Rb/Sr/Lu, Na/Sr/Lu/Nb, Na/Eu/Hf, Dy/Rb/Gd, Sr/Ce, Na/Pt/Bi, Rb/Hf, Ca/Cs, Ca/Mg/Na, Hf/Bi, Sr/Sn, Sr/W, Sr/Nb, Sr/Ce/K, Zr/W, Y/W, Na/W, Bi/W, Bi/Cs, Bi/Ca, Bi/Sn, Bi/Sb, Ge/Hf, Hf/Sm, Sb/Ag, Sb/Bi, Sb/Au, Sb/Sm, Sb/Sr, Sb/W, Sb/Hf, Sb/Yb, Sb/Sn, Yb/Au, Yb/Ta, Yb/W, Yb/Sr, Yb/Pb, Yb/W, Yb/Ag, Au/Sr, W/Ge, Sr/Tb, Ta/Hf, W/Au, Ca/W, Au/Re, Sm/Li, La/K, Zn/Cs, Na/K/Mg, Zr/Cs, Ca/Ce, Na/Li/Cs, Li/Sr, Cs/Zn, La/Dy/K, Dy/K, La/Mg, Na/Nd/In/K, In/Sr, Sr/Cs, Rb/Ga/Tm/Cs, Ga/Cs, K/La/Zr/Ag, Lu/Fe, Sr/Tb/K, Sr/Tm, La/Dy, Sm/Li/Sr, Mg/K, Li/Rb/Ga, Li/Cs/Tm, Zr/K, Li/Cs, Li/K/La, Ce/Zr/La, Ca/Al/La, Sr/Zn/La, Sr/Cs/Zn, Sm/Cs, In/K, Ho/Cs/Li/La, Sr/Pr/K, Cs/La/Na, La/S/Sr, K/La/Zr/Ag, Lu/TI, Pr/Zn, Rb/Sr/La, Na/Sr/Eu/Ca, K/Cs/Sr/La, Na/Sr/Lu, Sr/Eu/Dy, Lu/Nb, La/Dy/Gd, Na/Mg/TI/P, Na/Pt, Gd/Li/K, Rb/K/Lu, Sr/La/Dy/S, Na/Ce/Co, Na/Ce, Na/Ga/Gd/Al, Ba/Rh/Ta, Ba/Ta, Na/Al/Bi, Sr/Hf/Rb, Cs/Eu/S, Sm/Tm/Yb/Fe, Sm/Tm/Yb, Hf/Zr/Ta, Rb/Gd/Li/K, Gd/Ho/Al/P, Na/Ca/Lu, Cu/Sn, Ag/Au, Al/Bi, Al/Mo, Al/Nb, Au/Pt, Ga/Bi, Mg/W, Pb/Au, Sn/Mg, Sr/B, Zn/Bi, Gd/Ho, Zr/Bi, Ho/Sr, Gd/Ho/Sr, Ca/Sr, Ca/Sr/W, Sr/Ho/Tm/Na, Na/Zr/Eu/Tm, Sr/Pb, Sr/W/Li, Ca/Sr/W or Sr/Hf. In one embodiment of the foregoing, nanowires comprise La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Ln1.sub.4-xLn2.sub.xO.sub.6, La.sub.4-xLn1.sub.xO.sub.6, La.sub.4-xNd.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4, La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, Y—La, Zr—La, Pr—La or Ce—La or combinations thereof.
(254) In other embodiments, the nanowires comprise La.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Y.sub.2O.sub.3, Ce.sub.2O.sub.3, Pr.sub.2O.sub.3, Ln1.sub.4-xLn2.sub.x, La.sub.4-xLn1.sub.xO.sub.6, La.sub.4-xNd.sub.xO.sub.6, wherein L.sub.n1 and L.sub.n2 are each independently a lanthanide element, wherein L.sub.n1 and L.sub.n2 are not the same and x is a number ranging from greater than 0 to less than 4, La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, Y—La, Zr—La, Pr—La or Ce—La doped with Sr/Ta, for example in some embodiments the nanowires comprise Sr/Ta/La.sub.2O.sub.3, Sr/Ta/Yb.sub.2O.sub.3, Sr/Ta/Eu.sub.2O.sub.3, Sr/Ta/Sm.sub.2O.sub.3, Sr/Ta/La.sub.3NdO.sub.6, Sr/Ta/LaNd.sub.3O.sub.6, Sr/Ta/La.sub.1.5Nd.sub.2.5O.sub.6, Sr/Ta/La.sub.2.5Nd.sub.1.5O.sub.6, Sr/Ta/La.sub.3.2Nd.sub.0.8O.sub.6, Sr/Ta/La.sub.3.5Nd.sub.0.5O.sub.6, Sr/Ta/La.sub.3.8Nd.sub.0.2O.sub.6, Sr/Ta/Y—La, Sr/Ta/Zr—La, Sr/Ta/Pr—La or Sr/Ta/Ce—La or combinations thereof. In other embodiments, the nanowires comprise Ln1.sub.4-xLn2.sub.xO.sub.6, La.sub.4-xLn1.sub.xO.sub.6, La.sub.4-xNd.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4, La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, Y—La, Zr—La, Pr—La or Ce—La doped with Na, Sr, Ca, Yb, Cs or Sb, for example the nanowires may comprise Na/Ln1.sub.4-xLn2.sub.xO.sub.6, Sr/Ln1.sub.4-xLn2.sub.xO.sub.6, Ca/Ln1.sub.4-xLn2.sub.xO.sub.6, Yb/Ln1.sub.4-xLn2.sub.xO.sub.6, Cs/Ln1.sub.4-xLn2.sub.xO.sub.6, Sb/Ln1.sub.4-xLn2.sub.xO.sub.6, Na/La.sub.4-xLn1.sub.xO.sub.6, Na/La.sub.3NdO.sub.6, Sr/La.sub.4-xLn1.sub.xO.sub.6, Ca/La.sub.4-xLn1.sub.xO.sub.6, Yb/La.sub.4-xLn1.sub.xO.sub.6, Cs/La.sub.4-xLn1.sub.xO.sub.6, Sb/La.sub.4-xLn1.sub.xO.sub.6, Na/La.sub.4-xNd.sub.xO.sub.6, Sr/La.sub.4-xNd.sub.xO.sub.6, Ca/La.sub.4-xNd.sub.xO.sub.6, Yb/La.sub.4-xNd.sub.xO.sub.6, Cs La.sub.4-xNd.sub.xO.sub.6, Sb/La.sub.4-xNd.sub.xO.sub.6, Na/LaNd.sub.3O.sub.6, Na/La.sub.1.5Nd.sub.2.5O.sub.6, Na/La.sub.2.5Nd.sub.1.5O.sub.6, Na/La.sub.3.2Nd.sub.0.8O.sub.6, Na/La.sub.3.5Nd.sub.0.5O.sub.6, Na/La.sub.3.8Nd.sub.0.2O.sub.6, Na/Y—La, Na/Zr—La, Na/Pr—La, Na/Ce—La, Sr/La.sub.3NdO.sub.6, Sr/LaNd.sub.3O.sub.6, Sr/La.sub.1.5Nd.sub.2.5O.sub.6, Sr/La.sub.2.5Nd.sub.1.5O.sub.6, Sr/La.sub.3.2Nd.sub.0.8O.sub.6, Sr/La.sub.3.5Nd.sub.0.5O.sub.6, Sr/La.sub.3.8Nd.sub.0.2O.sub.6, Sr/Y—La, Sr/Zr—La, Sr/Pr—La, Sr/Ce—La, Ca/La.sub.3NdO.sub.6, Ca/LaNd.sub.3O.sub.6, Ca/La.sub.1.5Nd.sub.2.5O.sub.6, Ca/La.sub.2.5Nd.sub.1.5O.sub.6, Ca/La.sub.3.2Nd.sub.0.8O.sub.6, Ca/La.sub.3.5Nd.sub.0.5O.sub.6, Ca/La.sub.3.8Nd.sub.0.2O.sub.6, Ca/Y—La, Ca/Zr—La, Ca/Pr—La, Ca/Ce—La, Yb/La.sub.3NdO.sub.6, Yb/LaNd.sub.3O.sub.6, Yb/La.sub.1.5Nd.sub.2.5O.sub.6, Yb/La.sub.2.5Nd.sub.1.5O.sub.6, Yb/La.sub.3.2Nd.sub.0.8O.sub.6, Yb/La.sub.3.5Nd.sub.0.5O.sub.6, Yb/La.sub.3.8Nd.sub.0.2O.sub.6, Yb/Y—La, Yb/Zr—La, Yb/Pr—La, Yb/Ce—La, Cs/La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6, Cs/La.sub.1.5Nd.sub.2.5O.sub.6, Cs/La.sub.2.5Nd.sub.1.5O.sub.6, Cs/La.sub.3.2Nd.sub.0.8O.sub.6, Cs/La.sub.3.5Nd.sub.0.5O.sub.6, Cs/La.sub.3.8Nd.sub.0.2O.sub.6, Cs/Y—La, Cs/Zr—La, Cs/Pr—La, Cs/Ce—La, Sb/La.sub.3NdO.sub.6, Sb/LaNd.sub.3O.sub.6, Sb/La.sub.1.5Nd.sub.2.5O.sub.6, Sb/La.sub.2.5Nd.sub.1.5O.sub.6, Sb/La.sub.3.2Nd.sub.0.8O.sub.6, Sb/La.sub.3.5Nd.sub.0.5O.sub.6, Sb/La.sub.3.8Nd.sub.0.2O.sub.6, Sb/Y—La, Sb/Zr—La, Sb/Pr—La, Sb/Ce—La or combinations thereof.
(255) Furthermore, the present inventors have discovered that lanthanide oxides doped with alkali metals and/or alkaline earth metals and at least one other dopant selected from Groups 3-16 have desirable catalytic properties and are useful in a variety of catalytic reactions, such as OCM. Accordingly, in one embodiment the nanowire catalysts comprise a lanthanide oxide doped with an alkali metal, an alkaline earth metal or combinations thereof, and at least one other dopant from groups 3-16. In some embodiments, the nanowire catalyst comprises a lanthanide oxide, an alkali metal dopant and at least one other dopant selected from Groups 3-16. In other embodiments, the nanowire catalyst comprises a lanthanide oxide, an alkaline earth metal dopant and at least one other dopant selected from Groups 3-16.
(256) In some more specific embodiments of the foregoing, the nanowire catalyst comprises a lanthanide oxide, a lithium dopant and at least one other dopant selected from Groups 3-16. In still other embodiments, the nanowire catalyst comprises a lanthanide oxide, a sodium dopant and at least one other dopant selected from Groups 3-16. In other embodiments, the nanowire catalyst comprises a lanthanide oxide, a potassium dopant and at least one other dopant selected from Groups 3-16. In other embodiments, the nanowire catalyst comprises a lanthanide oxide, a rubidium dopant and at least one other dopant selected from Groups 3-16. In more embodiments, the nanowire catalyst comprises a lanthanide oxide, a caesium dopant and at least one other dopant selected from Groups 3-16.
(257) In still other embodiments of the foregoing, the nanowire catalyst comprises a lanthanide oxide, a beryllium dopant and at least one other dopant selected from Groups 3-16. In other embodiments, the nanowire catalyst comprises a lanthanide oxide, a magnesium dopant and at least one other dopant selected from Groups 3-16. In still other embodiments, the nanowire catalyst comprises a lanthanide oxide, a calcium dopant and at least one other dopant selected from Groups 3-16. In more embodiments, the nanowire catalyst comprises a lanthanide oxide, a strontium dopant and at least one other dopant selected from Groups 3-16. In more embodiments, the nanowire catalyst comprises a lanthanide oxide, a barium dopant and at least one other dopant selected from Groups 3-16.
(258) In some embodiments of the foregoing lanthanide oxide nanowire catalysts, the catalysts comprise La.sub.2O.sub.3, Nd.sub.2O.sub.3, Yb.sub.2O.sub.3, Eu.sub.2O.sub.3, Sm.sub.2O.sub.3, Ln1.sub.4-xLn2.sub.xO.sub.6, La.sub.4-xLn1.sub.xO.sub.6, La.sub.4-xNd.sub.xO.sub.6, wherein Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4, La.sub.3NdO.sub.6, LaNd.sub.3O.sub.6, La.sub.1.5Nd.sub.2.5O.sub.6, La.sub.2.5Nd.sub.1.5O.sub.6, La.sub.3.2Nd.sub.0.8O.sub.6, La.sub.3.5Nd.sub.0.5O.sub.6, La.sub.3.8Nd.sub.0.2O.sub.6, Y—La, Zr—La, Pr—La or Ce—La or combinations thereof. In other various embodiments, the lanthanide oxide nanowire catalyst comprises a C.sub.2 selectivity of greater than 50% and a methane conversion of greater than 20% when the lanthanide oxide nanowire catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less.
(259) In various embodiments, of any of the above nanowire catalysts, the nanowire catalyst comprises a C.sub.2 selectivity of greater than 50% and a methane conversion of greater than 20% when the nanowire catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less, 700° C. or less, 650° C. or less or even 600° C. or less.
(260) In more embodiments, of any of the above nanowire catalysts, the nanowire catalyst comprises a C.sub.2 selectivity of greater than 50%, greater than 55%, greater than 60%, greater than 65%, greater than 70%, or even greater than 75%, and a methane conversion of greater than 20% when the nanowire catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less.
(261) In other embodiments, of any of the above catalysts, the catalyst comprises a C.sub.2 selectivity of greater than 50%, and a methane conversion of greater than 20%, greater than 25%, greater than 30%, greater than 35%, greater than 40%, greater than 45%, or even greater than 50% when the rare earth oxide catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less. In some embodiments of the foregoing, the methan conversion and C2 selectivity are calculated based on a single pass basis (i.e., the percent of methane converted or C2 selectivity upon a single pass over the catalyst or catalytic bed, etc.)
(262) In some embodiments, the foregoing doped nanowires comprise 1, 2, 3 or four doping elements. In other embodiments, the nanowires comprise more than four doping elements, for example, 5, 6, 7, 8, 9, 10 or even more doping elements. In this regard, each dopant may be present in the nanowires (for example any of the nanowires disclosed in Tables 9-12) in up to 75% by weight. For example, in one embodiment the concentration of a first doping element ranges from 0.01% to 1% w/w, 1%-5% w/w, 5%-10% w/w. 10%-20% ww, 20%-30% w/w, 30%-40% w/w or 40%-50% w/w, for example about 1% w/w, about 2% w/w, about 3% w/w, about 4% w/w, about 5% w/w, about 6% w/w, about 7% w/w, about 8% w/w, about 9% w/w, about 10% w/w, about 11% w/w, about 12% w/w, about 13% w/w, about 14% w/w, about 15% w/w, about 16% w/w, about 17% w/w, about 18% w/w, about 19% w/w or about 20% w/w.
(263) In other embodiments, the concentration of a second doping element (when present) ranges from 0.01% to 1% w/w, 1%-5% w/w, 5%-10% w/w. 10%-20% ww, 20%-30% w/w, 30%-40% w/w or 40%-50% w/w, for example about 1% w/w, about 2% w/w, about 3% w/w, about 4% w/w, about 5% w/w, about 6% w/w, about 7% w/w, about 8% w/w, about 9% w/w, about 10% w/w, about 11% w/w, about 12% w/w, about 13% w/w, about 14% w/w, about 15% w/w, about 16% w/w, about 17% w/w, about 18% w/w, about 19% w/w or about 20% w/w.
(264) In other embodiments, the concentration of a third doping element (when present) ranges from 0.01% to 1% w/w, 1%-5% w/w, 5%-10% w/w. 10%-20% ww, 20%-30% w/w, 30%-40% w/w or 40%-50% w/w, for example about 1% w/w, about 2% w/w, about 3% w/w, about 4% w/w, about 5% w/w, about 6% w/w, about 7% w/w, about 8% w/w, about 9% w/w, about 10% w/w, about 11% w/w, about 12% w/w, about 13% w/w, about 14% w/w, about 15% w/w, about 16% w/w, about 17% w/w, about 18% w/w, about 19% w/w or about 20% w/w.
(265) In other embodiments, the concentration of a fourth doping element (when present) ranges from 0.01% to 1% w/w, 1%-5% w/w, 5%-10% w/w. 10%-20% ww, 20%-30% w/w, 30%-40% w/w or 40%-50% w/w, for example about 1% w/w, about 2% w/w, about 3% w/w, about 4% w/w, about 5% w/w, about 6% w/w, about 7% w/w, about 8% w/w, about 9% w/w, about 10% w/w, about 11% w/w, about 12% w/w, about 13% w/w, about 14% w/w, about 15% w/w, about 16% w/w, about 17% w/w, about 18% w/w, about 19% w/w or about 20% w/w.
(266) In other embodiments, the concentration of the dopant is measured in terms of atomic percent (at/at). In some of these embodiments, each dopant may be present in the nanowires (for example any of the nanowires disclosed in Tables 1-12) in up to 75% at/at. For example, in one embodiment the concentration of a first doping element ranges from 0.01% to 1% at/at, 1%-5% at/at, 5%-10% at/at. 10%-20% at/at, 20%-30% at/at, 30%-40% at/at or 40%-50% at/at, for example about 1% at/at, about 2% at/at, about 3% at/at, about 4% at/at, about 5% at/at, about 6% at/at, about 7% at/at, about 8% at/at, about 9% at/at, about 10% at/at, about 11% at/at, about 12% at/at, about 13% at/at, about 14% at/at, about 15% at/at, about 16% at/at, about 17% at/at, about 18% at/at, about 19% at/at or about 20% at/at.
(267) In other embodiments, the concentration of a second doping element (when present) ranges from 0.01% to 1% at/at, 1%-5% at/at, 5%-10% at/at. 10%-20% ww, 20%-30% at/at, 30%-40% at/at or 40%-50% at/at, for example about 1% at/at, about 2% at/at, about 3% at/at, about 4% at/at, about 5% at/at, about 6% at/at, about 7% at/at, about 8% at/at, about 9% at/at, about 10% at/at, about 11% at/at, about 12% at/at, about 13% at/at, about 14% at/at, about 15% at/at, about 16% at/at, about 17% at/at, about 18% at/at, about 19% at/at or about 20% at/at.
(268) In other embodiments, the concentration of a third doping element (when present) ranges from 0.01% to 1% at/at, 1%-5% at/at, 5%-10% at/at. 10%-20% ww, 20%-30% at/at, 30%-40% at/at or 40%-50% at/at, for example about 1% at/at, about 2% at/at, about 3% at/at, about 4% at/at, about 5% at/at, about 6% at/at, about 7% at/at, about 8% at/at, about 9% at/at, about 10% at/at, about 11% at/at, about 12% at/at, about 13% at/at, about 14% at/at, about 15% at/at, about 16% at/at, about 17% at/at, about 18% at/at, about 19% at/at or about 20% at/at.
(269) In other embodiments, the concentration of a fourth doping element (when present) ranges from 0.01% to 1% at/at, 1%-5% at/at, 5%-10% at/at. 10%-20% ww, 20%-30% at/at, 30%-40% at/at or 40%-50% at/at, for example about 1% at/at, about 2% at/at, about 3% at/at, about 4% at/at, about 5% at/at, about 6% at/at, about 7% at/at, about 8% at/at, about 9% at/at, about 10% at/at, about 11% at/at, about 12% at/at, about 13% at/at, about 14% at/at, about 15% at/at, about 16% at/at, about 17% at/at, about 18% at/at, about 19% at/at or about 20% at/at.
(270) Accordingly, any of the doped nanowires described above or in Tables 1-12, may comprise any of the foregoing doping concentrations.
(271) Furthermore, different catalytic characteristics of the above doped nanowires can be varied or “tuned” based on the method used to prepare them. For example, in one embodiment the above nanowires (and the nanowires of Tables 1-12) are prepared using a biological templating approach, for example phage. In other embodiments, the nanowires are prepared via a hydrothermal or sol gel approach (i.e., a non-templated approach). Some embodiments for preparing the nanowires (e.g., rare earth nanowires) comprise preparing the nanowires directly from the corresponding oxide or via a metal hydroxide gel approach. Such methods are described in more detail herein and other methods are known in the art. In addition, the above dopants may be incorporated either before or after (or combinations thereof) an optional calcincation step as described herein.
(272) In other embodiments, the nanowires comprise a mixed oxide selected from a Y—La mixed oxide doped with Na. (Y ranges from 5 to 20% of La mol/mol); a Zr—La mixed oxide doped with Na (Zr ranges from 1 to 5% of La mol/mol); a Pr—La mixed oxide doped with a group 1 element (Pr ranges from 2 to 6% of La mol/mol); and a Ce—La mixed oxide doped with a group 1 element (Ce ranges from 5 to 20% of La mol/mol). As used herein, the notation “M1-M2”, wherein M1 and M2 are each independently metals refers to a mixed metal oxide comprising the two metals. M1 and M2 may be present in equal or different amounts (at/at).
(273) Some embodiments of the metal oxides disclosed herein can be in the form of oxides, oxyhydroxides, hydroxides, oxycarbonates or combination thereof after being exposed to moisture, carbon dioxide, undergoing incomplete calcination or combination thereof.
(274) It is contemplated that any one or more of the dopants disclosed herein can be combined with any one of the nanowires disclosed herein to form a doped nanowire comprising one, two, three or more dopants. Tables 1-12 below show exemplary doped nanowires in accordance with various specific embodiments. Dopants (Dop) are shown in the horizontal rows and base nanowire catalyst (NW) in the vertical columns for Tables 1-8, and dopants are shown in the vertical columns and base nanowire catalyst in the horizontal rows for Tables 9-12. The resulting doped catalysts are shown in the intersecting cells in all tables. In some embodiments, the doped nanowires shown in tables 1-12 are doped with one, two, three or more additional dopants.
(275) TABLE-US-00001 TABLE 1 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) Dop NW Li Na K Rb Cs Be Mg Ca Li.sub.2O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ BeO BeO BeO BeO BeO BeO BeO BeO MgO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MgO MgO MgO MgO MgO MgO MgO MgO CaO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ CaO CaO CaO CaO CaO CaO CaO CaO SrO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ SrO SrO SrO SrO SrO SrO SrO SrO BaO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ BaO BaO BaO BaO BaO BaO BaO BaO Sc.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ TiO TiO TiO TiO TiO TiO TiO TiO Ti.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ VO VO VO VO VO VO VO VO V.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ NbO NbO NbO NbO NbO NbO NbO NbO NbO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ CrO CrO CrO CrO CrO CrO CrO CrO Cr.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MnO MnO MnO MnO MnO MnO MnO MnO Mn/Mg/O Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3— Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ B.sub.2O.sub.10 Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 (Li,Mg).sub.6— Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MnO.sub.8 (Li,Mg).sub.6— (Li,Mg).sub.6— (Li,Mg).sub.6— (Li,Mg).sub.6— (Li,Mg).sub.6— (Li,Mg).sub.6— (Li,Mg).sub.6— (Li,Mg).sub.6— MnO.sub.8 MnO.sub.8 MnO.sub.8 MnO.sub.8 MnO.sub.8 MnO.sub.8 MnO.sub.8 MnO.sub.8 Mn.sub.2O.sub.4 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Na.sub.4P.sub.2O.sub.7 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/ Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ WO.sub.4 Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ Mn.sub.3O.sub.4/ WO.sub.4 WO.sub.4 WO.sub.4 WO.sub.4 WO.sub.4 WO.sub.4 WO.sub.4 WO.sub.4 Na.sub.2WO.sub.4 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO MgO MgO MgO MgO Na.sub.10Mn— Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ W.sub.5O.sub.17 Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 La.sub.3NdO.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Y—La Y—La Y—La Y—La Y—La Y—La Y—La Y—La Zr—La Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Pr—La Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Ce—La Li/ Na/ K/ Rb/ Cs/ Be/ Mg/ Ca/ Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La
(276) TABLE-US-00002 TABLE 2 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) Dop NW Sr Ba B P S F Cl Li.sub.2O Sr/ Ba/ B/ P/ S/ F/ Cl/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Sr/ Ba/ B/ P/ S/ F/ Cl/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Sr/ Ba/ B/ P/ S/ F/ Cl/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Sr/ Ba/ B/ P/ S/ F/ Cl/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Sr/ Ba/ B/ P/ S/ F/ Cl/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Sr/ Ba/ B/ P/ S/ F/ Cl/ BeO BeO BeO BeO BeO BeO BeO MgO Sr/ Ba/ B/ P/ S/ F/ Cl/ MgO MgO MgO MgO MgO MgO MgO CaO Sr/ Ba/ B/ P/ S/ F/ Cl/ CaO CaO CaO CaO CaO CaO CaO SrO Sr/ Ba/ B/ P/ S/ F/ Cl/ SrO SrO SrO SrO SrO SrO SrO BaO Sr/ Ba/ B/ P/ S/ F/ Cl/ BaO BaO BaO BaO BaO BaO BaO Sc.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Sr/ Ba/ B/ P/ S/ F/ Cl/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Sr/ Ba/ B/ P/ S/ F/ Cl/ TiO TiO TiO TiO TiO TiO TiO Ti.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Sr/ Ba/ B/ P/ S/ F/ Cl/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Sr/ Ba/ B/ P/ S/ F/ Cl/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Sr/ Ba/ B/ P/ S/ F/ Cl/ VO VO VO VO VO VO VO V.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Sr/ Ba/ B/ P/ S/ F/ Cl/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Sr/ Ba/ B/ P/ S/ F/ Cl/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Sr/ Ba/ B/ P/ S/ F/ Cl/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Sr/ Ba/ B/ P/ S/ F/ Cl/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Sr/ Ba/ B/ P/ S/ F/ Cl/ NbO NbO NbO NbO NbO NbO NbO NbO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Sr/ Ba/ B/ P/ S/ F/ Cl/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Sr/ Ba/ B/ P/ S/ F/ Cl/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Sr/ Ba/ B/ P/ S/ F/ Cl/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Sr/ Ba/ B/ P/ S/ F/ Cl/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Sr/ Ba/ B/ P/ S/ F/ Cl/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Sr/ Ba/ B/ P/ S/ F/ Cl/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Sr/ Ba/ B/ P/ S/ F/ Cl/ CrO CrO CrO CrO CrO CrO CrO Cr.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Sr/ Ba/ B/ P/ S/ F/ Cl/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Sr/ Ba/ B/ P/ S/ F/ Cl/ MnO MnO MnO MnO MnO MnO MnO Mn/Mg/O Sr/ Ba/ B/ P/ S/ F/ Cl/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Sr/ Ba/ B/ P/ S/ F/ Cl/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Sr/ Ba/ B/ P/ S/ F/ Cl/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3— Sr/ Ba/ B/ P/ S/ F/ Cl/ B.sub.2O.sub.10 Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Sr/ Ba/ B/ P/ S/ F/ Cl/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Sr/ Ba/ B/ P/ S/ F/ Cl/ (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Mn.sub.2O.sub.4 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Na.sub.4P.sub.2O.sub.7 Sr/ Ba/ B/ P/ S/ F/ Cl/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Sr/ Ba/ B/ P/ S/ F/ Cl/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Sr/ Ba/ B/ P/ S/ F/ Cl/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Sr/ Ba/ B/ P/ S/ F/ Cl/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4/ Sr/ Ba/ B/ P/ S/ F/ Cl/ MgO NaMnO.sub.4/ NaMnO.sub.4/ NaMnO.sub.4/ NaMnO.sub.4/ NaMnO.sub.4/ NaMnO.sub.4/ NaMnO.sub.4/ MgO MgO MgO MgO MgO MgO MgO Na.sub.10Mn— Sr/ Ba/ B/ P/ S/ F/ Cl/ W.sub.5O.sub.17 Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 La.sub.3NdO.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 Sr/ Ba/ B/ P/ S/ F/ Cl/ La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Sr/ Ba/ B/ P/ S/ F/ Cl/ Y—La Y—La Y—La Y—La Y—La Y—La Y—La Zr—La Sr/ Ba/ B/ P/ S/ F/ Cl/ Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Pr—La Sr/ Ba/ B/ P/ S/ F/ Cl/ Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Ce—La Sr/ Ba/ B/ P/ S/ F/ Cl/ Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La
(277) TABLE-US-00003 TABLE 3 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) Dop NW La Ce Pr Nd Pm Sm Eu Gd Li.sub.2O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ BeO BeO BeO BeO BeO BeO BeO BeO MgO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ MgO MgO MgO MgO MgO MgO MgO MgO CaO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ CaO CaO CaO CaO CaO CaO CaO CaO SrO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ SrO SrO SrO SrO SrO SrO SrO SrO BaO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ BaO BaO BaO BaO BaO BaO BaO BaO Sc.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ TiO TiO TiO TiO TiO TiO TiO TiO Ti.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ VO VO VO VO VO VO VO VO V.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ NbO NbO NbO NbO NbO NbO NbO NbO NbO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ CrO CrO CrO CrO CrO CrO CrO CrO Cr.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ MnO MnO MnO MnO MnO MnO MnO MnO Mn/Mg/O La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3— La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ B.sub.2O.sub.10 Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— Mg.sub.3Mn.sub.3— B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Mn.sub.2O.sub.4 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Na.sub.4P.sub.2O.sub.7 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO MgO MgO MgO MgO Na.sub.10Mn— La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ W.sub.5O.sub.17 Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— Na.sub.10Mn— W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 W.sub.5O.sub.17 La.sub.3NdO.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 La.sub.3.8Nd.sub.0.2O.sub.6 Y—La La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Y—La Y—La Y—La Y—La Y—La Y—La Y—La Y—La Zr—La La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Zr—La Pr—La La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Pr—La Ce—La La/ Ce/ Pr/ Nd/ Pm/ Sm/ Eu/ Gd/ Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La Ce—La
(278) TABLE-US-00004 TABLE 4 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW\Dop Tb Dy Ho Er Li.sub.2O Tb/ Dy/ Ho/ Er/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Tb/ Dy/ Ho/ Er/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Tb/ Dy/ Ho/ Er/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Tb/ Dy/ Ho/ Er/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Tb/ Dy/ Ho/ Er/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Tb/ Dy/ Ho/ Er/ BeO BeO BeO BeO MgO Tb/ Dy/ Ho/ Er/ MgO MgO MgO MgO CaO Tb/ Dy/ Ho/ Er/ CaO CaO CaO CaO SrO Tb/ Dy/ Ho/ Er/ SrO SrO SrO SrO BaO Tb/ Dy/ Ho/ Er/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Tb/ Dy/ Ho/ Er/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Tb/ Dy/ Ho/ Er/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Tb/ Dy/ Ho/ Er/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Tb/ Dy/ Ho/ Er/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Tb/ Dy/ Ho/ Er/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Tb/ Dy/ Ho/ Er/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Tb/ Dy/ Ho/ Er/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Tb/ Dy/ Ho/ Er/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Tb/ Dy/ Ho/ Er/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Tb/ Dy/ Ho/ Er/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Tb/ Dy/ Ho/ Er/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Tb/ Dy/ Ho/ Er/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Tb/ Dy/ Ho/ Er/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Tb/ Dy/ Ho/ Er/ VO VO VO VO V.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Tb/ Dy/ Ho/ Er/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Tb/ Dy/ Ho/ Er/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Tb/ Dy/ Ho/ Er/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Tb/ Dy/ Ho/ Er/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Tb/ Dy/ Ho/ Er/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Tb/ Dy/ Ho/ Er/ NbO NbO NbO NbO NbO.sub.2 Tb/ Dy/ Ho/ Er/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Tb/ Dy/ Ho/ Er/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Tb/ Dy/ Ho/ Er/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Tb/ Dy/ Ho/ Er/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Tb/ Dy/ Ho/ Er/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Tb/ Dy/ Ho/ Er/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Tb/ Dy/ Ho/ Er/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Tb/ Dy/ Ho/ Er/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Tb/ Dy/ Ho/ Er/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Tb/ Dy/ Ho/ Er/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Tb/ Dy/ Ho/ Er/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Tb/ Dy/ Ho/ Er/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Tb/ Dy/ Ho/ Er/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Tb/ Dy/ Ho/ Er/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Tb/ Dy/ Ho/ Er/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Tb/ Dy/ Ho/ Er/ MnO MnO MnO MnO Mn/Mg/O Tb/ Dy/ Ho/ Er/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Tb/ Dy/ Ho/ Er/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Tb/ Dy/ Ho/ Er/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Tb/ Dy/ Ho/ Er/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Tb/ Dy/ Ho/ Er/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Tb/ Dy/ Ho/ Er/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Tb/ Dy/ Ho/ Er/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Tb/ Dy/ Ho/ Er/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Tb/ Dy/ Ho/ Er/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Tb/ Dy/ Ho/ Er/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Tb/ Dy/ Ho/ Er/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Tb/ Dy/ Ho/ Er/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Tb/ Dy/ Ho/ Er/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6MnO.sub.8 Tb/ Dy/ Ho/ Er/ (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Tb/ Dy/ Ho/ Er/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Tb/ Dy/ Ho/ Er/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Tb/ Dy/ Ho/ Er/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Tb/ Dy/ Ho/ Er/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Tb/ Dy/ Ho/ Er/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Tb/ Dy/ Ho/ Er/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Tb/ Dy/ Ho/ Er/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Tb/ Dy/ Ho/ Er/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Tb/ Dy/ Ho/ Er/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Tb/ Dy/ Ho/ Er/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Tb/ Dy/ Ho/ Er/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Tb/ Dy/ Ho/ Er/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Tb/ Dy/ Ho/ Er/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Tb/ Dy/ Ho/ Er/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Tb/ Dy/ Ho/ Er/ Y—La Y—La Y—La Y—La Zr—La Tb/ Dy/ Ho/ Er/ Zr—La Zr—La Zr—La Zr—La Pr—La Tb/ Dy/ Ho/ Er/ Pr—La Pr—La Pr—La Pr—La Ce—La Tb/ Dy/ Ho/ Er/ Ce—La Ce—La Ce—La Ce—La NW\Dop Tm Yb Lu In Li.sub.2O Tm/ Yb/ Lu/ In/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Tm/ Yb/ Lu/ In/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Tm/ Yb/ Lu/ In/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Tm/ Yb/ Lu/ In/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Tm/ Yb/ Lu/ In/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Tm/ Yb/ Lu/ In/ BeO BeO BeO BeO MgO Tm/ Yb/ Lu/ In/ MgO MgO MgO MgO CaO Tm/ Yb/ Lu/ In/ CaO CaO CaO CaO SrO Tm/ Yb/ Lu/ In/ SrO SrO SrO SrO BaO Tm/ Yb/ Lu/ In/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Tm/ Yb/ Lu/ In/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Tm/ Yb/ Lu/ In/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Tm/ Yb/ Lu/ In/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Tm/ Yb/ Lu/ In/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Tm/ Yb/ Lu/ In/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Tm/ Yb/ Lu/ In/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Tm/ Yb/ Lu/ In/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Tm/ Yb/ Lu/ In/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Tm/ Yb/ Lu/ In/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Tm/ Yb/ Lu/ In/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Tm/ Yb/ Lu/ In/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Tm/ Yb/ Lu/ In/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Tm/ Yb/ Lu/ In/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Tm/ Yb/ Lu/ In/ VO VO VO VO V.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Tm/ Yb/ Lu/ In/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Tm/ Yb/ Lu/ In/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Tm/ Yb/ Lu/ In/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Tm/ Yb/ Lu/ In/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Tm/ Yb/ Lu/ In/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Tm/ Yb/ Lu/ In/ NbO NbO NbO NbO NbO.sub.2 Tm/ Yb/ Lu/ In/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Tm/ Yb/ Lu/ In/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Tm/ Yb/ Lu/ In/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Tm/ Yb/ Lu/ In/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Tm/ Yb/ Lu/ In/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Tm/ Yb/ Lu/ In/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Tm/ Yb/ Lu/ In/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Tm/ Yb/ Lu/ In/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Tm/ Yb/ Lu/ In/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Tm/ Yb/ Lu/ In/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Tm/ Yb/ Lu/ In/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Tm/ Yb/ Lu/ In/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Tm/ Yb/ Lu/ In/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Tm/ Yb/ Lu/ In/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Tm/ Yb/ Lu/ In/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Tm/ Yb/ Lu/ In/ MnO MnO MnO MnO Mn/Mg/O Tm/ Yb/ Lu/ In/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Tm/ Yb/ Lu/ In/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Tm/ Yb/ Lu/ In/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Tm/ Yb/ Lu/ In/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Tm/ Yb/ Lu/ In/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Tm/ Yb/ Lu/ In/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Tm/ Yb/ Lu/ In/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Tm/ Yb/ Lu/ In/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Tm/ Yb/ Lu/ In/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Tm/ Yb/ Lu/ In/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Tm/ Yb/ Lu/ In/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Tm/ Yb/ Lu/ In/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Tm/ Yb/ Lu/ In/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6MnO.sub.8 Tm/ Yb/ Lu/ In/ (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Tm/ Yb/ Lu/ In/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Tm/ Yb/ Lu/ In/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Tm/ Yb/ Lu/ In/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Tm/ Yb/ Lu/ In/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Tm/ Yb/ Lu/ In/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Tm/ Yb/ Lu/ In/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Tm/ Yb/ Lu/ In/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Tm/ Yb/ Lu/ In/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Tm/ Yb/ Lu/ In/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Tm/ Yb/ Lu/ In/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Tm/ Yb/ Lu/ In/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Tm/ Yb/ Lu/ In/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Tm/ Yb/ Lu/ In/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Tm/ Yb/ Lu/ In/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Tm/ Yb/ Lu/ In/ Y—La Y—La Y—La Y—La Zr—La Tm/ Yb/ Lu/ In/ Zr—La Zr—La Zr—La Zr—La Pr—La Tm/ Yb/ Lu/ In/ Pr—La Pr—La Pr—La Pr—La Ce—La Tm/ Yb/ Lu/ In/ Ce—La Ce—La Ce—La Ce—La
(279) TABLE-US-00005 TABLE 5 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW\Dop Y Sc Al Cu Li.sub.2O Y/ Sc/ Al/ Cu/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Y/ Sc/ Al/ Cu/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Y/ Sc/ Al/ Cu/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Y/ Sc/ Al/ Cu/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Y/ Sc/ Al/ Cu/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Y/ Sc/ Al/ Cu/ BeO BeO BeO BeO MgO Y/ Sc/ Al/ Cu/ MgO MgO MgO MgO CaO Y/ Sc/ Al/ Cu/ CaO CaO CaO CaO SrO Y/ Sc/ Al/ Cu/ SrO SrO SrO SrO BaO Y/ Sc/ Al/ Cu/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Y/ Sc/ Al/ Cu/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Y/ Sc/ Al/ Cu/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Y/ Sc/ Al/ Cu/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Y/ Sc/ Al/ Cu/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Y/ Sc/ Al/ Cu/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Y/ Sc/ Al/ Cu/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Y/ Sc/ Al/ Cu/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Y/ Sc/ Al/ Cu/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Y/ Sc/ Al/ Cu/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Y/ Sc/ Al/ Cu/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Y/ Sc/ Al/ Cu/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Y/ Sc/ Al/ Cu/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Y/ Sc/ Al/ Cu/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Y/ Sc/ Al/ Cu/ VO VO VO VO V.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Y/ Sc/ Al/ Cu/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Y/ Sc/ Al/ Cu/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Y/ Sc/ Al/ Cu/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Y/ Sc/ Al/ Cu/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Y/ Sc/ Al/ Cu/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Y/ Sc/ Al/ Cu/ NbO NbO NbO NbO NbO.sub.2 Y/ Sc/ Al/ Cu/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Y/ Sc/ Al/ Cu/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Y/ Sc/ Al/ Cu/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Y/ Sc/ Al/ Cu/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Y/ Sc/ Al/ Cu/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Y/ Sc/ Al/ Cu/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Y/ Sc/ Al/ Cu/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Y/ Sc/ Al/ Cu/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Y/ Sc/ Al/ Cu/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Y/ Sc/ Al/ Cu/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Y/ Sc/ Al/ Cu/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Y/ Sc/ Al/ Cu/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Y/ Sc/ Al/ Cu/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Y/ Sc/ Al/ Cu/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Y/ Sc/ Al/ Cu/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Y/ Sc/ Al/ Cu/ MnO MnO MnO MnO Mn/Mg/O Y/ Sc/ Al/ Cu/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Y/ Sc/ Al/ Cu/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Y/ Sc/ Al/ Cu/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Y/ Sc/ Al/ Cu/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Y/ Sc/ Al/ Cu/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Y/ Sc/ Al/ Cu/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Y/ Sc/ Al/ Cu/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Y/ Sc/ Al/ Cu/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Y/ Sc/ Al/ Cu/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Y/ Sc/ Al/ Cu/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Y/ Sc/ Al/ Cu/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Y/ Sc/ Al/ Cu/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Y/ Sc/ Al/ Cu/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6MnO.sub.8 Y/ Sc/ Al/ Cu/ (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Y/ Sc/ Al/ Cu/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Y/ Sc/ Al/ Cu/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Y/ Sc/ Al/ Cu/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Y/ Sc/ Al/ Cu/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Y/ Sc/ Al/ Cu/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Y/ Sc/ Al/ Cu/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Y/ Sc/ Al/ Cu/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Y/ Sc/ Al/ Cu/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Y/ Sc/ Al/ Cu/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Y/ Sc/ Al/ Cu/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Y/ Sc/ Al/ Cu/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Y/ Sc/ Al/ Cu/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Y/ Sc/ Al/ Cu/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y/ Sc/ Al/ Cu/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Y/ Sc/ Al/ Cu/ Y—La Y—La Y—La Y—La Zr—La Y/ Sc/ Al/ Cu/ Zr—La Zr—La Zr—La Zr—La Pr—La Y/ Sc/ Al/ Cu/ Pr—La Pr—La Pr—La Pr—La Ce—La Y/ Sc/ Al/ Cu/ Ce—La Ce—La Ce—La Ce—La NW\Dop Ga Hf Fe Cr Li.sub.2O Ga/ Hf/ Fe/ Cr/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Ga/ Hf/ Fe/ Cr/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Ga/ Hf/ Fe/ Cr/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Ga/ Hf/ Fe/ Cr/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Ga/ Hf/ Fe/ Cr/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Ga/ Hf/ Fe/ Cr/ BeO BeO BeO BeO MgO Ga/ Hf/ Fe/ Cr/ MgO MgO MgO MgO CaO Ga/ Hf/ Fe/ Cr/ CaO CaO CaO CaO SrO Ga/ Hf/ Fe/ Cr/ SrO SrO SrO SrO BaO Ga/ Hf/ Fe/ Cr/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Ga/ Hf/ Fe/ Cr/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Ga/ Hf/ Fe/ Cr/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Ga/ Hf/ Fe/ Cr/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Ga/ Hf/ Fe/ Cr/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Ga/ Hf/ Fe/ Cr/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Ga/ Hf/ Fe/ Cr/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Ga/ Hf/ Fe/ Cr/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Ga/ Hf/ Fe/ Cr/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Ga/ Hf/ Fe/ Cr/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Ga/ Hf/ Fe/ Cr/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Ga/ Hf/ Fe/ Cr/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Ga/ Hf/ Fe/ Cr/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Ga/ Hf/ Fe/ Cr/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Ga/ Hf/ Fe/ Cr/ VO VO VO VO V.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Ga/ Hf/ Fe/ Cr/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Ga/ Hf/ Fe/ Cr/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Ga/ Hf/ Fe/ Cr/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Ga/ Hf/ Fe/ Cr/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Ga/ Hf/ Fe/ Cr/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Ga/ Hf/ Fe/ Cr/ NbO NbO NbO NbO NbO.sub.2 Ga/ Hf/ Fe/ Cr/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Ga/ Hf/ Fe/ Cr/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Ga/ Hf/ Fe/ Cr/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Ga/ Hf/ Fe/ Cr/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Ga/ Hf/ Fe/ Cr/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Ga/ Hf/ Fe/ Cr/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Ga/ Hf/ Fe/ Cr/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Ga/ Hf/ Fe/ Cr/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Ga/ Hf/ Fe/ Cr/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Ga/ Hf/ Fe/ Cr/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Ga/ Hf/ Fe/ Cr/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Ga/ Hf/ Fe/ Cr/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Ga/ Hf/ Fe/ Cr/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Ga/ Hf/ Fe/ Cr/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Ga/ Hf/ Fe/ Cr/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Ga/ Hf/ Fe/ Cr/ MnO MnO MnO MnO Mn/Mg/O Ga/ Hf/ Fe/ Cr/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Ga/ Hf/ Fe/ Cr/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Ga/ Hf/ Fe/ Cr/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Ga/ Hf/ Fe/ Cr/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Ga/ Hf/ Fe/ Cr/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Ga/ Hf/ Fe/ Cr/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Ga/ Hf/ Fe/ Cr/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Ga/ Hf/ Fe/ Cr/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Ga/ Hf/ Fe/ Cr/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Ga/ Hf/ Fe/ Cr/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Ga/ Hf/ Fe/ Cr/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Ga/ Hf/ Fe/ Cr/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Ga/ Hf/ Fe/ Cr/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6MnO.sub.8 Ga/ Hf/ Fe/ Cr/ (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 (Li,Mg).sub.6MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Ga/ Hf/ Fe/ Cr/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Ga/ Hf/ Fe/ Cr/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Ga/ Hf/ Fe/ Cr/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Ga/ Hf/ Fe/ Cr/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Ga/ Hf/ Fe/ Cr/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Ga/ Hf/ Fe/ Cr/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Ga/ Hf/ Fe/ Cr/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Ga/ Hf/ Fe/ Cr/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Ga/ Hf/ Fe/ Cr/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Ga/ Hf/ Fe/ Cr/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Ga/ Hf/ Fe/ Cr/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Ga/ Hf/ Fe/ Cr/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Ga/ Hf/ Fe/ Cr/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Ga/ Hf/ Fe/ Cr/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Ga/ Hf/ Fe/ Cr/ Y—La Y—La Y—La Y—La Zr—La Ga/ Hf/ Fe/ Cr/ Zr—La Zr—La Zr—La Zr—La Pr—La Ga/ Hf/ Fe/ Cr/ Pr—La Pr—La Pr—La Pr—La Ce—La Ga/ Hf/ Fe/ Cr/ Ce—La Ce—La Ce—La Ce—La
(280) TABLE-US-00006 TABLE 6 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW\Dop Ru Zr Ta Rh Li.sub.2O Ru/ Zr/ Ta/ Rh/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Ru/ Zr/ Ta/ Rh/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Ru/ Zr/ Ta/ Rh/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Ru/ Zr/ Ta/ Rh/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Ru/ Zr/ Ta/ Rh/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Ru/ Zr/ Ta/ Rh/ BeO BeO BeO BeO MgO Ru/ Zr/ Ta/ Rh/ MgO MgO MgO MgO CaO Ru/ Zr/ Ta/ Rh/ CaO CaO CaO CaO SrO Ru/ Zr/ Ta/ Rh/ SrO SrO SrO SrO BaO Ru/ Zr/ Ta/ Rh/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Ru/ Zr/ Ta/ Rh/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Ru/ Zr/ Ta/ Rh/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Ru/ Zr/ Ta/ Rh/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Ru/ Zr/ Ta/ Rh/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Ru/ Zr/ Ta/ Rh/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Ru/ Zr/ Ta/ Rh/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Ru/ Zr/ Ta/ Rh/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Ru/ Zr/ Ta/ Rh/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Ru/ Zr/ Ta/ Rh/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Ru/ Zr/ Ta/ Rh/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Ru/ Zr/ Ta/ Rh/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Ru/ Zr/ Ta/ Rh/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Ru/ Zr/ Ta/ Rh/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Ru/ Zr/ Ta/ Rh/ VO VO VO VO V.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Ru/ Zr/ Ta/ Rh/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Ru/ Zr/ Ta/ Rh/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Ru/ Zr/ Ta/ Rh/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Ru/ Zr/ Ta/ Rh/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Ru/ Zr/ Ta/ Rh/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Ru/ Zr/ Ta/ Rh/ NbO NbO NbO NbO NbO.sub.2 Ru/ Zr/ Ta/ Rh/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Ru/ Zr/ Ta/ Rh/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Ru/ Zr/ Ta/ Rh/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Ru/ Zr/ Ta/ Rh/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Ru/ Zr/ Ta/ Rh/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Ru/ Zr/ Ta/ Rh/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Ru/ Zr/ Ta/ Rh/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Ru/ Zr/ Ta/ Rh/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Ru/ Zr/ Ta/ Rh/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Ru/ Zr/ Ta/ Rh/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Ru/ Zr/ Ta/ Rh/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Ru/ Zr/ Ta/ Rh/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Ru/ Zr/ Ta/ Rh/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Ru/ Zr/ Ta/ Rh/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Ru/ Zr/ Ta/ Rh/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Ru/ Zr/ Ta/ Rh/ MnO MnO MnO MnO Mn/Mg/O Ru/ Zr/ Ta/ Rh/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Ru/ Zr/ Ta/ Rh/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Ru/ Zr/ Ta/ Rh/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Ru/ Zr/ Ta/ Rh/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Ru/ Zr/ Ta/ Rh/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Ru/ Zr/ Ta/ Rh/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Ru/ Zr/ Ta/ Rh/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Ru/ Zr/ Ta/ Rh/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Ru/ Zr/ Ta/ Rh/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Ru/ Zr/ Ta/ Rh/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Ru/ Zr/ Ta/ Rh/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Ru/ Zr/ Ta/ Rh/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Ru/ Zr/ Ta/ Rh/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6—MnO.sub.8 Ru/ Zr/ Ta/ Rh/ (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Ru/ Zr/ Ta/ Rh/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Ru/ Zr/ Ta/ Rh/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Ru/ Zr/ Ta/ Rh/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Ru/ Zr/ Ta/ Rh/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Ru/ Zr/ Ta/ Rh/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Ru/ Zr/ Ta/ Rh/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Ru/ Zr/ Ta/ Rh/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Ru/ Zr/ Ta/ Rh/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Ru/ Zr/ Ta/ Rh/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Ru/ Zr/ Ta/ Rh/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Ru/ Zr/ Ta/ Rh/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Ru/ Zr/ Ta/ Rh/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Ru/ Zr/ Ta/ Rh/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Ru/ Zr/ Ta/ Rh/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Ru/ Zr/ Ta/ Rh/ Y—La Y—La Y—La Y—La Zr—La Ru/ Zr/ Ta/ Rh/ Zr—La Zr—La Zr—La Zr—La Pr—La Ru/ Zr/ Ta/ Rh/ Pr—La Pr—La Pr—La Pr—La Ce—La Ru/ Zr/ Ta/ Rh/ Ce—La Ce—La Ce—La Ce—La NW\Dop Au Mo Ni Li.sub.2O Au/ Mo/ Ni/ Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Au/ Mo/ Ni/ Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Au/ Mo/ Ni/ K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Au/ Mo/ Ni/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Au/ Mo/ Ni/ Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Au/ Mo/ Ni/ BeO BeO BeO MgO Au/ Mo/ Ni/ MgO MgO MgO CaO Au/ Mo/ Ni/ CaO CaO CaO SrO Au/ Mo/ Ni/ SrO SrO SrO BaO Au/ Mo/ Ni/ BaO BaO BaO Sc.sub.2O.sub.3 Au/ Mo/ Ni/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Au/ Mo/ Ni/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Au/ Mo/ Ni/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Au/ Mo/ Ni/ CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Au/ Mo/ Ni/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Au/ Mo/ Ni/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Au/ Mo/ Ni/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Au/ Mo/ Ni/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Au/ Mo/ Ni/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Au/ Mo/ Ni/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Au/ Mo/ Ni/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Au/ Mo/ Ni/ TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Au/ Mo/ Ni/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Au/ Mo/ Ni/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Au/ Mo/ Ni/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Au/ Mo/ Ni/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Au/ Mo/ Ni/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Au/ Mo/ Ni/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Au/ Mo/ Ni/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Au/ Mo/ Ni/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Au/ Mo/ Ni/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Au/ Mo/ Ni/ ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Au/ Mo/ Ni/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Au/ Mo/ Ni/ PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Au/ Mo/ Ni/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Au/ Mo/ Ni/ TiO TiO TiO Ti.sub.2O.sub.3 Au/ Mo/ Ni/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Au/ Mo/ Ni/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Au/ Mo/ Ni/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Au/ Mo/ Ni/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Au/ Mo/ Ni/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Au/ Mo/ Ni/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Au/ Mo/ Ni/ HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Au/ Mo/ Ni/ VO VO VO V.sub.2O.sub.3 Au/ Mo/ Ni/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Au/ Mo/ Ni/ VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Au/ Mo/ Ni/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Au/ Mo/ Ni/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Au/ Mo/ Ni/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Au/ Mo/ Ni/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Au/ Mo/ Ni/ NbO NbO NbO NbO.sub.2 Au/ Mo/ Ni/ NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Au/ Mo/ Ni/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Au/ Mo/ Ni/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Au/ Mo/ Ni/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Au/ Mo/ Ni/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Au/ Mo/ Ni/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Au/ Mo/ Ni/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Au/ Mo/ Ni/ CrO CrO CrO Cr.sub.2O.sub.3 Au/ Mo/ Ni/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Au/ Mo/ Ni/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Au/ Mo/ Ni/ CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Au/ Mo/ Ni/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Au/ Mo/ Ni/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Au/ Mo/ Ni/ MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Au/ Mo/ Ni/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Au/ Mo/ Ni/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Au/ Mo/ Ni/ WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Au/ Mo/ Ni/ MnO MnO MnO Mn/Mg/O Au/ Mo/ Ni/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Au/ Mo/ Ni/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Au/ Mo/ Ni/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Au/ Mo/ Ni/ MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Au/ Mo/ Ni/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Au/ Mo/ Ni/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Au/ Mo/ Ni/ ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Au/ Mo/ Ni/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Au/ Mo/ Ni/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Au/ Mo/ Ni/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Au/ Mo/ Ni/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Au/ Mo/ Ni/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Au/ Mo/ Ni/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6—MnO.sub.8 Au/ Mo/ Ni/ (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Au/ Mo/ Ni/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Au/ Mo/ Ni/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Au/ Mo/ Ni/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Au/ Mo/ Ni/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Au/ Mo/ Ni/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Au/ Mo/ Ni/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Au/ Mo/ Ni/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Au/ Mo/ Ni/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Au/ Mo/ Ni/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Au/ Mo/ Ni/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Au/ Mo/ Ni/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Au/ Mo/ Ni/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Au/ Mo/ Ni/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Au/ Mo/ Ni/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Au/ Mo/ Ni/ Y—La Y—La Y—La Zr—La Au/ Mo/ Ni/ Zr—La Zr—La Zr—La Pr—La Au/ Mo/ Ni/ Pr—La Pr—La Pr—La Ce—La Au/ Mo/ Ni/ Ce—La Ce—La Ce—La
(281) TABLE-US-00007 TABLE 7 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW\Dop Co Sb W V Li.sub.2O Co/ Sb/ W/ V/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Co/ Sb/ W/ V/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Co/ Sb/ W/ V/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Co/ Sb/ W/ V/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Co/ Sb/ W/ V/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Co/ Sb/ W/ V/ BeO BeO BeO BeO MgO Co/ Sb/ W/ V/ MgO MgO MgO MgO CaO Co/ Sb/ W/ V/ CaO CaO CaO CaO SrO Co/ Sb/ W/ V/ SrO SrO SrO SrO BaO Co/ Sb/ W/ V/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Co/ Sb/ W/ V/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Co/ Sb/ W/ V/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Co/ Sb/ W/ V/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Co/ Sb/ W/ V/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Co/ Sb/ W/ V/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Co/ Sb/ W/ V/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Co/ Sb/ W/ V/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Co/ Sb/ W/ V/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Co/ Sb/ W/ V/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Co/ Sb/ W/ V/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Co/ Sb/ W/ V/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Co/ Sb/ W/ V/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Co/ Sb/ W/ V/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Co/ Sb/ W/ V/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Co/ Sb/ W/ V/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Co/ Sb/ W/ V/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Co/ Sb/ W/ V/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Co/ Sb/ W/ V/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Co/ Sb/ W/ V/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Co/ Sb/ W/ V/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Co/ Sb/ W/ V/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Co/ Sb/ W/ V/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Co/ Sb/ W/ V/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Co/ Sb/ W/ V/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Co/ Sb/ W/ V/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Co/ Sb/ W/ V/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Co/ Sb/ W/ V/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Co/ Sb/ W/ V/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Co/ Sb/ W/ V/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Co/ Sb/ W/ V/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Co/ Sb/ W/ V/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Co/ Sb/ W/ V/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Co/ Sb/ W/ V/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Co/ Sb/ W/ V/ VO VO VO VO V.sub.2O.sub.3 Co/ Sb/ W/ V/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Co/ Sb/ W/ V/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Co/ Sb/ W/ V/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Co/ Sb/ W/ V/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Co/ Sb/ W/ V/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Co/ Sb/ W/ V/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Co/ Sb/ W/ V/ NbO NbO NbO NbO NbO.sub.2 Co/ Sb/ W/ V/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Co/ Sb/ W/ V/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Co/ Sb/ W/ V/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Co/ Sb/ W/ V/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Co/ Sb/ W/ V/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Co/ Sb/ W/ V/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Co/ Sb/ W/ V/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Co/ Sb/ W/ V/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Co/ Sb/ W/ V/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Co/ Sb/ W/ V/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Co/ Sb/ W/ V/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Co/ Sb/ W/ V/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Co/ Sb/ W/ V/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Co/ Sb/ W/ V/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Co/ Sb/ W/ V/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Co/ Sb/ W/ V/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Co/ Sb/ W/ V/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Co/ Sb/ W/ V/ MnO MnO MnO MnO Mn/Mg/O Co/ Sb/ W/ V/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Co/ Sb/ W/ V/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Co/ Sb/ W/ V/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Co/ Sb/ W/ V/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Co/ Sb/ W/ V/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Co/ Sb/ W/ V/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Co/ Sb/ W/ V/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Co/ Sb/ W/ V/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Co/ Sb/ W/ V/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Co/ Sb/ W/ V/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Co/ Sb/ W/ V/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Co/ Sb/ W/ V/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Co/ Sb/ W/ V/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6—MnO.sub.8 Co/ Sb/ W/ V/ (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Co/ Sb/ W/ V/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Co/ Sb/ W/ V/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Co/ Sb/ W/ V/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Co/ Sb/ W/ V/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Co/ Sb/ W/ V/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Co/ Sb/ W/ V/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Co/ Sb/ W/ V/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Co/ Sb/ W/ V/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Co/ Sb/ W/ V/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Co/ Sb/ W/ V/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Co/ Sb/ W/ V/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Co/ Sb/ W/ V/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Co/ Sb/ W/ V/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Co/ Sb/ W/ V/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Co/ Sb/ W/ V/ Y—La Y—La Y—La Y—La Zr—La Co/ Sb/ W/ V/ Zr—La Zr—La Zr—La Zr—La Pr—La Co/ Sb/ W/ V/ Pr—La Pr—La Pr—La Pr—La Ce—La Co/ Sb/ W/ V/ Ce—La Ce—La Ce—La Ce—La NW\Dop Ag Te Pd Ir Li.sub.2O Ag/ Te/ Pd/ Ir/ Li.sub.2O Li.sub.2O Li.sub.2O Li.sub.2O Na.sub.2O Ag/ Te/ Pd/ Ir/ Na.sub.2O Na.sub.2O Na.sub.2O Na.sub.2O K.sub.2O Ag/ Te/ Pd/ Ir/ K.sub.2O K.sub.2O K.sub.2O K.sub.2O Rb.sub.2O Ag/ Te/ Pd/ Ir/ Rb.sub.2O Rb.sub.2O Rb.sub.2O Rb.sub.2O Cs.sub.2O Ag/ Te/ Pd/ Ir/ Cs.sub.2O Cs.sub.2O Cs.sub.2O Cs.sub.2O BeO Ag/ Te/ Pd/ Ir/ BeO BeO BeO BeO MgO Ag/ Te/ Pd/ Ir/ MgO MgO MgO MgO CaO Ag/ Te/ Pd/ Ir/ CaO CaO CaO CaO SrO Ag/ Te/ Pd/ Ir/ SrO SrO SrO SrO BaO Ag/ Te/ Pd/ Ir/ BaO BaO BaO BaO Sc.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Ag/ Te/ Pd/ Ir/ CeO.sub.2 CeO.sub.2 CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Ag/ Te/ Pd/ Ir/ TbO.sub.2 TbO.sub.2 TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Ag/ Te/ Pd/ Ir/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Ag/ Te/ Pd/ Ir/ ThO.sub.2 ThO.sub.2 ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Ag/ Te/ Pd/ Ir/ PaO.sub.2 PaO.sub.2 PaO.sub.2 PaO.sub.2 TiO.sub.2 Ag/ Te/ Pd/ Ir/ TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO.sub.2 TiO Ag/ Te/ Pd/ Ir/ TiO TiO TiO TiO Ti.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Ag/ Te/ Pd/ Ir/ Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.3O Ti.sub.2O Ag/ Te/ Pd/ Ir/ Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Ag/ Te/ Pd/ Ir/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Ag/ Te/ Pd/ Ir/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Ag/ Te/ Pd/ Ir/ ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Ag/ Te/ Pd/ Ir/ HfO.sub.2 HfO.sub.2 HfO.sub.2 HfO.sub.2 VO Ag/ Te/ Pd/ Ir/ VO VO VO VO V.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Ag/ Te/ Pd/ Ir/ VO.sub.2 VO.sub.2 VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Ag/ Te/ Pd/ Ir/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Ag/ Te/ Pd/ Ir/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Ag/ Te/ Pd/ Ir/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Ag/ Te/ Pd/ Ir/ V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Ag/ Te/ Pd/ Ir/ NbO NbO NbO NbO NbO.sub.2 Ag/ Te/ Pd/ Ir/ NbO.sub.2 NbO.sub.2 NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Ag/ Te/ Pd/ Ir/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Ag/ Te/ Pd/ Ir/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Ag/ Te/ Pd/ Ir/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Ag/ Te/ Pd/ Ir/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Ag/ Te/ Pd/ Ir/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Ag/ Te/ Pd/ Ir/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Ag/ Te/ Pd/ Ir/ CrO CrO CrO CrO Cr.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Ag/ Te/ Pd/ Ir/ CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.2 CrO.sub.3 Ag/ Te/ Pd/ Ir/ CrO.sub.3 CrO.sub.3 CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Ag/ Te/ Pd/ Ir/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Ag/ Te/ Pd/ Ir/ MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.2 MoO.sub.3 Ag/ Te/ Pd/ Ir/ MoO.sub.3 MoO.sub.3 MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Ag/ Te/ Pd/ Ir/ WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.2 WoO.sub.3 Ag/ Te/ Pd/ Ir/ WoO.sub.3 WoO.sub.3 WoO.sub.3 WoO.sub.3 MnO Ag/ Te/ Pd/ Ir/ MnO MnO MnO MnO Mn/Mg/O Ag/ Te/ Pd/ Ir/ Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Ag/ Te/ Pd/ Ir/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Ag/ Te/ Pd/ Ir/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Ag/ Te/ Pd/ Ir/ MnO.sub.2 MnO.sub.2 MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Ag/ Te/ Pd/ Ir/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Ag/ Te/ Pd/ Ir/ ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.2 ReO.sub.3 Ag/ Te/ Pd/ Ir/ ReO.sub.3 ReO.sub.3 ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Ag/ Te/ Pd/ Ir/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Ag/ Te/ Pd/ Ir/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Ag/ Te/ Pd/ Ir/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Ag/ Te/ Pd/ Ir/ NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Ag/ Te/ Pd/ Ir/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Ag/ Te/ Pd/ Ir/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6—MnO.sub.8 Ag/ Te/ Pd/ Ir/ (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Ag/ Te/ Pd/ Ir/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Ag/ Te/ Pd/ Ir/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Ag/ Te/ Pd/ Ir/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Ag/ Te/ Pd/ Ir/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Ag/ Te/ Pd/ Ir/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Ag/ Te/ Pd/ Ir/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Ag/ Te/ Pd/ Ir/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Ag/ Te/ Pd/ Ir/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Ag/ Te/ Pd/ Ir/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Ag/ Te/ Pd/ Ir/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Ag/ Te/ Pd/ Ir/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Ag/ Te/ Pd/ Ir/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Ag/ Te/ Pd/ Ir/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Ag/ Te/ Pd/ Ir/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Ag/ Te/ Pd/ Ir/ Y—La Y—La Y—La Y—La Zr—La Ag/ Te/ Pd/ Ir/ Zr—La Zr—La Zr—La Zr—La Pr—La Ag/ Te/ Pd/ Ir/ Pr—La Pr—La Pr—La Pr—La Ce—La Ag/ Te/ Pd/ Ir/ Ce—La Ce—La Ce—La Ce—La
(282) TABLE-US-00008 TABLE 8 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW\Dop Mn Ti Li.sub.2O Mn/ Ti/ Li.sub.2O Li.sub.2O Na.sub.2O Mn/ Ti/ Na.sub.2O Na.sub.2O K.sub.2O Mn/ Ti/ K.sub.2O K.sub.2O Rb.sub.2O Mn/ Ti/ Rb.sub.2O Rb.sub.2O Cs.sub.2O Mn/ Ti/ Cs.sub.2O Cs.sub.2O BeO Mn/ Ti/ BeO BeO MgO Mn/ Ti/ MgO MgO CaO Mn/ Ti/ CaO CaO SrO Mn/ Ti/ SrO SrO BaO Mn/ Ti/ BaO BaO Sc.sub.2O.sub.3 Mn/ Ti/ Sc.sub.2O.sub.3 Sc.sub.2O.sub.3 Y.sub.2O.sub.3 Mn/ Ti/ Y.sub.2O.sub.3 Y.sub.2O.sub.3 La.sub.2O.sub.3 Mn/ Ti/ La.sub.2O.sub.3 La.sub.2O.sub.3 CeO.sub.2 Mn/ Ti/ CeO.sub.2 CeO.sub.2 Ce.sub.2O.sub.3 Mn/ Ti/ Ce.sub.2O.sub.3 Ce.sub.2O.sub.3 Pr.sub.2O.sub.3 Mn/ Ti/ Pr.sub.2O.sub.3 Pr.sub.2O.sub.3 Nd.sub.2O.sub.3 Mn/ Ti/ Nd.sub.2O.sub.3 Nd.sub.2O.sub.3 Sm.sub.2O.sub.3 Mn/ Ti/ Sm.sub.2O.sub.3 Sm.sub.2O.sub.3 Eu.sub.2O.sub.3 Mn/ Ti/ Eu.sub.2O.sub.3 Eu.sub.2O.sub.3 Gd.sub.2O.sub.3 Mn/ Ti/ Gd.sub.2O.sub.3 Gd.sub.2O.sub.3 Tb.sub.2O.sub.3 Mn/ Ti/ Tb.sub.2O.sub.3 Tb.sub.2O.sub.3 TbO.sub.2 Mn/ Ti/ TbO.sub.2 TbO.sub.2 Tb.sub.6O.sub.11 Mn/ Ti/ Tb.sub.6O.sub.11 Tb.sub.6O.sub.11 Dy.sub.2O.sub.3 Mn/ Ti/ Dy.sub.2O.sub.3 Dy.sub.2O.sub.3 Ho.sub.2O.sub.3 Mn/ Ti/ Ho.sub.2O.sub.3 Ho.sub.2O.sub.3 Er.sub.2O.sub.3 Mn/ Ti/ Er.sub.2O.sub.3 Er.sub.2O.sub.3 Tm.sub.2O.sub.3 Mn/ Ti/ Tm.sub.2O.sub.3 Tm.sub.2O.sub.3 Yb.sub.2O.sub.3 Mn/ Ti/ Yb.sub.2O.sub.3 Yb.sub.2O.sub.3 Lu.sub.2O.sub.3 Mn/ Ti/ Lu.sub.2O.sub.3 Lu.sub.2O.sub.3 Ac.sub.2O.sub.3 Mn/ Ti/ Ac.sub.2O.sub.3 Ac.sub.2O.sub.3 Th.sub.2O.sub.3 Mn/ Ti/ Th.sub.2O.sub.3 Th.sub.2O.sub.3 ThO.sub.2 Mn/ Ti/ ThO.sub.2 ThO.sub.2 Pa.sub.2O.sub.3 Mn/ Ti/ Pa.sub.2O.sub.3 Pa.sub.2O.sub.3 PaO.sub.2 Mn/ Ti/ PaO.sub.2 PaO.sub.2 TiO.sub.2 Mn/ Ti/ TiO.sub.2 TiO.sub.2 TiO Mn/ Ti/ TiO TiO Ti.sub.2O.sub.3 Mn/ Ti/ Ti.sub.2O.sub.3 Ti.sub.2O.sub.3 Ti.sub.3O Mn/ Ti/ Ti.sub.3O Ti.sub.3O Ti.sub.2O Mn/ Ti/ Ti.sub.2O Ti.sub.2O Ti.sub.3O.sub.5 Mn/ Ti/ Ti.sub.3O.sub.5 Ti.sub.3O.sub.5 Ti.sub.4O.sub.7 Mn/ Ti/ Ti.sub.4O.sub.7 Ti.sub.4O.sub.7 ZrO.sub.2 Mn/ Ti/ ZrO.sub.2 ZrO.sub.2 HfO.sub.2 Mn/ Ti/ HfO.sub.2 HfO.sub.2 VO Mn/ Ti/ VO VO V.sub.2O.sub.3 Mn/ Ti/ V.sub.2O.sub.3 V.sub.2O.sub.3 VO.sub.2 Mn/ Ti/ VO.sub.2 VO.sub.2 V.sub.2O.sub.5 Mn/ Ti/ V.sub.2O.sub.5 V.sub.2O.sub.5 V.sub.3O.sub.7 Mn/ Ti/ V.sub.3O.sub.7 V.sub.3O.sub.7 V.sub.4O.sub.9 Mn/ Ti/ V.sub.4O.sub.9 V.sub.4O.sub.9 V.sub.6O.sub.13 Mn/ Ti/ V.sub.6O.sub.13 V.sub.6O.sub.13 NbO Mn/ Ti/ NbO NbO NbO.sub.2 Mn/ Ti/ NbO.sub.2 NbO.sub.2 Nb.sub.2O.sub.5 Mn/ Ti/ Nb.sub.2O.sub.5 Nb.sub.2O.sub.5 Nb.sub.8O.sub.19 Mn/ Ti/ Nb.sub.8O.sub.19 Nb.sub.8O.sub.19 Nb.sub.16O.sub.38 Mn/ Ti/ Nb.sub.16O.sub.38 Nb.sub.16O.sub.38 Nb.sub.12O.sub.29 Mn/ Ti/ Nb.sub.12O.sub.29 Nb.sub.12O.sub.29 Nb.sub.47O.sub.116 Mn/ Ti/ Nb.sub.47O.sub.116 Nb.sub.47O.sub.116 Ta.sub.2O.sub.5 Mn/ Ti/ Ta.sub.2O.sub.5 Ta.sub.2O.sub.5 CrO Mn/ Ti/ CrO CrO Cr.sub.2O.sub.3 Mn/ Ti/ Cr.sub.2O.sub.3 Cr.sub.2O.sub.3 CrO.sub.2 Mn/ Ti/ CrO.sub.2 CrO.sub.2 CrO.sub.3 Mn/ Ti/ CrO.sub.3 CrO.sub.3 Cr.sub.8O.sub.21 Mn/ Ti/ Cr.sub.8O.sub.21 Cr.sub.8O.sub.21 MoO.sub.2 Mn/ Ti/ MoO.sub.2 MoO.sub.2 MoO.sub.3 Mn/ Ti/ MoO.sub.3 MoO.sub.3 W.sub.2O.sub.3 Mn/ Ti/ W.sub.2O.sub.3 W.sub.2O.sub.3 WoO.sub.2 Mn/ Ti/ WoO.sub.2 WoO.sub.2 WoO.sub.3 Mn/ Ti/ WoO.sub.3 WoO.sub.3 MnO Mn/ Ti/ MnO MnO Mn/Mg/O Mn/ Ti/ Mn/Mg/O Mn/Mg/O Mn.sub.3O.sub.4 Mn/ Ti/ Mn.sub.3O.sub.4 Mn.sub.3O.sub.4 Mn.sub.2O.sub.3 Mn/ Ti/ Mn.sub.2O.sub.3 Mn.sub.2O.sub.3 MnO.sub.2 Mn/ Ti/ MnO.sub.2 MnO.sub.2 Mn.sub.2O.sub.7 Mn/ Ti/ Mn.sub.2O.sub.7 Mn.sub.2O.sub.7 ReO.sub.2 Mn/ Ti/ ReO.sub.2 ReO.sub.2 ReO.sub.3 Mn/ Ti/ ReO.sub.3 ReO.sub.3 Re.sub.2O.sub.7 Mn/ Ti/ Re.sub.2O.sub.7 Re.sub.2O.sub.7 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mn/ Ti/ Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3Mn.sub.3—B.sub.2O.sub.10 Mg.sub.3(BO.sub.3).sub.2 Mn/ Ti/ Mg.sub.3(BO.sub.3).sub.2 Mg.sub.3(BO.sub.3).sub.2 NaWO.sub.4 Mn/ Ti/ NaWO.sub.4 NaWO.sub.4 Mg.sub.6MnO.sub.8 Mn/ Ti/ Mg.sub.6MnO.sub.8 Mg.sub.6MnO.sub.8 Mn.sub.2O.sub.4 Mn/ Ti/ Mn.sub.2O.sub.4 Mn.sub.2O.sub.4 (Li,Mg).sub.6—MnO.sub.8 Mn/ Mn/ (Li,Mg).sub.6—MnO.sub.8 (Li,Mg).sub.6—MnO.sub.8 Na.sub.4P.sub.2O.sub.7 Mn/ Ti/ Na.sub.4P.sub.2O.sub.7 Na.sub.4P.sub.2O.sub.7 Mo.sub.2O.sub.8 Mn/ Ti/ Mo.sub.2O.sub.8 Mo.sub.2O.sub.8 Mn.sub.3O.sub.4/WO.sub.4 Mn/ Ti/ Mn.sub.3O.sub.4/WO.sub.4 Mn.sub.3O.sub.4/WO.sub.4 Na.sub.2WO.sub.4 Mn/ Ti/ Na.sub.2WO.sub.4 Na.sub.2WO.sub.4 Zr.sub.2Mo.sub.2O.sub.8 Mn/ Ti/ Zr.sub.2Mo.sub.2O.sub.8 Zr.sub.2Mo.sub.2O.sub.8 NaMnO.sub.4—/ Mn/ Ti/ MgO NaMnO.sub.4—/ NaMnO.sub.4—/ MgO MgO Na.sub.10Mn—W.sub.5O.sub.17 Mn/ Ti/ Na.sub.10Mn—W.sub.5O.sub.17 Na.sub.10Mn—W.sub.5O.sub.17 La.sub.3NdO.sub.6 Mn/ Ti/ La.sub.3NdO.sub.6 La.sub.3NdO.sub.6 LaNd.sub.3O.sub.6 Mn/ Ti/ LaNd.sub.3O.sub.6 LaNd.sub.3O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 Mn/ Ti/ La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.1,5Nd.sub.2,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 Mn/ Ti/ La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.2,5Nd.sub.1,5O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 Mn/ Ti/ La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,2Nd.sub.0,8O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 Mn/ Ti/ La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,5Nd.sub.0,5O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Mn/ Ti/ La.sub.3,8Nd.sub.0,2O.sub.6 La.sub.3,8Nd.sub.0,2O.sub.6 Y—La Mn/ Ti/ Y—La Y—La Zr—La Mn/ Ti/ Zr—La Zr—La Pr—La Mn/ Ti/ Pr—La Pr—La Ce—La Mn/ Ti/ Ce—La Ce—La
(283) TABLE-US-00009 TABLE 9 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW Dop La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Eu/Na Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Na Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Zr/Eu/Ca Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/Na Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Sm/Ho/Tm Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Zr Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Mg/La/K Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/K/Mg/Tm Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Dy/K Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/La/Dy Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/La/Eu Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/La/Eu/In Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Ce Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Na/La/K Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/La/Li/Cs Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 K/La K/La/ K/La/ K/La/ K/La/ K/La/ K/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 K/La/S K/La/S/ K/La/S/ K/La/S/ K/La/S/ K/La/S/ K/La/S/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 K/Na K/Na/ K/Na/ K/Na/ K/Na/ K/Na/ K/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Cs/La Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Cs/La/Tm Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Tb Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Li/Cs/Sr/Tm Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Sr/Cs Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Sr/Zn/K Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Ga/Cs Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/K/Sr/La Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Na Li/Na/ Li/Na/ Li/Na/ Li/Na/ Li/Na/ Li/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Na/Rb/Ga Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Na/Sr Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Na/Sr/La Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Sm/Cs Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ba/Sm/Yb/S Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Ce/K Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Ba/Tm/K/La Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ba/Tm/Zn/K Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ La2O3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cs/K/La Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cs/La/Tm/Na Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cs/Li/K/La Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sm/Li/Sr/Cs Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Cs/La Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Tm/Li/Cs Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zn/K Zn/K/ Zn/K/ Zn/K/ Zn/K/ Zn/K/ Zn/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zr/Cs/K/La Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Ca/In/Ni Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Ho/Tm Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Nd/S La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Rb/Ca Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/K Li/K/ Li/K/ Li/K/ Li/K/ Li/K/ Li/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Tm/Lu/Ta/P Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Ca/Dy/P Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/La/Yb/Zn Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Zr/K Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Rb/Sr/Lu Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Sr/Lu/Nb Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Eu/Hf Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Dy/Rb/Gd Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Pt/Bi Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Hf Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Cs Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Mg/Na Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Hf/Bi Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Sn Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Pr/K Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Nb Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zr/W Zr/W/ Zr/W/ Zr/W/ Zr/W/ Zr/W/ Zr/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Y/W Y/W/ Y/W/ Y/W/ Y/W/ Y/W/ Y/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/W Na/W/ Na/W/ Na/W/ Na/W/ Na/W/ Na/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Bi/W Bi/W/ Bi/W/ Bi/W/ Bi/W/ Bi/W/ Bi/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Bi/Cs Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Bi/Ca Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Bi/Sn Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Bi/Sb Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ge/Hf Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Hf/Sm Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Ag Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Bi Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Au Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Sm Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Tb/K Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Sb/Sr Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/W Sb/W/ Sb/W/ Sb/W/ Sb/W/ Sb/W/ Sb/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Hf Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Yb Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb/Sn Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/Au Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/Ta Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/Sr Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/Pb Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb/Ag Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Au/Sr Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Hf/K Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ W/Ge W/Ge/ W/Ge/ W/Ge/ W/Ge/ W/Ge/ W/Ge/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ta/Sr Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ta/Hf Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 W/Au W/Au/ W/Au/ W/Au/ W/Au/ W/Au/ W/Au/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/W Ca/W/ Ca/W/ Ca/W/ Ca/W/ Ca/W/ Ca/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sm/Li Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/K La/K/ La/K/ La/K/ La/K/ La/K/ La/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zn/Cs Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/K/Mg Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zr/Cs Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Ce Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Li/Cs Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Sr Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Dy/K La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Pr Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Dy/K Dy/K/ Dy/K/ Dy/K/ Dy/K/ Dy/K/ Dy/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Nd/In/K Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 In/Sr In/Sr/ In/Sr/ In/Sr/ In/Sr/ In/Sr/ In/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Cs Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Ga/Tm/Cs Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ga/Cs Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Lu/Fe Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Tm Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Dy La/Dy/ La/Dy/ La/Dy/ La/Dy/ La/Dy/ La/Dy/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sm/Li/Sr Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/K Mg/K/ Mg/K/ Mg/K/ Mg/K/ Mg/K/ Mg/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Rb/Ga Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/Cs/Tm Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zr/K Zr/K/ Zr/K/ Zr/K/ Zr/K/ Zr/K/ Zr/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Hf/Rb Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Li/K/La Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ce/Zr/La Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Al/La Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Zn/La Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Cs/Zn Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sm/Cs Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 In/K In/K/ In/K/ In/K/ In/K/ In/K/ In/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ho/Cs/Li/La Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cs/La/Na Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/S/Sr La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Lu/Tl Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Pr/Zn Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Sr/La Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Sr/Eu/Ca Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/B Sr/B/ Sr/B/ Sr/B/ Sr/B/ Sr/B/ Sr/B/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/ K/Cs/Sr/La K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Sr/Lu Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Eu/Dy Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Lu/Nb Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Dy/Gd La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Mg/Tl/P Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Pt Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Gd/Li/K Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/K/Lu Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/La/Dy/S Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Ce/Co Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Ce Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Ga/Gd/Al Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ba/Rh/Ta Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ba/Ta Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Al/Bi Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cs/Eu/S Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sm/Tm/Yb/Fe Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sm/Tm/Yb Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Hf/Zr/Ta Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Gd/Li/K Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Gd/Ho/Al/P Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Ca/Lu Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cu/Sn Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ag/Au Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Al/Bi Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Al/Mo Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Al/Nb Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Au/Pt Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ga/Bi Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/W Mg/W/ Mg/W/ Mg/W/ Mg/W/ Mg/W/ Mg/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Pb/Au Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sn/Mg Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zn/Bi Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Ta Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na Na/ Na/ Na/ Na/ Na/ Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr Sr/ Sr/ Sr/ Sr/ Sr/ Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca Ca/ Ca/ Ca/ Ca/ Ca/ Ca/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Yb Yb/ Yb/ Yb/ Yb/ Yb/ Yb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Cs Cs/ Cs/ Cs/ Cs/ Cs/ Cs/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sb Sb/ Sb/ Sb/ Sb/ Sb/ Sb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Gd/Ho Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Zr/Bi Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ho/Sr Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Gd/Ho/Sr Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Sr Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Na/Zr/Eu/Tm Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Ho/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Tm/Na La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Pb Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/W/Li Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Hf Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Nd La/Nd/ La/Nd/ La/Nd/ La/Nd/ La/Nd/ La/Nd/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Sm La/Sm/ La/Sm/ La/Sm/ La/Sm/ La/Sm/ La/Sm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Ce La/Ce/ La/Ce/ La/Ce/ La/Ce/ La/Ce/ La/Ce/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Sr La/Sr/ La/Sr/ La/Sr/ La/Sr/ La/Sr/ La/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Nd/Sr La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Bi/Sr La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Ce/Nd/Sr La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Bi/Ce/Nd/Sr La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Eu/Gd Eu/Gd/ Eu/Gd/ Eu/Gd/ Eu/Gd/ Eu/Gd/ Eu/Gd/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ca/Na Ca/Na/ Ca/Na/ Ca/Na/ Ca/Na/ Ca/Na/ Ca/Na/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Eu/Sm Eu/Sm/ Eu/Sm/ Eu/Sm/ Eu/Sm/ Eu/Sm/ Eu/Sm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Eu/Sr Eu/Sr/ Eu/Sr/ Eu/Sr/ Eu/Sr/ Eu/Sr/ Eu/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/Sr Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Ce/Mg Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Gd/Sm Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Au/Pb Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Bi/Hf Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/S Rb/S/ Rb/S/ Rb/S/ Rb/S/ Rb/S/ Rb/S/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Sr/Nd Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Eu/Y Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/Nd Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Mg/Nd/Fe Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 La.sub.3NdO.sub.6 Rb/Sr Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ La.sub.2O.sub.3 Nd.sub.2O.sub.3 Yb.sub.2O.sub.3 Eu.sub.2O.sub.3 Sm.sub.2O.sub.3 Rb/Sr/
(284) TABLE-US-00010 TABLE 10 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) NW Dop La.sub.4−XNd.sub.XO.sub.6* LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Eu/Na Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Na Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Zr/Eu/Ca Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/Na Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Sm/Ho/Tm Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/La/K Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/K/Mg/Tm Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Dy/K Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/B Sr/B/ Sr/B/ Sr/B/ Sr/B/ Sr/B/ Sr/B/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/La/Dy Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/La/Eu Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/La/Eu/In Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/La/K Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/La/Li/Cs Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 K/La K/La/ K/La/ K/La/ K/La/ K/La/ K/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 K/La/S K/La/S/ K/La/S/ K/La/S/ K/La/S/ K/La/S/ K/La/S/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 K/Na K/Na/ K/Na/ K/Na/ K/Na/ K/Na/ K/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Cs/La Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Cs/La/Tm Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Cs/Sr/Tm Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Sr/Cs Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Sr/Zn/K Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Pr Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Ga/Cs Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/K/Sr/La Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Na Li/Na/ Li/Na/ Li/Na/ Li/Na/ Li/Na/ Li/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Na/Rb/Ga Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Na/Sr Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Na/Sr/La Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Sm/Cs Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ba/Sm/Yb/S Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ba/Tm/K/La Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ba/Tm/Zn/K Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cs/K/La Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Pr/K Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cs/La/Tm/Na Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cs/Li/K/La Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sm/Li/Sr/Cs Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Cs/La Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Tm/Li/Cs Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zn/K Zn/K/ Zn/K/ Zn/K/ Zn/K/ Zn/K/ Zn/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zr/Cs/K/La Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Ca/In/Ni Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Ho/Tm Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/Nd/S La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Hf/Rb Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Rb/Ca Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/K Li/K/ Li/K/ Li/K/ Li/K/ Li/K/ Li/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Tm/Lu/Ta/P Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Ca/Dy/P Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/La/Yb/Zn Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Sr/Lu Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Sr/Lu/Nb Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Eu/Hf Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Dy/Rb/Gd Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Pt/Bi Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Hf Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Cs Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Mg/Na Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Hf/Bi Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Sn Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Nb Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zr/W Zr/W/ Zr/W/ Zr/W/ Zr/W/ Zr/W/ Zr/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Hf/K Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Y/W Y/W/ Y/W/ Y/W/ Y/W/ Y/W/ Y/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/W Na/W/ Na/W/ Na/W/ Na/W/ Na/W/ Na/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Bi/W Bi/W/ Bi/W/ Bi/W/ Bi/W/ Bi/W/ Bi/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Bi/Cs Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Bi/Ca Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Bi/Sn Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Bi/Sb Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ge/Hf Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Hf/Sm Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Ag Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Bi Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Au Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Zr Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Sm Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Sr Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/W Sb/W/ Sb/W/ Sb/W/ Sb/W/ Sb/W/ Sb/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Hf Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Yb Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb/Sn Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/Au Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/Ta Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/Sr Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/Pb Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb/Ag Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Au/Sr Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 W/Ge W/Ge/ W/Ge/ W/Ge/ W/Ge/ W/Ge/ W/Ge/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ta/Sr Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ta/Hf Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 W/Au W/Au/ W/Au/ W/Au/ W/Au/ W/Au/ W/Au/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Tb Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/W Ca/W/ Ca/W/ Ca/W/ Ca/W/ Ca/W/ Ca/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sm/Li Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/K La/K/ La/K/ La/K/ La/K/ La/K/ La/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zn/Cs Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/K/Mg Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zr/Cs Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Ce Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Li/Cs Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Sr Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/Dy/K La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Dy/K Dy/K/ Dy/K/ Dy/K/ Dy/K/ Dy/K/ Dy/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Nd/In/K Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 In/Sr In/Sr/ In/Sr/ In/Sr/ In/Sr/ In/Sr/ In/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Cs Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Ce Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Ga/Tm/Cs Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ga/Cs Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Lu/Fe Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Tm Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/Dy La/Dy/ La/Dy/ La/Dy/ La/Dy/ La/Dy/ La/Dy/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sm/Li/Sr Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Zr/K Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/K Mg/K/ Mg/K/ Mg/K/ Mg/K/ Mg/K/ Mg/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Rb/Ga Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Cs/Tm Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zr/K Zr/K/ Zr/K/ Zr/K/ Zr/K/ Zr/K/ Zr/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Li/K/La Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ce/Zr/La Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Al/La Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Zn/La Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Cs/Zn Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sm/Cs Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 In/K In/K/ In/K/ In/K/ In/K/ In/K/ In/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ho/Cs/Li/La Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cs/La/Na Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/S/Sr La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Lu/Tl Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Pr/Zn Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Sr/La Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Ce/K Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Sr/Eu/Ca Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 K/Cs/Sr/La K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Sr/Lu Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Eu/Dy Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Lu/Nb Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/Dy/Gd La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Mg/Tl/P Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Pt Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Gd/Li/K Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/K/Lu Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/La/Dy/S Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Ce/Co Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Ce Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Ga/Gd/Al Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ba/Rh/Ta Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ba/Ta Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Al/Bi Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cs/Eu/S Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sm/Tm/Yb/Fe Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sm/Tm/Yb Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Hf/Zr/Ta Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Tb/K Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Gd/Li/K Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Gd/Ho/Al/P Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Ca/Lu Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cu/Sn Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ag/Au Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Al/Bi Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Al/Mo Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Al/Nb Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Au/Pt Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ga/Bi Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/W Mg/W/ Mg/W/ Mg/W/ Mg/W/ Mg/W/ Mg/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Pb/Au Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sn/Mg Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zn/Bi Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Ta Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na Na/ Na/ Na/ Na/ Na/ Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr Sr/ Sr/ Sr/ Sr/ Sr/ Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca Ca/ Ca/ Ca/ Ca/ Ca/ Ca/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Yb Yb/ Yb/ Yb/ Yb/ Yb/ Yb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Cs Cs/ Cs/ Cs/ Cs/ Cs/ Cs/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sb Sb/ Sb/ Sb/ Sb/ Sb/ Sb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Gd/Ho Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Zr/Bi Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ho/Sr Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Gd/Ho/Sr Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Sr Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Na/Zr/Eu/Tm Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Ho/Tm/Na Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Pb Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/W/Li Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Hf Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/Sr Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Ce/Mg Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Gd/Sm Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Au/Pb Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Bi/Hf Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/S Rb/S/ Rb/S/ Rb/S/ Rb/S/ Rb/S/ Rb/S/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Sr/Nd Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Eu/Y Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/Nd Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Mg/Nd/Fe Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 Rb/Sr Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ La.sub.4−XNd.sub.XO.sub.6 LaNd.sub.3O.sub.6 La.sub.1.5Nd.sub.2.5O.sub.6 La.sub.2.5Nd.sub.1.5O.sub.6 La.sub.3.2Nd.sub.0.8O.sub.6 La.sub.3.5Nd.sub.0.5O.sub.6 *x is a number ranging from greater than 0 to less than 4
(285) TABLE-US-00011 TABLE 11 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) Dop\NW La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Eu/Na Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Na Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Zr/Eu/Ca Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—Laa Ce—La Mg/Na Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Sm/Ho/Tm Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Mg/La/K Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/K/Mg/Tm Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Dy/K Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/La/Dy Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/La/Eu Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/La/Eu/In Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/La/K Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/La/Li/Cs Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La K/La K/La/ K/La/ K/La/ K/La/ K/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La K/La/S K/La/S/ K/La/S/ K/La/S/ K/La/S/ K/La/S/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La K/Na K/Na/ K/Na/ K/Na/ K/Na/ K/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Cs/La Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Pr/K Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Cs/La/Tm Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Cs/Sr/Tm Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Sr/Cs Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Sr/Zn/K Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Ga/Cs Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/K/Sr/La Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Na Li/Na/ Li/Na/ Li/Na/ Li/Na/ Li/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Na/Rb/Ga Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Na/Sr Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Na/Sr/La Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Sm/Cs Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ba/Sm/Yb/S Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ba/Tm/K/La Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ba/Tm/Zn/K Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Tb/K Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La C + s/K/La Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Cs/La/Tm/Na Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Cs/Li/K/La Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sm/Li/Sr/Cs Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Cs/La Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Tm/Li/Cs Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zn/K Zn/K/ Zn/K/ Zn/K/ Zn/K/ Zn/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zr/Cs/K/La Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Ca/In/Ni Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Ho/Tm Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Nd/S La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Rb/Ca Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/K Li/K/ Li/K/ Li/K/ Li/K/ Li/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Tm/Lu/Ta/P Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Ca/Dy/P Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Mg/La/Yb/Zn Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Sr/Lu Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/B Sr/B/ Sr/B/ Sr/B/ Sr/B/ Sr/B/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Sr/Lu/Nb Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Eu/Hf Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Dy/Rb/Gd Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Pt/Bi Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Hf Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Cs Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Mg/Na Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Hf/Bi Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Sn Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Nb Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zr/W Zr/W/ Zr/W/ Zr/W/ Zr/W/ Zr/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Y/W Y/W/ Y/W/ Y/W/ Y/W/ Y/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/W Na/W/ Na/W/ Na/W/ Na/W/ Na/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Bi/W Bi/W/ Bi/W/ Bi/W/ Bi/W/ Bi/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Bi/Cs Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Bi/Ca Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Pr Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Bi/Sn Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Bi/Sb Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ge/Hf Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Hf/Sm Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Ag Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Bi Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Au Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Sm Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Sr Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/W Sb/W/ Sb/W/ Sb/W/ Sb/W/ Sb/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Hf Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Yb Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Hf/K Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb/Sn Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/Au Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/Ta Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/Sr Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/Pb Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Yb/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb/Ag Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Au/Sr Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La W/Ge W/Ge/ W/Ge/ W/Ge/ W/Ge/ W/Ge/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Hf/Rb Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ta/Sr Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ta/Hf Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La W/Au W/Au/ W/Au/ W/Au/ W/Au/ W/Au/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/W Ca/W/ Ca/W/ Ca/W/ Ca/W/ Ca/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sm/Li Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/K La/K/ La/K/ La/K/ La/K/ La/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zn/Cs Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/K/Mg Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zr/Cs Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Ce Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Zr/K Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Li/Cs Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Sr Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Dy/K La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Dy/K Dy/K/ Dy/K/ Dy/K/ Dy/K/ Dy/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Nd/In/K Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La In/Sr In/Sr/ In/Sr/ In/Sr/ In/Sr/ In/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Cs Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Ga/Tm/Cs Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ga/Cs Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Zr Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Lu/Fe Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Tm Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Dy La/Dy/ La/Dy/ La/Dy/ La/Dy/ La/Dy/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sm/Li/Sr Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Mg/K Mg/K/ Mg/K/ Mg/K/ Mg/K/ Mg/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Rb/Ga Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Cs/Tm Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zr/K Zr/K/ Zr/K/ Zr/K/ Zr/K/ Zr/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Ce Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Li/K/La Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ce/Zr/La Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Al/La Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Zn/La Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Cs/Zn Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sm/Cs Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La In/K In/K/ In/K/ In/K/ In/K/ In/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ho/Cs/Li/La Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Cs/La/Na Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/S/Sr La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Lu/Tl Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Pr/Zn Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Sr/La Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Sr/Eu/Ca Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La K/Cs/Sr/La K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Sr/Lu Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Eu/Dy Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Lu/Nb Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Tb Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Dy/Gd La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Mg/Tl/P Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Pt Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Gd/Li/K Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/K/Lu Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/La/Dy/S Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Ce/Co Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Ce Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Ga/Gd/Al Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ba/Rh/Ta Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ba/Ta Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Al/Bi Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Cs/Eu/S Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sm/Tm/Yb/Fe Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sm/Tm/Yb Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Hf/Zr/Ta Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Gd/Li/K Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—Lai/K Ce—La Gd/Ho/Al/P Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Ca/Lu Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Cu/Sn Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ag/Au Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Al/Bi Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Al/Mo Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Al/Nb Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Ce/K Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Au/Pt Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ga/Bi Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Mg/W Mg/W/ Mg/W/ Mg/W/ Mg/W/ Mg/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Pb/Au Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sn/Mg Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zn/Bi Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Ta Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na Na/ Na/ Na/ Na/ Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr Sr/ Sr/ Sr/ Sr/ Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca Ca/ Ca/ Ca/ Ca/ Ca/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Yb Yb/ Yb/ Yb/ Yb/ Yb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Cs Cs/ Cs/ Cs/ Cs/ Cs/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sb Sb/ Sb/ Sb/ Sb/ Sb/ La.sub.3.8Nd.sub.0.2O.sub.6/ Y—La/ Zr—La/ Pr—La/ Ce—La/ Zn/Bi Zn/Bi Zn/Bi Zn/Bi Zn/Bi Gd/Ho Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Zr/Bi Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ho/Sr Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Gd/Ho/Sr Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Sr Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Na/Zr/Eu/Tm Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Ho/Tm/Na Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Pb Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/W/Li Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Hf Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Au/Re/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Sr/W/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Nd La/Nd/ La/Nd/ La/Nd/ La/Nd/ La/Nd/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Sm La/Sm/ La/Sm/ La/Sm/ La/Sm/ La/Sm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Ce La/Ce/ La/Ce/ La/Ce/ La/Ce/ La/Ce/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Sr La/Sr/ La/Sr/ La/Sr/ La/Sr/ La/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Nd/Sr La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Bi/Sr La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Ce/Nd/Sr La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Bi/Ce/Nd/Sr La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Eu/Gd Eu/Gd/ Eu/Gd/ Eu/Gd/ Eu/Gd/ Eu/Gd/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ca/Na Ca/Na/ Ca/Na/ Ca/Na/ Ca/Na/ Ca/Na/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Eu/Sm Eu/Sm/ Eu/Sm/ Eu/Sm/ Eu/Sm/ Eu/Sm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Eu/Sr Eu/Sr/ Eu/Sr/ Eu/Sr/ Eu/Sr/ Eu/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Mg/Sr Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Ce/Mg Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Gd/Sm Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Au/Pb Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Bi/Hf Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/S Rb/S/ Rb/S/ Rb/S/ Rb/S/ Rb/S/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Sr/Nd Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Eu/Y Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Mg/Nd Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ La/Mg/ La.sub.3.8Nd.sub.0.2O.sub.6 NY—La Zr—La Pr—La Ce—La Mg/Nd/Fe Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La Rb/Sr Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ La.sub.3.8Nd.sub.0.2O.sub.6 Y—La Zr—La Pr—La Ce—La
(286) TABLE-US-00012 TABLE 12 NANOWIRES (NW) DOPED WITH SPECIFIC DOPANTS (DOP) Dop\NW Ln1.sub.4−xLn2.sub.xO.sub.6* La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Eu/Na Eu/Na/ Eu/Na/ Eu/Na/ Eu/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Na Sr/Na/ Sr/Na/ Sr/Na/ Sr/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Zr/Eu/Ca Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Na/Zr/Eu/Ca/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/Na Mg/Na/ Mg/Na/ Mg/Na/ Mg/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Sm/Ho/Tm Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Sr/Sm/Ho/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/La/K Mg/La/K/ Mg/La/K/ Mg/La/K/ Mg/La/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/K/Mg/Tm Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Na/K/Mg/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Dy/K Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Na/Dy/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/La/Dy Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Na/La/Dy/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/La/Eu Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Na/La/Eu/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/La/Eu/In Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Na/La/Eu/In/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/La/K Na/La/K/ Na/La/K/ Na/La/K/ Na/La/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/La/Li/Cs Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Na/La/Li/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO K/La K/La/ K/La/ K/La/ K/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO K/La/S K/La/S/ K/La/S/ K/La/S/ K/La/S/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO K/Na K/Na/ K/Na/ K/Na/ K/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Cs/La Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Li/Cs/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Cs/La/Tm Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Li/Cs/La/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Cs/Sr/Tm Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Li/Cs/Sr/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Sr/Cs Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Li/Sr/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Sr/Zn/K Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Li/Sr/Zn/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Ga/Cs Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Li/Ga/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/K/Sr/La Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Li/K/Sr/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Na Li/Na/ Li/Na/ Li/Na/ Li/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Na/Rb/Ga Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Li/Na/Rb/Ga/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Zr Sr/Zr/ Sr/Zr/ Sr/Zr/ Sr/Zr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Na/Sr Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Li/Na/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Na/Sr/La Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Li/Na/Sr/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Sm/Cs Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Li/Sm/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ba/Sm/Yb/S Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ba/Sm/Yb/S/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ba/Tm/K/La Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ba/Tm/K/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ba/Tm/Zn/K Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ba/Tm/Zn/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cs/K/La Cs/K/La/ Cs/K/La/ Cs/K/La/ Cs/K/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cs/La/Tm/Na Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Cs/La/Tm/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cs/Li/K/La Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Cs/Li/K/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sm/Li/Sr/Cs Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Sm/Li/Sr/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Cs/La Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Sr/Cs/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Tm/Li/Cs Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Sr/Tm/Li/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zn/K Zn/K/ Zn/K/ Zn/K/ Zn/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zr/Cs/K/La Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Zr/Cs/K/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Ca/In/Ni Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Rb/Ca/In/Ni/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Ho/Tm Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Sr/Ho/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Nd/S La/Nd/S/ La/Nd/S/ La/Nd/S/ La/Nd/S/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Tb Sr/Tb/ Sr/Tb/ Sr/Tb/ Sr/Tb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Rb/Ca Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Li/Rb/Ca/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/K Li/K/ Li/K/ Li/K/ Li/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Tm/Lu/Ta/P Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Tm/Lu/Ta/P/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Ca/Dy/P Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Rb/Ca/Dy/P/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/La/Yb/Zn Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Mg/La/Yb/Zn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Sr/Lu Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Rb/Sr/Lu/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Sr/Lu/Nb Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Na/Sr/Lu/Nb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Eu/Hf Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Na/Eu/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Dy/Rb/Gd Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Dy/Rb/Gd/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Pt/Bi Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Na/Pt/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Hf Rb/Hf/ Rb/Hf/ Rb/Hf/ Rb/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Cs Ca/Cs/ Ca/Cs/ Ca/Cs/ Ca/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Mg/Na Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ca/Mg/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Hf/Bi Hf/Bi/ Hf/Bi/ Hf/Bi/ Hf/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Sn Sr/Sn/ Sr/Sn/ Sr/Sn/ Sr/Sn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Nb Sr/Nb/ Sr/Nb/ Sr/Nb/ Sr/Nb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zr/W Zr/W/ Zr/W/ Zr/W/ Zr/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Y/W Y/W/ Y/W/ Y/W/ Y/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/W Na/W/ Na/W/ Na/W/ Na/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Ce Sr/Ce/ Sr/Ce/ Sr/Ce/ Sr/Ce/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Bi/W Bi/W/ Bi/W/ Bi/W/ Bi/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Bi/Cs Bi/Cs/ Bi/Cs/ Bi/Cs/ Bi/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Bi/Ca Bi/Ca/ Bi/Ca/ Bi/Ca/ Bi/Ca/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Bi/Sn Bi/Sn/ Bi/Sn/ Bi/Sn/ Bi/Sn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Bi/Sb Bi/Sb/ Bi/Sb/ Bi/Sb/ Bi/Sb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ge/Hf Ge/Hf/ Ge/Hf/ Ge/Hf/ Ge/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Hf/Sm Hf/Sm/ Hf/Sm/ Hf/Sm/ Hf/Sm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Ag Sb/Ag/ Sb/Ag/ Sb/Ag/ Sb/Ag/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Bi Sb/Bi/ Sb/Bi/ Sb/Bi/ Sb/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Au Sb/Au/ Sb/Au/ Sb/Au/ Sb/Au/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Sm Sb/Sm/ Sb/Sm/ Sb/Sm/ Sb/Sm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Sr Sb/Sr/ Sb/Sr/ Sb/Sr/ Sb/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/W Sb/W/ Sb/W/ Sb/W/ Sb/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Hf Sb/Hf/ Sb/Hf/ Sb/Hf/ Sb/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Yb Sb/Yb/ Sb/Yb/ Sb/Yb/ Sb/Yb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Pr/K Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Sr/Pr/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb/Sn Sb/Sn/ Sb/Sn/ Sb/Sn/ Sb/Sn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/Au Yb/Au/ Yb/Au/ Yb/Au/ Yb/Au/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/Ta Yb/Ta/ Yb/Ta/ Yb/Ta/ Yb/Ta/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/Sr Yb/Sr/ Yb/Sr/ Yb/Sr/ Yb/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/Pb Yb/Pb/ Yb/Pb/ Yb/Pb/ Yb/Pb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/W Yb/W/ Yb/W/ Yb/W/ Yb/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb/Ag Yb/Ag/ Yb/Ag/ Yb/Ag/ Yb/Ag/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Au/Sr Au/Sr/ Au/Sr/ Au/Sr/ Au/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO W/Ge W/Ge/ W/Ge/ W/Ge/ W/Ge/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ta/Sr Ta/Sr/ Ta/Sr/ Ta/Sr/ Ta/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ta/Hf Ta/Hf/ Ta/Hf/ Ta/Hf/ Ta/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO W/Au W/Au/ W/Au/ W/Au/ W/Au/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/W Ca/W/ Ca/W/ Ca/W/ Ca/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sm/Li Sm/Li/ Sm/Li/ Sm/Li/ Sm/Li/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/K La/K/ La/K/ La/K/ La/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zn/Cs Zn/Cs/ Zn/Cs/ Zn/Cs/ Zn/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Zr/K Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Sr/Zr/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/K/Mg Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Na/K/Mg/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zr/Cs Zr/Cs/ Zr/Cs/ Zr/Cs/ Zr/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Ce Ca/Ce/ Ca/Ce/ Ca/Ce/ Ca/Ce/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Li/Cs Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Na/Li/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Sr Li/Sr/ Li/Sr/ Li/Sr/ Li/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Dy/K La/Dy/K/ La/Dy/K/ La/Dy/K/ La/Dy/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Dy/K Dy/K/ Dy/K/ Dy/K/ Dy/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Nd/In/K Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Na/Nd/In/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO In/Sr In/Sr/ In/Sr/ In/Sr/ In/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Cs Sr/Cs/ Sr/Cs/ Sr/Cs/ Sr/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Ga/Tm/Cs Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Rb/Ga/Tm/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ga/Cs Ga/Cs/ Ga/Cs/ Ga/Cs/ Ga/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Lu/Fe Lu/Fe/ Lu/Fe/ Lu/Fe/ Lu/Fe/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Tm Sr/Tm/ Sr/Tm/ Sr/Tm/ Sr/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Dy La/Dy/ La/Dy/ La/Dy/ La/Dy/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sm/Li/Sr Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Sm/Li/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/K Mg/K/ Mg/K/ Mg/K/ Mg/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Rb/Ga Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Li/Rb/Ga/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Ce/K Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Sr/Ce/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Cs/Tm Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Li/Cs/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zr/K Zr/K/ Zr/K/ Zr/K/ Zr/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/Cs Li/Cs/ Li/Cs/ Li/Cs/ Li/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Li/K/La Li/K/La/ Li/K/La/ Li/K/La/ Li/K/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ce/Zr/La Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ce/Zr/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Al/La Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ca/Al/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Zn/La Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Sr/Zn/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Cs/Zn Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Sr/Cs/Zn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sm/Cs Sm/Cs/ Sm/Cs/ Sm/Cs/ Sm/Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO In/K In/K/ In/K/ In/K/ In/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Pr Sr/Pr/ Sr/Pr/ Sr/Pr/ Sr/Pr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ho/Cs/Li/La Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ho/Cs/Li/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cs/La/Na Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Cs/La/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/S/Sr La/S/Sr/ La/S/Sr/ La/S/Sr/ La/S/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO K/La/Zr/Ag K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ K/La/Zr/Ag/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Lu/Tl Lu/Tl/ Lu/Tl/ Lu/Tl/ Lu/Tl/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Pr/Zn Pr/Zn/ Pr/Zn/ Pr/Zn/ Pr/Zn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Sr/La Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Rb/Sr/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Sr/Eu/Ca Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Na/Sr/Eu/Ca/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO K/Cs/Sr/La K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ K/Cs/Sr/La/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Sr/Lu Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Na/Sr/Lu/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Eu/Dy Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Sr/Eu/Dy/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Lu/Nb Lu/Nb/ Lu/Nb/ Lu/Nb/ Lu/Nb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Dy/Gd La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ La/Dy/Gd/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Mg/Tl/P Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Na/Mg/Tl/P/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Pt Na/Pt/ Na/Pt/ Na/Pt/ Na/Pt/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Gd/Li/K Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Gd/Li/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/K/Lu Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Rb/K/Lu/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/La/Dy/S Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Sr/La/Dy/S/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Ce/Co Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Na/Ce/Co/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Ce Na/Ce/ Na/Ce/ Na/Ce/ Na/Ce/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Tb/K Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Sr/Tb/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Ga/Gd/Al Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Na/Ga/Gd/Al/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ba/Rh/Ta Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ba/Rh/Ta/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ba/Ta Ba/Ta/ Ba/Ta/ Ba/Ta/ Ba/Ta/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Al/Bi Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Na/Al/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cs/Eu/S Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Cs/Eu/S/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sm/Tm/Yb/Fe Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Sm/Tm/Yb/Fe/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sm/Tm/Yb Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Sm/Tm/Yb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Hf/Zr/Ta Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Hf/Zr/Ta/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Gd/Li/K Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Rb/Gd/Li/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Gd/Ho/Al/P Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Gd/Ho/Al/P/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Ca/Lu Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Na/Ca/Lu/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cu/Sn Cu/Sn/ Cu/Sn/ Cu/Sn/ Cu/Sn/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ag/Au Ag/Au/ Ag/Au/ Ag/Au/ Ag/Au/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Al/Bi Al/Bi/ Al/Bi/ Al/Bi/ Al/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Al/Mo Al/Mo/ Al/Mo/ Al/Mo/ Al/Mo/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Hf/Rb Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Sr/Hf/Rb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Al/Nb Al/Nb/ Al/Nb/ Al/Nb/ Al/Nb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Au/Pt Au/Pt/ Au/Pt/ Au/Pt/ Au/Pt/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ga/Bi Ga/Bi/ Ga/Bi/ Ga/Bi/ Ga/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/W Mg/W/ Mg/W/ Mg/W/ Mg/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Pb/Au Pb/Au/ Pb/Au/ Pb/Au/ Pb/Au/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sn/Mg Sn/Mg/ Sn/Mg/ Sn/Mg/ Sn/Mg/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zn/Bi Zn/Bi/ Zn/Bi/ Zn/Bi/ Zn/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Ta Sr/Ta/ Sr/Ta/ Sr/Ta/ Sr/Ta/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na Na/ Na/ Na/ Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr Sr/ Sr/ Sr/ Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca Ca/ Ca/ Ca/ Ca/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Yb Yb/ Yb/ Yb/ Yb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Cs Cs/ Cs/ Cs/ Cs/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sb Sb/ Sb/ Sb/ Sb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Gd/Ho Gd/Ho/ Gd/Ho/ Gd/Ho/ Gd/Ho/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Zr/Bi Zr/Bi/ Zr/Bi/ Zr/Bi/ Zr/Bi/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ho/Sr Ho/Sr/ Ho/Sr/ Ho/Sr/ Ho/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/B Sr/B/ Sr/B/ Sr/B/ Sr/B/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Gd/Ho/Sr Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Gd/Ho/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Sr Ca/Sr/ Ca/Sr/ Ca/Sr/ Ca/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Na/Zr/Eu/Tm Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Na/Zr/Eu/Tm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Ho/Tm/Na Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Sr/Ho/Tm/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Pb Sr/Pb/ Sr/Pb/ Sr/Pb/ Sr/Pb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/W/Li Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Sr/W/Li/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Sr/W Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ca/Sr/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Hf Sr/Hf/ Sr/Hf/ Sr/Hf/ Sr/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Au/Re Au/Re/ Au/Re/ Au/Re/ Au/Re/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/W Sr/W/ Sr/W/ Sr/W/ Sr/W/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Nd La/Nd/ La/Nd/ La/Nd/ La/Nd/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Sm La/Sm/ La/Sm/ La/Sm/ La/Sm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Ce La/Ce/ La/Ce/ La/Ce/ La/Ce/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Sr La/Sr/ La/Sr/ La/Sr/ La/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Nd/Sr La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ La/Nd/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Bi/Sr La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ La/Bi/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Ce/Nd/Sr La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ La/Ce/Nd/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Bi/Ce/Nd/Sr La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ La/Bi/Ce/Nd/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Eu/Gd Eu/Gd/ Eu/Gd/ Eu/Gd/ Eu/Gd/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ca/Na Ca/Na/ Ca/Na/ Ca/Na/ Ca/Na/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Eu/Sm Eu/Sm/ Eu/Sm/ Eu/Sm/ Eu/Sm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Eu/Sr Eu/Sr/ Eu/Sr/ Eu/Sr/ Eu/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/Sr Mg/Sr/ Mg/Sr/ Mg/Sr/ Mg/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Ce/Mg Ce/Mg/ Ce/Mg/ Ce/Mg/ Ce/Mg/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Gd/Sm Gd/Sm/ Gd/Sm/ Gd/Sm/ Gd/Sm/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Au/Pb Au/Pb/ Au/Pb/ Au/Pb/ Au/Pb/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Bi/Hf Bi/Hf/ Bi/Hf/ Bi/Hf/ Bi/Hf/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/S Rb/S/ Rb/S/ Rb/S/ Rb/S/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Nd Sr/Nd/ Sr/Nd/ Sr/Nd/ Sr/Nd/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Eu/Y Eu/Y/ Eu/Y/ Eu/Y/ Eu/Y/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Sr/Hf/K Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Sr/Hf/K/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/Nd Mg/Nd/ Mg/Nd/ Mg/Nd/ Mg/Nd/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO La/Mg La/Mg/ La/Mg/ La/Mg/ La/Mg/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Mg/Nd/Fe Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Mg/Nd/Fe/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO Rb/Sr Rb/Sr/ Rb/Sr/ Rb/Sr/ Rb/Sr/ Ln1.sub.4−xLn2.sub.xO.sub.6 La.sub.4−xLn1.sub.xO.sub.6 Y.sub.2O.sub.3 MgO *Ln1 and Ln2 are each independently a lanthanide element, wherein Ln1 and Ln2 are not the same and x is a number ranging from greater than 0 to less than 4
(287) As used in Tables 1-12 and throughout the specification, a nanowire composition represented by E.sup.1/E.sup.2/E.sub.3, etc., wherein E.sup.1, E.sup.2 and E.sup.3 are each independently an element or a compound comprising one or more elements, refers to a nanowire composition comprised of a mixture of E.sup.1, E.sup.2 and E.sup.3. E.sup.1/E.sup.2/E.sup.3, etc. are not necessarily present in equal amounts and need not form a bond with one another. For example, a nanowire comprising Li/MgO refers to a nanowire comprising Li and MgO, for example, Li/MgO may refer to a MgO nanowire doped with Li. By way of another example, a nanowire comprising NaMnO.sub.4/MgO refers to a nanowire comprised of a mixture of NaMnO.sub.4 and MgO. Dopants may be added in suitable form. For example in a lithium doped magnesium oxide nanowire (Li/MgO), the Li dopant can be incorporated in the form of Li.sub.2O, Li.sub.2CO.sub.3, LiOH, or other suitable forms. Li may be fully incorporated in the MgO crystal lattice (e.g., (Li,Mg)O) as well. Dopants for other nanowires may be incorporated analogously.
(288) In some more specific embodiments, the dopant is selected from Li, Ba and Sr. In other specific embodiments, the nanowires comprise Li/MgO, Ba/MgO, Sr/La.sub.2O.sub.3, Ba/La.sub.2O.sub.3, Mn/Na.sub.2WO.sub.4, Mn.sub.2O.sub.3/Na.sub.2WO.sub.4, Mn.sub.3O.sub.4/Na.sub.2WO.sub.4, Mg.sub.6MnO.sub.8, Li/B/Mg.sub.6MnO.sub.8, Na/B/Mg.sub.6MnO.sub.8, Zr.sub.2Mo.sub.2O.sub.8 or NaMnO.sub.4/MgO.
(289) In some other specific embodiments, the nanowire comprises a mixed oxide of Mn and Mg with or without B and with or without Li. Additional dopants for such nanowires may comprise doping elements selected from Group 1 and 2 and groups 7-13. The dopants may be present as single dopants or in combination with other dopants. In certain specific embodiments of nanowires comprising a mixed oxide of Mn and Mg with or without B and with or without Li., the dopant comprises a combination of elements from group 1 and group 8-11.
(290) Nanowires comprising mixed oxides of Mn and Mg are well suited for incorporation of dopants because magnesium atoms can be easily substituted by other atoms as long as their size is comparable with magnesium. A family of “doped” Mg.sub.6MnO.sub.8 compounds with the composition M.sub.xMg.sub.(6-x)MnO.sub.8, wherein each M is independently a dopant as defined herein and x is 0 to 6, can thus be created. The oxidation state of Mn can be tuned by selecting different amounts (i.e., different values of x) of M with different oxidation states, for example Li.sub.(x)Mg.sub.(6-x)MnO.sub.8 would contain a mixture of Mn(IV) and Mn(V) with x<1 and a mixture that may include Mn(V), Mn(VI), Mn(VII) with x>1. The maximum value of x depends on the ability of a particular atom M to be incorporated in the Mg.sub.6MnO.sub.8 crystal structure and therefore varies depending on M. It is believed that the ability to tune the manganese oxidation state as described above could have advantageous effect on the catalytic activity of the disclosed nanowires.
(291) Examples of nanowires comprising Li/Mn/Mg/B and an additional dopant include; Li/Mn/Mg/B doped with Co; Li/Mn/Mg/B doped with Na, Li/Mn/Mg/B doped with Be; Li/Mn/Mg/B doped with Al; Li/Mn/Mg/B doped with Hf; Li/Mn/Mg/B doped with Zr; Li/Mn/Mg/B doped with Zn; Li/Mn/Mg/B doped with Rh and Li/Mn/Mg/B doped with Ga. Nanowires comprising Li/Mn/Mg/B doped with different combinations of these dopants are also provided. For example, in some embodiments the Li/Mn/Mg/B nanowires are doped with Na and Co. In other embodiments, the Li/Mn/Mg/B nanowires are doped with Ga and Na.
(292) In other embodiments, nanowires comprising Mn/W with or without dopants are provided. For example, the present inventors have found through high throughput testing that nanowires comprising Mn/W and various dopants are good catalysts in the OCM reaction. Accordingly, in some embodiments, the Mn/W nanowires are doped with Ba. In other embodiments, the Mn/W nanowires are doped with Be. In yet other embodiments, the Mn/W nanowires are doped with Te.
(293) In any of the above embodiments, the Mn/W nanowires may comprise a SiO.sub.2 support. Alternatively, the use of different supports such as ZrO.sub.2, HfO.sub.2 and In.sub.2O.sub.3 in any of the above embodiments has been shown to promote OCM activity at reduced temperature compared to the same catalyst supported on silica with limited reduction in selectivity.
(294) Nanowires comprising rare earth oxides doped with various elements are also effective catalysts in the OCM reaction. In certain specific embodiments, the rare earth oxide or oxy-hydroxide can be any rare earth, preferably La, Nd, Eu, Sm, Yb, Gd. In certain embodiments of the nanowires comprising rare earth elements or yttria, the dopant comprises alkali earth (group 2) elements. The degree of effectiveness of a particular dopant is a function of the rare earth used and the concentration of the alkali earth dopant. In addition to Alkali earth elements, further embodiments of the rare earth or yttria nanowires include embodiments wherein the nanowires comprise alkali elements as dopants, which further promote the selectivity of the OCM catalytic activity of the doped material. In yet other embodiments of the foregoing, the nanowires comprise both an alkali element and alkali earth element as dopant. In still further embodiments, an additional dopant can be selected from an additional rare earth and groups 3, 4, 8, 9, 10, 13, 14.
(295) The foregoing rare earth catalyst may be doped prior to, or after formation of the rare earth oxide. In one embodiment, the corresponding rare earth salt is mixed with the corresponding dopant salt to form a solution or a slurry which is dried and then calcined in a range of 400° C. to 900° C., or between 500° C. and 700° C. In another embodiment, the rare earth oxide is formed first through calcination of a rare earth salt and then contacted with a solution comprising the doping element prior to drying and calcination between 300° C. and 800° C., or between 400° C. and 700° C.
(296) In other embodiments, the nanowires comprise La.sub.2O.sub.3 or LaO.sub.y(OH).sub.x, wherein y ranges from 0 to 1.5, x ranges from 0 to 3 and 2y+x=3, doped with Na, Mg, Ca, Sr, Ga, Sc, Y, Zr, In, Nd, Eu, Sm,Ce, Gd or combinations thereof. In yet further embodiments, the La.sub.2O.sub.3 or LaO.sub.y(OH).sub.x nanowires are doped with binary dopant combinations, for example Eu/Na; Eu/Gd; Ca/Na; Eu/Sm; Eu/Sr; Mg/Sr; Ce/Mg; Gd/Sm, Mg/Na, Mg/Y, Ga/Sr, Nd/Mg, Gd/Na or Sm/Na. In some other embodiments, the La.sub.2O.sub.3 or LaO.sub.y(OH).sub.x nanowires are doped with a ternary dopant combination, for example Ca—Mg—Na.
(297) In other embodiments, the nanowires comprise Nd.sub.2O.sub.3 or NdO.sub.y(OH).sub.x, wherein y ranges from 0 to 1.5, x ranges from 0 to 3 and 2y+x=3, doped with Sr, Ca, Rb, Li, Na or combinations thereof. In certain other embodiments, the Nd.sub.2O.sub.3 or NdO.sub.y(OH).sub.x nanowires are doped with binary dopant combinations, for example Ca/Sr, Rb/Sr, Ta/Sr or Al/Sr.
(298) In still other examples of doped nanowires, the nanowires comprise Yb.sub.2O.sub.3 or YbO.sub.y(OH).sub.x, wherein y ranges from 0 to 1.5, x ranges from 0 to 3 and 2y+x=3, doped with Sr, Ca, Ba, Nd or combinations thereof. In certain other embodiments, the Yb.sub.2O.sub.3 or YbO.sub.y(OH).sub.x OCM nanowires are doped with a binary combination, for example of Sr/Nd.
(299) Still other examples of doped nanowires Eu.sub.2O.sub.3 or EuO.sub.y(OH).sub.x nanowires, wherein y ranges from 0 to 1.5, x ranges from 0 to 3 and 2y+x=3, doped with Sr, Ba, Sm, Gd, Na or combinations thereof or a binary dopant combination, for example Sr/Na or Sm/Na.
(300) Example of dopants for Sm.sub.2O.sub.3 or SmO.sub.y(OH).sub.x nanowires, wherein x and y are each independently an integer from 1 to 10, include Sr, and examples of dopants for Y.sub.2O.sub.3 or YO.sub.y(OH).sub.x nanowires, wherein y ranges from 0 to 1.5, x ranges from 0 to 3 and 2y+x=3, comprise Ga, La, Nd or combinations thereof. In certain other embodiments, the Y.sub.2O.sub.3 or YO.sub.y(OH).sub.x nanowires comprise a binary dopant combination, for example Sr/Nd, Eu/Y or Mg/Nd or a tertiary dopant combination, for example Mg/Nd/Fe.
(301) In yet other embodiments, the nanowires comprise Ln.sub.2O.sub.3 or Ln.sub.zO.sub.y(OH).sub.x, wherein Ln is at each occurrence, independently a lanthanide, x ranges from 0 to 3 and 2y+x=3, y ranges from 0 to 1.5, and z is 1, 2 or 3, and the nanowires are doped with Li, Na, K, Rb, Cs, Mg, Ca, Sr, Ba, Sc, Y, La, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, Ti, Zr, Hf, V, Nb, Ta, Mo, W, Mn, Ni, Pd, Pt, Cu, Ag, Au, Zn, Al, Ga, In, TI, Ge, Sn, Pb, P, As, Sb, Bi, S, Se, Te or combinations thereof. In certain other embodiments, the Ln.sub.2O.sub.3 or LnO.sub.y(OH).sub.x nanowires comprise only one dopant, for example Sr, a binary dopant combination, for example Na/Mg, Na/Sr, Mg/Sr, Li/Cs, Sr/W, Hf/Bi, Na/Eu, Zn/K, Sb/Ag, Sr/Ta, a tertiary dopant combination, for example Li/Na/Sr, Na/La/Eu, Li/Sr/Cs, Dy/Rb/Gd, Mg/La/K, or a quaternary dopant combination, for example Na/Zr/Eu/Ca, Na/La/Eu/In, Na/K/Mg/Tm, Li/Cs/Sr/Tm, Ba/Tm/Zn/K, Mg/La/Yb/Zn.
(302) Rare earth nanowires, which without doping often have low OCM selectivity, can be greatly improved by doping to reduce their combustion activity. In particular, nanowires comprising CeO.sub.2 and Pr.sub.2O.sub.3 tend to have strong total oxidation activity for methane, however doping with additional rare earth elements can significantly moderate the combustion activity and improve the overall utility of the catalyst. Example of dopants for improving the selectivity for Pr.sub.2O.sub.3 or PrO.sub.y(OH).sub.x nanowires, wherein y ranges from 0 to 1.5, x ranges from 0 to 3 and 2y+x=3, comprise binary dopants, for example Nd/Mg, La/Mg or Yb/Sr.
(303) In some embodiments, dopants are present in the nanowires in, for example, less than 50 at %, less than 25 at %, less than 10 at %, less than 5 at % or less than 1 at %.
(304) In other embodiments of the nanowires, the atomic ratio (w/w) of the one or more metal elements selected from Groups 1-7 and lanthanides and actinides in the form of an oxide and the dopant ranges from 1:1 to 10,000:1, 1:1 to 1,000:1 or 1:1 to 500:1.
(305) In further embodiments, the nanowires comprise one or more metal elements from Group 2 in the form of an oxide and a dopant from Group 1. In further embodiments, the nanowires comprise magnesium and lithium. In other embodiments, the nanowires comprise one or more metal elements from Group 2 and a dopant from Group 2, for example, in some embodiments, the nanowires comprise magnesium oxide and barium. In other embodiments, the nanowires comprise one or more metal elements from Group 2, a dopant from Group 2 and an additional dopant, for example, in some embodiments, the nanowires comprise magnesium oxide and are doped with strontium and tungsten dopants (i.e., Sr/W/MgO). In another embodiment, the nanowires comprise an element from the lanthanides in the form of an oxide and a dopant from Group 1 or Group 2. In further embodiments, the nanowires comprise lanthanum and strontium.
(306) Various methods for preparing doped nanowires are provided. In one embodiment, the doped nanowires can be prepared by co-precipitating a nanowire metal oxide precursor and a dopant precursor. In these embodiments, the doping element may be directly incorporated into the nanowire.
(307) Template Directed Synthesis of Nanowires
(308) In some embodiments, the nanowires can be prepared in a solution phase using an appropriate template. In this context, an appropriate template can be any synthetic or natural material, or combination thereof, that provides nucleation sites for binding ions (e.g. metal element ions and/or hydroxide or other anions) and causing the growth of a nanowire. The templates can be selected such that certain control of the nucleation sites, in terms of their composition, quantity and location can be achieved in a statistically significant manner. The templates are typically linear or anisotropic in shape, thus directing the growth of a nanowire.
(309) In contrast to other template directed preparation of nanostructures, the nanowires of the invention are generally not prepared from nanoparticles deposited on a template in a reduced state which are then heat treated and fused into an elongated nanoporous nanostructure. In particular, such methods are not generally applicable to continuous nanowires comprising one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof. Instead of forming a plurality of catalyst nanoparticles, nanocrystals, or nanocrystallites on the surface of the template (e.g., phage), the nanowires of the invention are preferably prepared by nucleation of an oxidized metal element (e.g., in the form of a metal ion) and subsequent growth of a nanowire. After nucleation of the oxidized metal element, the nanowires are generally calcined to produce the desired oxide, but annealing of nanoparticles is not necessary to form the nanowires.
(310) Accordingly, the nanowires used in the context of the invention have a number of properties that differentiate them from other nanostructures, such as those created as fused aggregates of nanoparticles. In particular, the nanowires are characterized as having one or more of; a substantially non-nanoporous structure, an average crystal domain size, either before and/or after calcination, of greater than 5 nm, and an anisotropic crystal habit.
(311) In the context of non-nanoporous nanowires, preferred compositions are distinguished from elongated nanostructures formed as nanoporous aggregates of nanoparticles by virtue of their substantially non-nanoporous structures. Such substantially non-nanoporous nanowire structures will preferably have a surface area of less than 150 m.sup.2/g, more preferably less than 100 m.sup.2/g, less than 50 m.sup.2/g, less than 40 m.sup.2/g, less than 30 m.sup.2/g less than 25 m.sup.2/g, less than 20 m.sup.2/g, less than 15 m.sup.2/g, less than 10 m.sup.2/g, or between 1 m.sup.2/g and any of the foregoing. As will be appreciated, nanowires created through templating processes, where additional aggregates may fuse to a non-nanoporous or substantially non-nanoporous nanowire core, will typically have higher surface areas, e.g., surface areas toward the higher end of the range, while nanowires created from other processes, e.g., by hydrothermal processes, will typically have lower surface areas.
(312) In certain aspects, the nanowires of the invention are characterized by relatively large crystal domain sizes in the context of relatively high surface area nanowire structures. In particular, and as noted previously, for those nanowires of the invention having an average crystal domain size in at least one crystal dimension that is greater than 5 nm, preferred nanowires of the invention will typically have an average crystal domain size in at least one crystal dimension that is greater than 10 nm, and in more preferred aspects, greater than 20 nm.
(313) In certain embodiments, the nanowires of the invention may also be characterized by additional structural properties. For example, in certain aspects, the nanowires of the invention may be characterized by a continuous crystal structure within the nanowire, excluding stacking faults. In certain aspects, the nanowires of the invention may be characterized by an aligned crystal structure within the nanowire consisting of parallel, aligned crystal domains.
(314) In some embodiments, methods for forming nanowires having the empirical formula M4.sub.wM5.sub.xM6.sub.yO.sub.z are provided, wherein M4 comprises one or more elements selected from Groups 1 through 4, M5 comprises one or more elements selected from Group 7 and M6 comprises one or more elements selected from Groups 5 through 8 and Groups 14 through 15 and w, x, y and z are integers such that the overall charge is balanced. The methods comprise combining one or more sources of M4, one or more sources of M5, and one or more sources of M6 in the presence of a templating agent and a solvent to form a mixture.
(315) In certain embodiments, M4 includes one or more elements selected from Group 1, such as Na, while M6 includes one or more elements selected from Group 6, such as W and M3 is Mn. In one embodiment, M4 is Na and the source of M4 is NaCl, M5 is Mn and the source of M5 is Mn(NO.sub.3).sub.2, M6 is W and the source of M6 is WO.sub.3, the solvent is water, and the templating agent is a bacteriophage.
(316) In various embodiments, the source of M4 can be one or more of a chloride, bromide, iodide, oxychloride, oxybromide, oxyiodide, nitrate, oxynitrate, sulfate or phosphate salt of any of Group 1, Group 2, Group 3, or a Group 4 element. In an embodiment, sources of M4 include LiCl, KCl, MgCl.sub.2, CaCl.sub.2, ScCl.sub.3, TiCl.sub.4, KBr, CaBr.sub.2, Sc(NO.sub.3).sub.3, Y(NO.sub.3).sub.3, TiBr.sub.4, ZrBr.sub.4, Zr(NO.sub.3).sub.4, ZrOCl.sub.2, ZrO(NO.sub.3).sub.2, Na.sub.2SO.sub.4, and Zr(SO.sub.4).sub.2. For any given source of M4, a source of M6 can be one or more of an oxide, oxide salt, or an oxyacid of any of Group 5, Group 6, Group 7, Group 8, Group 14 and Group 15 elements. In an embodiment, sources of M6 include MoO.sub.3, (NH.sub.4).sub.6Mo.sub.7O.sub.24, WO.sub.3, Na.sub.2WO.sub.4, H.sub.2WO.sub.4, Co.sub.2O.sub.3, P.sub.2O.sub.5, H.sub.3PO.sub.4 and H.sub.2SiO.sub.4. For any given combination of a source of M4 and a source of M6, a source of Mn can be, but is not limited to, any chloride, bromide, nitrate, or sulfate of manganese, including MnCl.sub.2, MnCl.sub.3, MnCl.sub.4, Mn(NO.sub.3).sub.3, MnSO.sub.4 and Mn.sub.2(SO.sub.4).sub.3.
(317) In still other embodiments, the templating agent can include a surfactant, such as tetraoctylammonium chloride, ammonium lauryl sulfate, or lauryl glucoside. For any templating agent or any source of M4, M6, or Mn, the solvent can include an organic solvent, such as ethanol, diethyl ether, or acetonitrile. Additionally, any embodiment of the method for forming a nanowire described above can include any additional component in the reaction mixture, such as a base.
(318) Nanowire-forming methods of various embodiments of the invention comprise combining a source of M4, a source of M5, a source of M6, a templating agent, and a solvent in a reaction mixture. In other embodiments, however, nanowire-forming methods of the present invention comprise combining two of a source of M4, a source of M5 and a source of M6 in the presence of a templating agent and a solvent to form an intermediate nanowire and then combining a remainder of the source of M4, the source of M5 and the source of M6 with the intermediate nanowire, wherein M4 includes one or more elements selected from Group 1, Group 2, Group 3 and Group 4 elements, wherein M5 includes one or more elements selected from Group 7, and wherein M6 includes one or more elements selected from Group 5, Group 6, Group 7, Group 8, Group 14 and Group 15 elements. In an embodiment, an intermediate nanowire is formed by combining the source of M5 and the source of M6 in the presence of the templating agent and the solvent, followed by combining the intermediate nanowire with the source of M4.
1. Biological Template
(319) Because peptide sequences have been shown to have specific and selective binding affinity for many different types of metal element ions, biological templates incorporating peptide sequences as nucleation sites are preferred. Moreover, biological templates can be engineered to comprise pre-determined nucleation sites in pre-determined spatial relationships (e.g., separated by a few to tens of nanometers).
(320) Both wild type (i.e., naturally occurring) and genetically engineered biological templates can be used. As discussed herein, biological templates such as proteins and bacteriophage can be engineered based on genetics to ensure control over the type of nucleation sites (e.g., by controlling the peptide sequences), their locations on the templates and their respective density and/or ratio to other nucleation sites. See, e.g., Mao, C. B. et al., (2004) Science, 303, 213-217; Belcher, A. et al., (2002) Science 296, 892-895; Belcher, A. et al., (2000) Nature 405 (6787) 665-668; Reiss et al., (2004) Nanoletters, 4 (6), 1127-1132, Flynn, C. et al., (2003) J. Mater. Sci., 13, 2414-2421; Mao, C. B. et al., (2003) PNAS, 100 (12), 6946-6951, which references are hereby incorporated by reference in their entireties. This allows for the ability to control the composition and distribution of the nucleation sites on the biological template.
(321) Thus, biological templates may be particularly advantageous for a controlled growth of nanowires. Biological templates can be biomolecules (e.g., proteins) as well as multi-molecular structures of a biological origin, including, for example, bacteriophage, virus, amyloid fiber, and capsid.
(a) Biomolecules
(322) In certain embodiments, the biological templates are biomolecules. In more specific embodiments, the biological templates are anisotropic biomolecules. Typically, a biomolecule comprises a plurality of subunits (building blocks) joined together in a sequence via chemical bonds. Each subunit comprises at least two reactive groups such as hydroxyl, carboxylic acid and amino groups, which enable the bond formations that interconnect the subunits. Examples of the subunits include, but are not limited to: amino acids (both natural and synthetic) and nucleotides. Accordingly, in some embodiments, the biomolecule template is a peptide, protein, nucleic acid, polynucleotide, amino acid, antibody, enzyme, or single-stranded or double-stranded nucleic acid or any modified and/or degraded forms thereof.
(323) Because protein synthesis can be genetically directed, proteins can be readily manipulated and functionalized to contain desired peptide sequences (i.e., nucleation sites) at desired locations within the primary structure of the protein. The protein can then be assembled to provide a template.
(324) Thus, in various embodiments, the templates are biomolecules are native proteins or proteins that can be engineered to have nucleation sites for specific ions.
(b) Baceteriophage
(325) In one particular embodiment, the biological template comprises a M13 bacteriophage which has or can be engineered to have one or more particular peptide sequences to be expressed on the coat proteins. M13 bacteriophage is a filamentous bacterial virus that is produced by amplification through E.coli bacteria. It is 880 nm long and 6.7 nm in diameter. The surface of the filamentous phage is mostly composed of its major coat protein, pVIII. 2700 copies of this protein pack around the phage DNA to make a tight and cylindrical shell. The N-termini of pVIII form a dense periodic display spaced at 2.7 nm. The final five residues of pVIII are structurally unconstrained and exposed to the solvent, therefore presenting an optimal target for engineering, manipulation, and substrate interaction.
(326)
(327) For example, in a further embodiment peptide sequences having one or more particular nucleation sites specific for various ions are expressed on the coat proteins. For example, in one embodiment, the coat protein is pVIII with peptide sequences having one or more particular nucleation sites specific for various ions bound thereto. In other further embodiments, the peptide sequences bound to the coat protein comprise 2 or more amino acids, 5 or more amino acids, 10 or more amino acids, 20 or more amino acids, or 40 or more amino acids. In other embodiments, the peptide sequences expressed on the coat protein comprise between 2 and 40 amino acids, between 5 and 20 amino acids, or between 7 and 12 amino acids.
(328) One of the approaches to obtain different types of M13 bacteriophage is to modify the viral genetic code in order to change the amino acid sequence of the major coat protein pVIII. The changes in sequence only affect the N-terminus amino acids of the pVIII protein, which are the ones that make the surface of the M13 phage, while the first 45 amino acids are left unchanged so that the packing of the pVIII proteins around the phage is not compromised. By changing the N-terminus amino acids on the pVIII protein, the surface characteristics of the phage can be tailored to higher affinities to specific metal ions and thus promoting selective growth of specific inorganic materials on the phage surface.
(329) Many short amino acid sequences can be engineered at the pVIII N-term inus for precipitation of various materials or combinations thereof. Typical functional groups in amino acids that can be used to tailor the phage surface affinity to metal ions include: carboxylic acid (—COOH), amino (—NH.sub.3.sup.+ or —NH.sub.2), hydroxyl (—OH), and/or thiol (—SH) functional groups. Table 13 summarizes a number of exemplary phages used in the present invention for preparing nanowires of inorganic metal oxides. In certain embodiment, the present disclosure is directed to any of the peptide sequences in Table 13. Sequences within Table 13 refer to the amino acid sequence of the pVIII protein (single-letter amino acid code). Underlined portions indicate the terminal sequence that was varied to tailor the phage surface affinity to metal ions. SEQ ID NO 30 represents wild type pVIII protein while SEQ ID NO 31 represents wild type pVIII protein including the signaling peptide portion (bold).
(330) TABLE-US-00013 TABLE 13 Phage Surface Protein Sequences SEQ ID NO Sequence 1 AEEGSEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLF KKFTSKAS 2 EEGSDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFK KFTSKAS 3 AEEEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKK FTSKAS 4 EEEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKF TSKAS 5 AEEEEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFK KFTSKAS 6 AEEAEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFK KFTSKAS 7 EEXEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKK FTSKAS X = E or G 8 AEDDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKK FTSKAS 9 AVSGSSPGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGI KLFKKFTSKAS 10 AVSGSSPDSDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGI KLFKKFTSKAS 11 AGETQQAMEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGI KLFKKFTSKAS 12 AAGETQQAMDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGI KLFKKFTSKAS 13 AEPGHDAVPEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIG IKLFKKFTSKAS 14 AEDPAEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLF KKFTSKAS 15 AEDPAKDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLF KKFTSKAS 16 AEFEVEADPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 17 AEHEAEEDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 18 AESEFELDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 19 ADNDVDLDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 20 ADSDYDGDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 21 ADADRDGDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 22 ADSDPDGDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 23 ADSDTDSDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 24 ADKDYDLDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 25 AEFEVGADPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 26 AGFEGEADPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 27 ADGDLDQDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 28 AEFEAEADPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 29 AGFEVEADPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL FKKFTSKAS 30 AEGDDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFK KFTSKAS 31 MKKSLVLKASVAVATLVPMLSFAAEGDDDPAKAAFNSLQASATE YIGYAWAMVVVIVGATIGIKLFKKFTSKAS
(331) Amino acid side chains have assorted chemical properties that can be used for material synthesis. Glutamic acid (E) and aspartic acid (D) have carboxylic acid side chains and are therefore negative at neutral pH. Negative residues are attractive to positively charged metal cations and therefore can nucleate biomineralization. Proline (P) is a cyclically constrained amino acid, and as a part of a protein gives it structural rigidity, potentially contributing to stronger binging interactions. Furthermore, through such rigidity proline can aid in bringing other functional side chains closer together for better coordination. Other amino acids of interest for use in phage-templated preparation of nanowires include histidine (H) that has a side chain with a pKa=6.0 and is very sensitive to the environment and can be made positive in only a slightly acidic environment. Tryptophan (W) has a large aromatic and polar side chain that can contribute to synthesis by metal pi-interactions.
(332) Accordingly, in certain embodiments the present disclosure provides phage sequences useful for templating of catalytic nanowires. In some embodiments, the engineered pVIII sequence comprises at least one constraining amino acid (e.g., P) and a repeat of 2 negative amino acids (e.g., E & D). Alanine is the one of the smallest side chain amino acids, and in some embodiments may be included as a spacer. The negative charges may be spread on both E & D amino acids as to avoid too many repeats of the same amino acid which may contribute to lower yield of phage. In a variation of the above sequence, Lysine (K) maybe included in the terminal phage sequence. Lysine has an active amine group, and therefore can potentially be attractive to higher group transition metals (e.g., Pt, Pd, Au) that exist as negatively charged ions in solution.
(333) In other embodiments, the sequences are based on an alternating peptide library approach. The engineered sequence is constrained to have an alternating negatively charged residue, for example either AEXEXEX (SEQ ID NO: 32) or ADXDXDX (SEQ ID NO: 33), wherein X is any amino acid.
(334) In other embodiments, a degenerate library approach is used to detect other viable sequences, i.e. amino acids of interest can be constrained and others can be left to be chosen by what is biologically favorable for phage production by bacteria. For example alternate libraries based on the negative residues AEXEXEX (SEQ ID NO: 32) or ADXDXDX (SEQ ID NO: 33) can be prepared using a degenerate library approach. In some embodiments, Histidine constrained or Tryptophan constrained libraries (e.g., AHXHXHX (SEQ ID NO: 34), AWXWXWX (SEQ ID NO: 35), AXXWHWX (SEQ ID NO: 36)), are useful for identifying aromatic and hydrophobic interactions. Other embodiments include altering the placement and order of the amino acids (e.g., ADDXEE (SEQ ID NO: 37)), and still other embodiments include constraining the sequences with proline amino acids (e.g., AEPEPEP (SEQ ID NO: 38), ADPDPDP (SEQ ID NO: 39)), to explore the effect of peptide structure on synthesis. Any combination of the above can be engineered and explored for biological viability and the templation behaviors. Non-limiting examples of phage surface protein sequences useful in the present invention are provided in Table 9 below.
(335) In one embodiment, the present disclosure provides methods for preparation and purification of filamentous bacteriophage. The purification methods may be based on standard methods or on the novel filtration methods described below. Such filtration methods can be advantageous in practice of certain embodiments of the invention since the methods are amenable to large scale preparations. Standard methods for purification of viruses, bacteriophage, DNA and recombinant proteins from feedstock solution generally include several steps. For example, the heavier components of feedstock, such as bacterial cells and cell debris, are first separated by centrifugation. Further, the particles of interest are then precipitated from the remaining supernatant by using a solution of polyethylene glycol and salt.
(336) While not wishing to be bound by theory, it is believed that polyethylene glycol (PEG) as a big inert molecule adds osmotic stress to the solutionby steric hindrance and increasing crowding, while the high concentration of salt screens the charge repulsion between the particles. The concentration of PEG, type and quantity of salts, as well as the subsequent processing steps depend upon the particular application. In the instance of filamentous bacteriophage, its long rod anisotropic geometry allows for minimal quantity of PEG to selectively precipitate these particles from the supernatant remaining after centrifugation, that might contain components of nutritious media used for amplification, as well as proteins and DNA excreted by bacteria during amplification and potential cell lysis. Following the precipitation, the solution is generally centrifuged once again to pellet the particle of interest such as bacteriophage, and then resuspended in the desired volume of buffer solution.
(337) The standard process described above works well on a small scale, however it may be limited by the centrifuge capacity as it is scaled up. Often the final solution has to be further clarified of remaining bacteria, by further centrifugation or filtration. Additionally the purified product may contain both trace amounts of polyethylene glycol as well as the salt used for precipitation in quantities difficult to quantitate, yet potentially influencing further chemical processing. In the case of bacteriophage, the solution can be purified further by a CsCl gradient and ultracentrifugation, however these steps are sometimes difficult to scale up due to the volumes that can be processed as well as the time and cost involved. Accordingly, there remains a need for improved phage preparation methods which are amenable to large scale production of purified phage.
(338) The novel methods described hereinare useful for large scale preparation of phage. In one embodiment, the method comprises a two-step filtration to purify bacteriophage from a feedstock solution. In the following description these two filtration steps are sometimes referred to as the first filtration step and the second filtration step, respectively. In some embodiments, the types of filtration employed comprise tangential flow filtration (TFF) and/or depth filtration. It is believed that such methods have not previously been employed with filamentous bacteriophage.
(339) Tangential flow filtration is a technique that separates the solution based on a size exclusion principle dictated by the pore size of the membrane used. The solution to be filtered is flowed over the membrane, with pressure applied across the membrane. One aspect ofTFF is that the solvent is split in two parts, the retentate and the permeate; therefore, particles in both the retentate and the permeate remain in solution. Particles smaller than the pore size filter through to the permeate side, and the larger particles are retained in the solution on the retentate side of the membrane. Fouling of the membrane is minimized by the continuous flow and recirculation of the solution on the retentate side of the membrane. Depending on the particular application, the particles of interest can be harvested either in the retentate or in the permeate, since both are still in solution.
(340) Depth filtration also separates the solution based on a size exclusion principle dictated by the pore size of the membrane used, but the solution to be filtered is flowed through the membrane instead of tangentially flowing along it as in TFF. Contrary to TFF, the entire amount of the solution is flowed through the membrane. Particles smaller than the pore size filter through to the permeate side, and the larger particles are retained in the solution on the retentate side of the membrane. Accordingly, the main difference between TFF and depth filtration is the nature of the retentate, which is a solution in TFF and a solid (“cake”) in depth filtration. Typically, in depth filtration the particles of interest will be harvested in the permeate and not in the retentate, which is trapped in the membrane.
(341) In one embodiment, a two-step TFF process for purifying bacteriophage is provided. In the first step a micro filtration is performed and in the second step an ultrafiltration is performed. In this respect a microfiltration comprises filtering a phage-containing solution through membranes of higher pore size (e.g., 0.1 to 3 μm). During this step the bigger particles of the feedstock such as cells and cell debris are clarified from solution and retained in the retentate, while the particles of interest (e.g., phage) are filtered through with the permeate. Ultrafiltration refers to filtration using smaller pore size membranes (e.g., 1 to 1000 kDa), the size being dependent on the specific application. During this filtration the particles of interest are retained while smaller particles, such as media components and small proteins are filtered out. In certain embodiments the ultrafiltration step can also be used to concentrate the solution by filtering out water. In an optional third step, diafiltration may be used to exchange the remaining concentrated media for buffer solution. Diafiltration may be performed over the same membrane as ultrafiltration.
(342) Various parameters of the foregoing filtration process may be varied for optimal purification results. In some embodiments, for both microftltration and ultrafiltration, parameters that control the flow of material over and through the membrane are important and can be varied. For example, the transmembrane pressure that is seen by the membrane as well as the flow rate of the recirculating solution can be varied from 0 to 40 psig and 100 to 3500 L/h/m.sup.2.
(343) One embodiment of the present disclosure provides a tangential flow filtration process that is easily scalable. In this embodiment, the volume of the feedstock that can be processed in a given time, scales directly with the surface area of the membrane used. As the surface area is increased and the flow rate adjusted accordingly, the other parameters of the process may remain the same. This allows for a manufacturing process to be initially designed and optimized using lab scale equipment and then later directly scaled to larger scales.
(344) In one embodiment of the foregoing filtration purification process for M13 phage, both the microfiltration and the ultrafiltration are performed using TFF. For microftltration, a nylon flat sheet membrane cartridge having pore sizes ranging from 0.1 to 3 μm, 0.1 to 1 μm or 0.2 to 0.45 μm may be used. In some embodiments, the flow rate in microfiltration ranges from 100 to 3500 L/h/m.sup.2, 300 to 3000 I/h/m.sup.2 or 500 to 2500 I/h/m.sup.2. In some embodiments, the flow rate in microfiltration is about 550 L/h/m.sup.2. In other embodiments, the transmembrane pressure in microfiltration ranges from 1 to 30 psig or from 2 to 20 psig, and in some embodiments the transmemrane pressure is about 15 psig.
(345) For the ultrafiltration and diafiltration steps a polyethersulfone flat sheet membrane cartridge having pore sizes ranging from 100 to 1000 kDa may be used. In some embodiments, the cartridge comprises pores having sizes of about 500 kDa. Flow parameters of approximately 100 to 3500 L/h/m.sup.2, 300 to 3000 I/h/m.sup.2 or 500 to 2500 I/h/m.sup.2, for example about 2200 Llhr/m.sup.2 may be used. The transmembrane pressures range from 1 to 30 psig or from 2 to 20 psig, and in some embodiments the transmembrane pressure is about 6 psig. In some embodiments, the solution may be diafiltered with from 1 to 20 volumes of water, for example 10 volumes of water. The optimum number of volumes depends on the desired purity of the final product. Any of the above parameters including the membrane material and configuration as well as flow parameters can be altered depending on the application, the particle of interest and purity and yield desired in the final product.
(346) In another embodiment, the microfiltration step is performed with depth filtration instead of TFF to eliminate bacterial cells and cell debris. The depth filtration may be performed using two filters connected in series. In some embodiments, the first filter comprises a glass fiber capsule with nominal porosity of from 0.5 to 3 μm, for example about 1.2 μm and followed by a double membrane filter capsule having, each membrane filter capsule having a pore size of from 0.1 to 1 μm, for example about 0.8 μm and about 0.45 μm, respectively. This filtration system allows for clarification of the feedstock solution prior to the ultrafiltration step, which may be carried out using the same parameters described in any of the embodiments described herein.
(347) Any of the above parameters may be modified to arrive at other embodiments. For example, in the initial step of clarifying the solution of cells and cell debris either TFF or depth filtration can be used. For the 2nd step of purifying the filamentous bacteriophage from the remaining solution TFF or depth filtration may also be used; however, in certain embodiments TFF is used.
(348) The disclosed filtration purification methods can be applied to any other biological particles that are currently purified using a combination of centrifugation and precipitation methods. Such biological particles include, but are not limited to, other bacteriophage (i.e., not just M13), viruses, proteins, etc. The filter membrane geometry can be either a flat sheet or hollow fiber.
(349) In some embodiments, the membranes used for TFF are chemically activated, via charge or affinity molecules, and such membranes may exhibit preferential binding to particles of interest to either be filtered out or retained. In other embodiments, the filter materials used for depth filtration may be activated, via charge or affinity molecules and may exhibit preferential binding for particles to be filtered out. Furthermore, some embodiments employ membranes for TFF which are mechanically activated via vibration to reduce fouling and enhance filtration.
(c) Amyloid Fibers
(350) In another embodiment, amyloid fibers can be used as the biological template on which metal ions can nucleate and assemble into a catalytic nanowire. Under certain conditions, one or more normally soluble proteins (i.e., a precursor protein) may fold and assemble into a filamentous structure and become insoluble. Amyloid fibers are typically composed of aggregated β-strands, regardless of the structure origin of the precursor protein. As used herein, the precursor protein may contain natural or unnatural amino acids. The precursor protein may be further modified with a fatty acid tail.
(d) Virus and Capsid
(351) In further embodiments, a virus or a capsid can be used as a biological template. Similar to a bacteriophage, a virus also comprises a protein coat and a nucleic acid core. In particular, viruses of anisotropic shapes, such as viral fibers, are suitable for nucleating and growing the catalytic nanowires described herein. Further, a virus can be genetically manipulated to express specific peptides on its coat for desirable binding to the ions. Viruses that have elongated or filamentous structures include those that are described in, for example, Christopher Ring, Genetically Engineered Viruses, (Ed) Bios Scientific (2001).
(352) In certain embodiments, the virus may have its genetic materials removed and only the exterior protein coat (capsid) remains as the biological template.
2. Nucleation
(353) Nucleation is the process of forming an inorganic nanowire in situ by converting soluble precursors (e.g., metal salts and anions) into nanocrystals in the presence of a template (e.g., a biological template). Typically, the nucleation and growth takes place from multiple binding sites along the length of the biological template in parallel. The growth continues until a structure encasing the biological template is formed. In some embodiments this structure is single-crystalline. In other embodiments the structure is amorphous, and in other embodiments the structure is polycrystalline. If desired, upon completion of the synthesis the organic biological template (e.g., bacteriophage) can be removed by thermal treatment (˜300° C.) in air or oxygen, without significantly affecting either the structure or shape of the inorganic material. In addition, dopants can be either simultaneously incorporated during the growth process or, in another embodiment, dopants can be incorporated via impregnation techniques.
(a) Nanowire Growth Methods
(354)
(355) In one embodiment, a method for preparing inorganic catalytic polycrystalline nanowires is provided, the nanowires each having a ratio of effective length to actual length of less than one and an aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV, wherein the nanowires each comprise one or more elements selected from Groups 1 through 7, lanthanides, actinides or combinations thereof. The method comprises:
(356) admixing (A) with a mixture comprising (B) and (C);
(357) admixing (B) with a mixture comprising (A) and (C); or
(358) admixing (C) with a mixture comprising (A) and (B) to obtain a mixture comprising (A), (B) and (C), wherein (A), (B), and (C) comprise, respectively:
(359) (A) a biological template;
(360) (B) one or more salts comprising one or more metal elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof; and
(361) (C) one or more anion precursors.
(362) Another embodiment provides a method for preparing a nanowire comprising a metal oxide, a metal oxy-hydroxide, a metal oxycarbonate or a metal carbonate, the method comprising:
(363) a) providing a solution comprising a plurality of biological templates;
(364) (b) introducing at least one metal ion and at least one anion to the solution under conditions and for a time sufficient to allow for nucleation and growth of a nanowire comprising a plurality of metal salts (M.sub.mX.sub.nZ.sub.p) on the template; and
(365) (c) converting the nanowire (M.sub.mX.sub.nZ.sub.p) to a nanowire comprising a plurality of metal oxides (M.sub.xO.sub.y), metal oxy-hydroxides (M.sub.xO.sub.yOH.sub.z), metal oxycarbonates (M.sub.xO.sub.y(CO.sub.3).sub.z), metal carbonate (M.sub.x(CO.sub.3).sub.y) or combinations thereof.
(366) wherein:
(367) M is, at each occurrence, independently a metal element from any of Groups 1 through 7, lanthanides or actinides;
(368) X is, at each occurrence, independently hydroxide, carbonate, bicarbonate, phosphate, hydrogenphosphate, dihydrogenphosphate, sulfate, nitrate or oxalate;
(369) Z is O;
(370) n, m, x and y are each independently a number from 1 to 100; and p is a number from 0 to 100.
(371) In certain variations of the foregoing, two or more different metal ions may be used. This produces nanowires comprising a mixture of two or more metal oxides. Such nanowires may be advantageous in certain catalytic reactions. For example, in some embodiments the nanowire catalysts may comprise at least a first and second metal oxide wherein the first metal oxide has better OCM activity than the second metal oxide and the second metal oxide has better ODH activity than the first metal oxide. In certain embodiments of the above, Applicants have found that it may be advantageous to perform multiple sequential additions of the metal ion, This addition technique may be particularily applicable to embodiments wherein two or more different metal ions are employed to form a mixed nanowire (M1M2X.sub.xY.sub.y, wherein M1 and M2 are different metal elements), which can be converted to M1M2O.sub.z, for example by calcination. The slow addition may be performed over any period of time, for example from 1 day to 1 week. In this regard, use of a syringe pump or an automatic (e.g., robotic) liquid dispenser may be advantageous. Slow addition of the components help ensure that they will nucleate on the biological template instead of non-selectively precipitate.
(372) In various embodiments, the biological templates are phages, as defined herein. In further embodiments, the metal ion is provided by adding one or more metal salt (as described herein) to the solution. In other embodiments, the anion is provided by adding one or more anion precursor to the solution. In various embodiments, the metal ion and the anion can be introduced to the solution simultaneously or sequentially in any order. In some embodiments, the nanowire (M.sub.mX.sub.nZ.sub.p) is converted to a metal oxide nanowire by calcination, which is a thermal treatment that transforms or decomposes the M.sub.mX.sub.nZ.sub.p nanowire to a metal oxide. In yet another embodiment, the method further comprises doping the metal oxide nanowire with a dopant. Doping may be performed either before or after calcination. Converting the nanowire to a metal oxide (or oxy-hydroxide, oxy-carbonate, or carbonate, etc.) generally comprises calcining.
(373) In a variation of the above method, mixed metal oxides can be prepared (as opposed to a mixture of metal oxides). Mixed metal oxides can be represented by the following formula M1.sub.wM2.sub.xM3.sub.yO.sub.z, wherein M1, M2 and M3 are each independently absent or a metal element, and w, x, y and z are integers such that the overall charge is balanced. Mixed metal oxides comprising more than three metals are also contemplated and can be prepared via an analogous method. Such mixed metal oxides find utility in a variety of the catalytic reactions disclosed herein. One exemplary mixed metal oxide is Na.sub.10MnW.sub.5O.sub.17 (Example 18).
(374) Thus, one embodiment provides a method for preparing a mixed metal oxide nanowire comprising a plurality of mixed metal oxides (M1.sub.wM2.sub.xM3.sub.yO.sub.z), the method comprising:
(375) a) providing a solution comprising a plurality of biological templates;
(376) (b) introducing metal salts comprising M1, M2 and M3 to the solution under conditions and for a time sufficient to allow for nucleation and growth of a nanowire comprising a plurality of the metal salts on the template; and
(377) (c) converting the nanowire to a mixed metal oxide nanowire comprising a plurality of mixed metal oxides (M1.sub.wM2.sub.xM3.sub.yO.sub.z),
(378) wherein:
(379) M1, M2 and M3 are, at each occurrence, independently a metal element from any of Groups 1 through 7, lanthanides or actinides;
(380) n, m, x and y are each independently a number from 1 to 100; and
(381) p is a number from 0 to 100.
(382) In other embodiments, the present disclosure provides a method for preparing metal oxide nanowires which may not require a calcination step. Thus, in some embodiments the method for preparing metal oxide nanowires comprises:
(383) (a) providing a solution that includes a plurality of biological templates; and
(384) (b) introducing a compound comprising a metal to the solution under conditions and for a time sufficient to allow for nucleation and growth of a nanowire (M.sub.mY.sub.n) on the template;
(385) wherein:
(386) M is a metal element from any of Groups 1 through 7, lanthanides or actinides;
(387) Y is O;
(388) n and m are each independently a number from 1 to 100.
(389) In some specific embodiments of the foregoing method, M is an early transition metal, for example V, Nb, Ta, Ti, Zr, Hf, W, Mo or Cr. In other embodiments, the metal oxide is WO.sub.3. In yet another embodiment, the method further comprises doping the metal oxide nanowire with a dopant. In some further embodiments, a reagent is added which converts the compound comprising a metal into a metal oxide.
(390) In another embodiment, nanowires are prepared by using metal salts sensitive to water hydrolysis, for example NbCl.sub.5, WCl.sub.6, TiCl.sub.4, ZrCl.sub.4. A template can be placed in ethanol along with the metal salt. Water is then slowly added to the reaction in order to convert the metals salts to metal oxide coated template.
(391) By varying the nucleation conditions, including (without limitation): incubation time of phage and metal salt; incubation time of phage and anion; concentration of phage; metal ion concentration, anion concentration, sequence of adding anion and metal ions; pH; phage sequences; solution temperature in the incubation step and/or growth step; types of metal precursor salt; types of anion precursor; addition rate; number of additions; amount of metal salt and/or anion precursor per addition, the time that lapses between the additions of the metal salt and anion precursor, including, e.g., simultaneous (zero lapse) or sequential additions followed by respective incubation times for the metal salt and the anion precursor, stable nanowires of diverse compositions and surface properties can be prepared. For example, in certain embodiments the pH of the nucleation conditions is at least 7.0, at least 8.0, at least 9.0, at least 10.0, at least 11.0, at least 12.0 or at least 13.0.
(392) As noted above, the rate of addition of reactants (e.g., metal salt, metal oxide, anion precursor, etc.) is one parameter that can be controlled and varied to produce nanowires having different properties. During the addition of reactants to a solution containing an existing nanowire and/or a templating material (e.g., phage), a critical concentration is reached for which the speed of deposition of solids on the existing nanowire and/or templating material matches the rate of addition of reactants to the reaction mixture. At this point, the concentration of soluble cation stabilizes and stops rising. Thus, nanowire growth can be controlled and maximized by maintaining the speed of addition of reactants such that near super-saturation concentration of the cation is maintained. This helps ensure that no undesirable nucleation occurs. If super-saturation of the anion (e.g., hydroxide) is exceeded, a new solid phase can start nucleating which allows for non-selective solid precipitation, rather than nanowire growth. Thus, in order to selectively deposit an inorganic layer on an existing nanowire and/or a templating material, the addition rate of reactants should be controlled to avoid reaching super-saturation of the solution containing the suspended solids.
(393) Accordingly, in one embodiment, reactant is repeatedly added in small doses to slowly build up the concentration of the reactant in the solution containing the template. In some embodiments, the speed of addition of reactant is such that the reactant concentration in the solution containing the template is near (but less than) the saturation point of the reactant. In some other embodiments, the reactant is added portion wise (i.e., step addition) rather than continuously. In these embodiments, the amount of reactant in each portion, and the time between addition of each portion, is controlled such that the reactant concentration in the solution containing the template is near (but less than) the saturation point of the reactant. In certain embodiments of the foregoing, the reactant is a metal cation while in other embodiments the reactant is an anion.
(394) Initial formation of nuclei on a template can be obtained by the same method described above, wherein the concentration of reactant is increased until near, but not above, the supersaturation point of the reactant. Such an addition method facilitates nucleation of the solid phase on the template, rather than homogeneous non-seeding nucleation. In some embodiments, it is desirable to use a slower reactant addition speed during the initial nucleation phase as the super-saturation depression due to the template might be quite small at this point. Once the first layer of solid (i.e., nanowire) is formed on the template, the addition speed can be increased.
(395) In some embodiments, the addition rate of reactant is controlled such that the precipitation rate matches the addition rate of the reactant. In these embodiments, nanowires comprising two or more different metals can be prepared by controlling the addition rates of two or more different metal cation solutions such that the concentration of each cation in the templating solution is maintained at or near (but does not exceed) the saturation point for each cation.
(396) In some embodiments, the optimal speed of addition (and step size if using step additions) is controlled as a function of temperature. For example, in some embodiments the nanowire growth rate is accelerated at higher temperatures. Thus, the addition rate of reactants is adjusted according to the temperature of the tem plating solution.
(397) In other embodiments, modeling (iterative numeric rather than algebraic) of the nanowire growth process is used to determine optimal solution concentrations and supernatant re-cycling strategies.
(398) As noted above, the addition rate of reactants can be controlled and modified to change the properties of the nanowires. In some embodiments, the addition rate of a hydroxide source must be controlled such that the pH of the templating solution is maintained at the desired level. This method may require specialized equipment, and depending on the addition rate, the potential for localized spikes in pH upon addition of the hydroxide source is possible. Thus, in an alternative embodiment the present disclosure provides a method wherein the template solution comprises a weak base that slowly generates hydroxide in-situ, obviating the need for an automated addition sequence.
(399) In the above embodiment, organic epoxides, such as but not limited to propylene oxide and epichlorohydrin, are used to slowly increase the template solution pH without the need for automated pH control. The epoxides are proton scavengers and undergo an irreversible ring-opening reaction with a nucleophilic anion of the metal oxide precursor (such as but not limited to Cl.sup.− or NO.sub.3.sup.−). The net effect is a slow homogenous raise in pH to form metal hydroxy species in solution that deposit onto the template surface. In some embodiments, the organic epoxide is propylene oxide.
(400) An attractive feature of this method is that the organic epoxide can be added all at once, there is no requirement for subsequent additions of organic epoxide to grow metal oxide coatings over the course of the reaction. Due to the flexibility of the “epoxide-assisted” coatings, it is anticipated that many various embodiments can be employed to make new templated materials (e.g., nanowires). For example, mixed metal oxide nanowires can be prepared by starting with appropriate ratios of metal oxide precursors and propylene oxide in the presence of bacteriophage. In other embodiments, metal oxide deposition on bacteriophage can be done sequentially to prepare core/shell materials (described in more detail below).
(b) Metal Salt
(401) As noted above, the nanowires are prepared by nucleation of metal ions in the presence of an appropriate template, for example, a bacteriophage. In this respect, any soluble metal salt may be used as the precursor of metal ions that nucleate on the template. Soluble metal salts of the metals from Groups 1 through 7, lanthanides and actinides are particularly useful and all such salts are contemplated.
(402) In one embodiment, the soluble metal salt comprises chlorides, bromides, iodides, nitrates, sulfates, acetates, oxides, oxyhalides, oxynitrates, phosphates (including hydrogenphosphate and dihydrogenphosphate) formates, alkoxides or oxalates of metal elements from Groups 1 through 7, lanthanides, actinides or combinations thereof. In more specific embodiments, the soluble metal salt comprises chlorides, nitrates or sulfates of metal elements from Groups 1 through 7, lanthanides, actinides or combinations thereof. The present disclosure contemplates all possible chloride, bromide, iodide, nitrate, sulfate, acetate, oxide, oxyhalides, oxynitrates, phosphates (including hydrogenphosphate and dihydrogenphosphate) formates, alkoxides and oxalate salts of metal elements from Groups 1 through 7, lanthanides, actinides or combinations thereof.
(403) In another embodiment, the metal salt comprises LiCl, LiBr, LiI, LiNO.sub.3, Li.sub.2SO.sub.4, LiCO.sub.2CH.sub.3, Li.sub.2C.sub.2O.sub.4, Li.sub.3PO.sub.4, Li.sub.2HPO.sub.4, LiH.sub.2PO.sub.4, LiCO.sub.2H, LiOR, NaCl, NaBr, NaI, NaNO.sub.3, Na.sub.2SO.sub.4, NaCO.sub.2CH.sub.3, Na.sub.2C.sub.2O.sub.4, Na.sub.3PO.sub.4, Na.sub.2HPO.sub.4, NaH.sub.2PO.sub.4, NaCO.sub.2H, NaOR, KCl, KBr, KI, KNO.sub.3, K.sub.2SO.sub.4, KCO.sub.2CH.sub.3, K.sub.2C.sub.2O.sub.4, K.sub.3PO4, K.sub.2HPO.sub.4, KH.sub.2PO.sub.4, KCO.sub.2H, KOR, RbCl, RbBr, RbI, RbNO.sub.3, Rb.sub.2SO.sub.4, RbCO.sub.2CH.sub.3, Rb.sub.2C.sub.2O.sub.4, Rb.sub.3PO.sub.4, Rb.sub.2HPO.sub.4, RbH.sub.2PO.sub.4, RbCO.sub.2H, RbOR, CsCl, CsBr, CsI, CsNO.sub.3, Cs.sub.2SO.sub.4, CsCO.sub.2CH.sub.3, Cs.sub.2C.sub.2O.sub.4, Cs.sub.3PO.sub.4, Cs.sub.2HPO.sub.4, CsH.sub.2PO.sub.4, CsCO.sub.2H, CsOR, BeCl.sub.2, BeBr.sub.2, BeI.sub.2, Be(NO.sub.3).sub.2, BeSO.sub.4, Be(CO.sub.2CH.sub.3).sub.2, BeC.sub.2O.sub.4, Be.sub.3(PO4).sub.2, BeHPO.sub.4, Be(H.sub.2PO.sub.4).sub.2, Be(CO.sub.2H).sub.2, Be(OR).sub.2, MgCl.sub.2, MgBr.sub.2, MgI.sub.2, Mg(NO.sub.3).sub.2, MgSO.sub.4, Mg(CO.sub.2CH.sub.3).sub.2, MgC.sub.2O.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgHPO.sub.4, Mg(H.sub.2PO.sub.4).sub.2, Mg(CO.sub.2H).sub.2, Mg(OR).sub.2, CaCl.sub.2, CaBr.sub.2, CaI.sub.2, Ca(NO.sub.3).sub.2, CaSO.sub.4, Ca(CO.sub.2CH.sub.3).sub.2, CaC.sub.2O.sub.4, Mg.sub.3(PO.sub.4).sub.2, MgHPO.sub.4, Mg(H.sub.2PO.sub.4).sub.2, Mg(CO.sub.2H).sub.2, Mg(OR).sub.2, SrCl.sub.2, SrBr.sub.2, SrI.sub.2, Sr(NO.sub.3).sub.2, SrSO.sub.4, Sr(CO.sub.2CH.sub.3).sub.2, SrC.sub.2O.sub.4, Sr.sub.3(PO.sub.4).sub.2, SrHPO.sub.4, Sr(H.sub.2PO.sub.4).sub.2, Sr(CO.sub.2H).sub.2, Sr(OR).sub.2, BaCl.sub.2, BaBr.sub.2, BaI.sub.2, Ba(NO.sub.3).sub.2, BaSO.sub.4, Ba(CO.sub.2CH.sub.3).sub.2, BaC.sub.2O.sub.4, Ba.sub.3(PO.sub.4).sub.2, BaHPO.sub.4, Ba(H.sub.2PO.sub.4).sub.2, Ba(CO.sub.2H).sub.2, Ba(OR).sub.2, ScCl.sub.3, ScBr.sub.3, ScI.sub.3, Sc(NO.sub.3).sub.3, Sc.sub.2(SO.sub.4).sub.3, Sc(CO.sub.2CH.sub.3).sub.3, Sc.sub.2(C.sub.2O.sub.4).sub.3, ScPO.sub.4, Sc.sub.2(HPO.sub.4).sub.3, Sc(H.sub.2PO.sub.4).sub.3, Sc(CO.sub.2H).sub.3, Sc(OR).sub.3, YCl.sub.3, YBr.sub.3, YI.sub.3, Y(NO.sub.3).sub.3, Y.sub.2(SO.sub.4).sub.3, Y(CO.sub.2CH.sub.3).sub.3, Y.sub.2(C.sub.2O.sub.4).sub.3, YPO.sub.4, Y.sub.2(HPO.sub.4).sub.3, Y(H.sub.2PO.sub.4).sub.3, Y(CO.sub.2H).sub.3, Y(OR).sub.3, TiCl.sub.4, TiBr.sub.4, TiI.sub.4, Ti(NO.sub.3).sub.4, Ti(SO.sub.4).sub.2, Ti(CO.sub.2CH.sub.3).sub.4, Ti(C.sub.2O.sub.4).sub.2, Ti.sub.3(PO.sub.4).sub.4, Ti(HPO.sub.4).sub.2, Ti(H.sub.2PO.sub.4).sub.4, Ti(CO.sub.2H).sub.4, Ti(OR).sub.4, ZrCl.sub.4, ZrOCl.sub.2, ZrBr.sub.4, ZrI.sub.4, Zr(NO.sub.3).sub.4, ZrO(NO.sub.3).sub.2, Zr(SO.sub.4).sub.2, Zr(CO.sub.2CH.sub.3).sub.4, Zr(C.sub.2O.sub.4).sub.2, Zr.sub.3(PO.sub.4).sub.4, Zr(HPO.sub.4).sub.2, Zr(H.sub.2PO.sub.4).sub.4, Zr(CO.sub.2H).sub.4, Zr(OR).sub.4, HfCl.sub.4, HfBr.sub.4, HfI.sub.4, Hf(NO.sub.3).sub.4, Hf(SO.sub.4).sub.2, Hf(CO.sub.2CH.sub.3).sub.4, Hf(C.sub.2O.sub.4).sub.2, Hf.sub.3(PO.sub.4).sub.4, Hf(HPO.sub.4).sub.2, Hf(H.sub.2PO.sub.4).sub.4, Hf(CO.sub.2H).sub.4, Hf(OR).sub.4, LaCl.sub.3, LaBr.sub.3, LaI.sub.3, La(NO.sub.3).sub.3, La.sub.2(SO.sub.4).sub.3, La(CO.sub.2CH.sub.3).sub.3, La.sub.2(C.sub.2O.sub.4).sub.3, LaPO.sub.4, La.sub.2(HPO.sub.4).sub.3, La(H.sub.2PO.sub.4).sub.3, La(CO.sub.2H).sub.3, La(OR).sub.3, WCl.sub.2, WCl.sub.3, WCl.sub.4, WCl.sub.5, WCl.sub.6, WBr.sub.2, WBr.sub.3, WBr.sub.4, WBr.sub.5, WBr.sub.6, WI.sub.2, WI.sub.3, WI.sub.4, WI.sub.5,WI.sub.6, W(NO.sub.3).sub.2, W(NO.sub.3).sub.3, W(NO.sub.3).sub.4, W(NO.sub.3).sub.5, W(NO.sub.3).sub.6, W(CO.sub.2CH.sub.3).sub.2, W(CO.sub.2CH.sub.3).sub.3, W(CO.sub.2CH.sub.3).sub.4, W(CO.sub.2CH.sub.3).sub.5, W(CO.sub.2CH.sub.3).sub.6, WC.sub.2O.sub.4, W.sub.2(C.sub.2O.sub.4).sub.3, W(C.sub.2O.sub.4).sub.2, W.sub.2(C.sub.2O.sub.4).sub.5, W(C.sub.2O.sub.4).sub.6, WPO.sub.4, W.sub.2(HPO.sub.4).sub.3, W(H.sub.2PO.sub.4).sub.3, W(CO.sub.2H).sub.3, W(OR).sub.3, W.sub.3(PO.sub.4).sub.4, W(HPO.sub.4).sub.2, W(H.sub.2PO.sub.4).sub.4, W(CO.sub.2H).sub.4, W(OR).sub.4, W.sub.3(PO.sub.4).sub.5, W.sub.2(HPO.sub.4).sub.5, W(H.sub.2PO.sub.4).sub.5, W(CO.sub.2H).sub.5, W(OR).sub.5, W(PO.sub.4).sub.2, W(HPO.sub.4).sub.3, W(H.sub.2PO.sub.4).sub.6, W(CO.sub.2H).sub.6, W(OR).sub.6, MnCl.sub.2 MnCl.sub.3, MnBr.sub.2 MnBr.sub.3, MnI.sub.2 MnI.sub.3, Mn(NO.sub.3).sub.2, Mn(NO.sub.3).sub.3, MnSO.sub.4, Mn.sub.2(SO.sub.4).sub.3, Mn(CO.sub.2CH.sub.3).sub.2, Mn(CO.sub.2CH.sub.3).sub.3, MnC.sub.2O.sub.4, Mn.sub.2(C.sub.2O.sub.4).sub.3, Mn.sub.3(PO.sub.4).sub.2, MnHPO.sub.4, Mn(H.sub.2PO.sub.4).sub.2, Mn(CO.sub.2H).sub.2, Mn(OR).sub.2, MnPO.sub.4, Mn.sub.2(HPO.sub.4).sub.3, Mn(H.sub.2PO.sub.4).sub.3, Mn(CO.sub.2H).sub.3, Mn(OR).sub.3, MoCl.sub.2, MoCl.sub.3, MoCl.sub.4, MoCl.sub.5, MoBr.sub.2, MoBr.sub.3, MoBr.sub.4, MoBr.sub.5, MoI.sub.2, MoI.sub.3, MoI.sub.4, MoI.sub.5, Mo(NO.sub.3).sub.2, Mo(NO.sub.3).sub.3, Mo(NO.sub.3).sub.4, Mo(NO.sub.3).sub.5, MoSO.sub.4, Mo.sub.2(SO.sub.4).sub.3, Mo(SO.sub.4).sub.2, Mo.sub.2(SO.sub.4).sub.5, Mo(CO.sub.2CH.sub.3).sub.2, Mo(CO.sub.2CH.sub.3).sub.3, Mo(CO.sub.2CH.sub.3).sub.4, Mo(CO.sub.2CH.sub.3).sub.5, MoC.sub.2O.sub.4, MO.sub.2(C.sub.2O.sub.4).sub.3, Mo(C.sub.2O.sub.4).sub.2, MO.sub.2(C.sub.2O.sub.4).sub.5, Mo.sub.3(PO.sub.4).sub.2, MoHPO.sub.4, Mo(H.sub.2PO.sub.4).sub.2, Mo(CO.sub.2H).sub.2, Mo(OR).sub.2, MoPO.sub.4, Mo.sub.2(HPO.sub.4).sub.3, Mo(H.sub.2PO.sub.4).sub.3, Mo(CO.sub.2H).sub.3, Mo(OR).sub.3, Mo.sub.3(PO.sub.4).sub.4, Mo(HPO.sub.4).sub.2, Mo(H.sub.2PO.sub.4).sub.4, Mo(CO.sub.2H).sub.4, Mo(OR).sub.4, Mo.sub.3(PO.sub.4).sub.5, Mo.sub.2(HPO.sub.4).sub.5, Mo(H.sub.2PO.sub.4).sub.5, Mo(CO.sub.2H).sub.5, MO(OR).sub.5, VCl, VCl.sub.2, VCl.sub.3, VCl.sub.4, VCl.sub.5, VBr, VBr.sub.2, VBr.sub.3, VBr.sub.4, VBr.sub.5, VI, VI.sub.2, VI.sub.3, VI.sub.4, VI.sub.5, VNO.sub.3, V(NO.sub.3).sub.2, V(NO.sub.3).sub.3, V(NO.sub.3).sub.4, V(NO.sub.3).sub.5, V.sub.2SO.sub.4, VSO.sub.4, V.sub.2(SO.sub.4).sub.3, V(SO.sub.4).sub.4, VCO.sub.2CH.sub.3, V(CO.sub.2CH.sub.3).sub.2, V(CO.sub.2CH.sub.3).sub.3, V(CO.sub.2CH.sub.3).sub.4, V.sub.2C.sub.2O.sub.4, VC.sub.2O.sub.4, V.sub.2(C.sub.2O.sub.4).sub.3, V(C.sub.2O.sub.4).sub.4, V.sub.3PO.sub.4, V.sub.2HPO.sub.4, VH.sub.2PO.sub.4, VCO.sub.2H, VOR, V.sub.3(PO.sub.4).sub.2, VHPO.sub.4, V(H.sub.2PO.sub.4).sub.2, V(CO.sub.2H).sub.2, V(OR).sub.2, VPO.sub.4, V.sub.2(HPO.sub.4).sub.3, V(H.sub.2PO.sub.4).sub.3, V(CO.sub.2H).sub.3, V(OR).sub.3, V.sub.3(PO.sub.4).sub.4, V(HPO.sub.4).sub.2, V(H.sub.2PO.sub.4).sub.4, V(CO.sub.2H).sub.4, V(OR).sub.4, V.sub.3(PO.sub.4).sub.5, V.sub.2(HPO.sub.4).sub.5, V(H.sub.2PO.sub.4).sub.5, V(CO.sub.2H).sub.5, V(OR).sub.5, TaCl, TaCl.sub.2, TaCl.sub.3, TaCl.sub.4, TaCl.sub.5, TaBr, TaBr.sub.2, TaBr.sub.3, TaBr.sub.4, TaBr.sub.5, TaI, TaI.sub.2, TaI.sub.3, TaI.sub.4, TaI.sub.5, TaNO.sub.3, Ta(NO.sub.3).sub.2, Ta(NO.sub.3).sub.3, Ta(NO.sub.3).sub.4, Ta(NO.sub.3).sub.5, Ta.sub.2SO.sub.4, TaSO.sub.4, Ta.sub.2(SO.sub.4).sub.3, Ta(SO.sub.4).sub.4, TaCO.sub.2CH.sub.3, Ta(CO.sub.2CH.sub.3).sub.2, Ta(CO.sub.2CH.sub.3).sub.3, Ta(CO.sub.2CH.sub.3).sub.4, Ta.sub.2C.sub.2O.sub.4, TaC.sub.2O.sub.4, Ta.sub.2(C.sub.2O.sub.4).sub.3, Ta(C.sub.2O.sub.4).sub.4, Ta.sub.3PO.sub.4, Ta.sub.2HPO.sub.4, TaH.sub.2PO.sub.4, TaCO.sub.2H, TaOR, Ta.sub.3(PO.sub.4).sub.2, TaHPO.sub.4, Ta(H.sub.2PO.sub.4).sub.2, Ta(CO.sub.2H).sub.2, Ta(OR).sub.2, TaPO.sub.4, Ta.sub.2(HPO.sub.4).sub.3, Ta(H.sub.2PO.sub.4).sub.3, Ta(CO.sub.2H).sub.3, Ta(OR).sub.3, Ta.sub.3(PO.sub.4).sub.4, Ta(HPO.sub.4).sub.2, Ta(H.sub.2PO.sub.4).sub.4, Ta(CO.sub.2H).sub.4, Ta(OR).sub.4, Ta.sub.3(PO.sub.4).sub.5, Ta.sub.2(HPO.sub.4).sub.5, Ta(H.sub.2PO.sub.4).sub.5, Ta(CO.sub.2H).sub.5, Ta(OR).sub.5, NbCl, NbCl.sub.2, NbCl.sub.3, NbCl.sub.4, NbCl.sub.5, NbBr, NbBr.sub.2, NbBr.sub.3, NbBr.sub.4, NbBr.sub.5, NbI, NbI.sub.2, NbI.sub.3, NbI.sub.4, NbI.sub.5, NbNO.sub.3, Nb(NO.sub.3).sub.2, Nb(NO.sub.3).sub.3, Nb(NO.sub.3).sub.4, Nb(NO.sub.3).sub.5, Nb.sub.2SO.sub.4, NbSO.sub.4, Nb.sub.2(SO.sub.4).sub.3, Nb(SO.sub.4).sub.4, NbCO.sub.2CH.sub.3, Nb(CO.sub.2CH.sub.3).sub.2, Nb(CO.sub.2CH.sub.3).sub.3, Nb(CO.sub.2CH.sub.3).sub.4, Nb.sub.2C.sub.2O.sub.4, NbC.sub.2O.sub.4, Nb.sub.2(C.sub.2O.sub.4).sub.3, Nb(C.sub.2O.sub.4).sub.4, Nb.sub.3PO.sub.4, Nb.sub.2HPO.sub.4, NbH.sub.2PO.sub.4, NbCO.sub.2H, NbOR, Nb.sub.3(PO.sub.4).sub.2, NbHPO.sub.4, Nb(H.sub.2PO.sub.4).sub.2, Nb(CO.sub.2H).sub.2, Nb(OR).sub.2, NbPO.sub.4, Nb.sub.2(HPO.sub.4).sub.3, Nb(H.sub.2PO.sub.4).sub.3, Nb(CO.sub.2H).sub.3, Nb(OR).sub.3, Nb.sub.3(PO.sub.4).sub.4, Nb(HPO.sub.4).sub.2, Nb(H.sub.2PO.sub.4).sub.4, Nb(CO.sub.2H).sub.4, Nb(OR).sub.4, Nb.sub.3(PO.sub.4).sub.5, Nb.sub.2(HPO.sub.4).sub.5, Nb(H.sub.2PO.sub.4).sub.5, Nb(CO.sub.2H).sub.5, Nb(OR).sub.5, NdCl.sub.3, NdBr.sub.3, NdI.sub.3, Nd(NO.sub.3).sub.3, Nd.sub.2(SO.sub.4).sub.3, Nd(CO.sub.2CH.sub.3).sub.3, Nd.sub.2(C.sub.2O.sub.4).sub.3, NdPO.sub.4, Nd.sub.2(HPO.sub.4).sub.3, Nd(H.sub.2PO.sub.4).sub.3, Nd(CO.sub.2H).sub.3, Nd(OR).sub.3, EuCl.sub.3, EuBr.sub.3, EuI.sub.3, Eu(NO.sub.3).sub.3, Eu.sub.2(SO.sub.4).sub.3, Eu(CO.sub.2CH.sub.3).sub.3, Eu.sub.2(C.sub.2O.sub.4).sub.3, NdPO.sub.4, Nd.sub.2(HPO.sub.4).sub.3, Nd(H.sub.2PO.sub.4).sub.3, Nd(CO.sub.2H).sub.3, Nd(OR).sub.3, PrCl.sub.3, PrBr.sub.3, PrI.sub.3, Pr(NO.sub.3).sub.3, Pr.sub.2(SO.sub.4).sub.3, Pr(CO.sub.2CH.sub.3).sub.3, Pr.sub.2(C.sub.2O.sub.4).sub.3, PrPO.sub.4, Pr.sub.2(HPO.sub.4).sub.3, Pr(H.sub.2PO.sub.4).sub.3, Pr(CO.sub.2H).sub.3, Pr(OR).sub.3, SmCl.sub.3, SmBr.sub.3, SmI.sub.3, Sm(NO.sub.3).sub.3, Sm.sub.2(SO.sub.4).sub.3, Sm(CO.sub.2CH.sub.3).sub.3, Sm.sub.2(C.sub.2O.sub.4).sub.3, SmPO.sub.4, Sm.sub.2(HPO.sub.4).sub.3, Sm(H.sub.2PO.sub.4).sub.3, Sm(CO.sub.2H).sub.3, Sm(OR).sub.3, CeCl.sub.3, CeBr.sub.3, CeI.sub.3, Ce(NO.sub.3).sub.3, Ce.sub.2(SO.sub.4).sub.3, Ce(CO.sub.2CH.sub.3).sub.3, Ce.sub.2(C.sub.2O.sub.4).sub.3 CePO.sub.4, Ce.sub.2(HPO.sub.4).sub.3, Ce(H.sub.2PO.sub.4).sub.3, Ce(CO.sub.2H).sub.3, Ce(OR).sub.3, or combinations thereof, wherein R is alkyl, alkenyl, alkynyl or aryl.
(404) In more specific embodiments, the metal salt comprises MgCl.sub.2, LaCl.sub.3, ZrCl.sub.4, WCl.sub.4, MoCl.sub.4, MnCl.sub.2 MnCl.sub.3, Mg(NO.sub.3).sub.2, La(NO.sub.3).sub.3, ZrOCl.sub.2, Mn(NO.sub.3).sub.2, Mn(NO.sub.3).sub.3, ZrO(NO.sub.3).sub.2, Zr(NO.sub.3).sub.4, or combinations thereof.
(405) In other embodiments, the metal salt comprises NdCl.sub.3, NdBr.sub.3, NdI.sub.3, Nd(NO.sub.3).sub.3, Nd.sub.2(SO.sub.4).sub.3, Nd(CO.sub.2CH.sub.3).sub.3, Nd.sub.2(C.sub.2O.sub.4).sub.3, EuCl.sub.3, EuBr.sub.3, EuI.sub.3, Eu(NO.sub.3).sub.3, Eu.sub.2(SO.sub.4).sub.3, Eu(CO.sub.2CH.sub.3).sub.3, Eu.sub.2(C.sub.2O.sub.4).sub.3, PrCl.sub.3, PrBr.sub.3, PrI.sub.3, Pr(NO.sub.3).sub.3, Pr.sub.2(SO.sub.4).sub.3, Pr(CO.sub.2CH.sub.3).sub.3, Pr.sub.2(C.sub.2O.sub.4).sub.3 or combinations thereof.
(406) In still other embodiments, the metal salt comprises Mg, Ca, Mg, W, La, Nd, Sm, Eu, W, Mn, Zr or mixtures thereof. The salt may be in the form of (oxy)chlorides, (oxy)nitrates or tungstates.
(c) Anion Precursor
(407) The anions, or counter ions of the metal ions that nucleate on the template, are provided in the form of an anion precursor. The anion precursor dissociates in the solution phase and releases an anion. Thus, the anion precursor can be any stable soluble salts having the desired anion. For instance, bases such as alkali metal hydroxides (e.g., sodium hydroxide, lithium hydroxide, potassium hydroxides) and ammonium hydroxide are anion precursors that provide hydroxide ions for nucleation. Alkali metal carbonates (e.g., sodium carbonate, potassium carbonates) and ammonium carbonate are anion precursors that provide carbonates ions for nucleation.
(408) In certain embodiments, the anion precursor comprises one or more metal hydroxide, metal carbonate, metal bicarbonate, metal sulfate, metal phosphate or metal oxalate. Preferably, the metal is an alkali or an alkaline earth metal. Thus, the anion precursor may comprise any one of alkali metal hydroxides, carbonates, bicarbonates, sulfates, phosphates or oxalate; or any one of alkaline earth metal hydroxides, carbonates, bicarbonates, sulfates, phosphates or oxalates.
(409) In some specific embodiments, the one or more anion precursors comprise LiOH, NaOH, KOH, Sr(OH).sub.2, Ba(OH).sub.2, Na.sub.2CO.sub.3, K.sub.2CO.sub.3, NaHCO.sub.3, KHCO.sub.3 (NR.sub.4).sub.2CO.sub.3, and NR.sub.4OH, wherein each R is independently selected from H, C.sub.1-C.sub.18 alkyl, C.sub.1-C.sub.18 alkenyl, C.sub.1-C.sub.18 alkynyl and C.sub.1-C.sub.18 aryl. Ammonium salts may provide certain advantages in that there is less possibility of introducing unwanted metal impurities. Accordingly, in a further embodiment, the anion precursor comprises ammonium hydroxide or ammonium carbonate.
(410) The dimensions of the nanowires are comparable to those of the biological templates (e.g., phage), although they can have different aspect ratios as longer growth can be used to increase the diameter while the length will increase in size at a much slower rate. The spacing of peptides on the phage surface controls the nucleation location and the catalytic nanowire size based on steric hindrance. The specific peptide sequence information can (or may) dictate the identity, size, shape and crystalline face of the catalytic nanowire being nucleated. To achieve the desired stochiometry between metal elements, support and dopants, multiple peptides specific for these discrete materials can be co-expressed within the same phage. Alternatively, precursor salts for the materials can be combined in the reaction at the desired stochiometry. The techniques for phage propagation and purification are also well established, robust and scalable. Multi-kilogram amounts of phage can be easily produced, thus assuring straightforward scale up to large, industrial quantities.
3. Core/Shell Structures
(411) In certain embodiments, nanowires can be grown on a support nanowire that has no or a different catalytic property.
(412) In other embodiments, M1.sub.x1O.sub.y1 comprises La.sub.2O.sub.3 while in other embodiments M2.sub.x2O.sub.y2 comprises La.sub.2O.sub.3. In other embodiments of the foregoing, M1.sub.x1O.sub.y1 or M2.sub.x2O.sub.y2 further comprises a dopant, wherein the dopant comprises Nd, Mn, Fe, Zr, Sr, Ba, Y or combinations thereof. Other specific combinations of core/shell nanowires are also envisioned within the scope of the present disclosure.
(413) Thus, one embodiment provides a method for preparing metal oxide, metal oxy-hydroxide, metal oxycarbonate or metal carbonate nanowires in a core/shell structure, the method comprising:
(414) (a) providing a solution that includes a plurality of biological templates;
(415) (b) introducing a first metal ion and a first anion to the solution under conditions and for a time sufficient to allow for nucleation and growth of a first nanowire (M1.sub.m1X1.sub.n1Z.sub.p1) on the template;
(416) (c) introducing a second metal ion and optionally a second anion to the solution under conditions and for a time sufficient to allow for nucleation and growth of a second nanowire (M2.sub.m2X2.sub.n2 Z.sub.p2) on the first nanowire (M1.sub.m1X1.sub.n1 Z.sub.p1); and
(417) (d) converting the first nanowire (M1.sub.m1X1.sub.n1Z.sub.p1) and the second nanowire (M2.sub.m2X2.sub.n2 Z.sub.p2) to the respective metal oxide nanowires (M1.sub.x1O.sub.y1) and (M2.sub.x2O.sub.y2), the respective metal oxy-hydroxide nanowires (M1.sub.x1O.sub.y1OH.sub.z1) and (M2.sub.x2O.sub.y2OH.sub.z2) the respective metal oxycarbonate nanowires (M1.sub.x1O.sub.y1(CO.sub.3).sub.z1) and (M2.sub.x2O.sub.y2(CO.sub.3).sub.z2) or the respective metal carbonate nanowires (M1.sub.x1(CO.sub.3).sub.y1) and (M2.sub.x2(CO.sub.3).sub.y2),
(418) wherein:
(419) M1 and M2 are the same or different and independently selected from a metal element;
(420) X1 and X2 are the same or different and independently hydroxide, carbonate, bicarbonate, phosphate, hydrogenphosphate, dihydrogenphosphate, sulfate, nitrate or oxalate;
(421) Z is O;
(422) n1, m1,n2, m2, x1, y1, z1, x2, y2 and z2 are each independently a number from 1 to 100; and
(423) p1 and p2 are independently a number from 0 to 100.
(424) In some embodiments, M1 and M2 are the same or different and independently selected from a metal element from any of Groups 2 through 7, lanthanides or actinides
(425) In various embodiments, the biological templates are phages, as defined herein. In further embodiments, the respective metal ion is provided by adding one or more respective metal salts (as described herein) to the solution. In other embodiments, the respective anions are provided by adding one or more respective anion precursors to the solution. In various embodiments, the first metal ion and the first anion can be introduced to the solution simultaneously or sequentially in any order. Similarly, the second metal ion and optionally the second anion can be introduced to the solution simultaneously or sequentially in any order. The first and second nanowire are typically converted to a metal oxide, metal oxy-hydroxide, metal oxycarbonate or metal carbonate nanowire in a core/shell structure by calcination.
(426) In yet another embodiment, the method further comprises doping the metal oxide nanowire in a core/shell structure with a dopant.
(427) By varying the nucleation conditions, including the pH of the solution, relative ratio of metal salt precursors and the anion precursors, relative ratios of the precursors and the phage of the synthetic mixture, stable nanowires of diverse compositions and surface properties can be prepared.
(428) In certain embodiments, the core nanowire (the first nanowire) is not catalytically active or less so than the shell nanowire (the second nanowire), and the core nanowire serve as an intrinsic catalytic support for the more active shell nanowire. For example, ZrO.sub.2 may not have high catalytic activity in an OCM reaction, whereas Sr.sup.2+ doped La.sub.2O.sub.3 does. A ZrO.sub.2 core thus may serve as a support for the catalytic Sr.sup.2+ doped La.sub.2O.sub.3 shell.
(429) In some embodiments, the present disclosure provides a nanowire comprising a core/shell structure and comprising a ratio of effective length to actual length of less than one. In other embodiments, the nanowires having a core/shell structure comprise a ratio of effective length to actual length equal to one.
(430) Nanowires in a core/shell arrangement may be prepared in the absence of a biological template. For example, a nanowire comprising a first metal may be prepared according to any of the non-template directed methods described herein. A second metal may then be nucleated or plated onto the nanowire to form a core/shell nanowire. The first and second metals may be the same or different. Other methods for preparing core/shell nanowires in the absence of a biological template are also envisaged.
4. Diversity
(431) As noted above, in some embodiments, the disclosed template-directed synthesis provides nanowires having diverse compositions and/or morphologies. This method combines two extremely powerful approaches, evolutionary selection and inorganic synthesis, to produce a library of nanowire catalysts with a new level of control over materials composition, materials surface and crystal structure. These nanowires prepared by biologically-templated methods take advantage of genetic engineering techniques to enable combinatorial synthesis of robust, active and selective inorganic catalytic polycrystalline nanowires. With selection, evolution and a combinatorial library with over a hundred billion sequence possibilities, nanowires having high specificity and product conversion yields in catalytic reactions are generated. This permits simultaneous optimization the nanowires' catalytic properties in a high-dimensional space.
(432) In various embodiments, the synthetic parameters for nucleating and growing nanowires can be manipulated to create nanowires of diverse compositions and morphologies. Typical synthetic parameters include, without limitation, concentration ratios of metal ions and active functional groups on the phage; concentration ratios of metal and anions (e.g., hydroxide); incubation time of phage and metal salt; incubation time of phage and anion; concentration of phage; sequence of adding anion and metal ions; pH; phage sequences; solution temperature in the incubation step and/or growth step; types of metal precursor salt; types of anion precursor; addition rate, number of additions; the time that lapses between the additions of the metal salt and anion precursor, including, e.g., simultaneous (zero lapse) or sequential additions followed by respective incubation times for the metal salt and the anion precursor.
(433) Additional variable synthetic parameters include, growth time once both metal and anion are present in the solution; choice of solvents (although water is typically used, certain amounts of alcohol, such as methanol, ethanol and propanol, can be mixed with water); choice of, or the number of, metal salts used (e.g., both LaCl.sub.3 and La(NO.sub.3).sub.3 can be used to provide La.sup.3+ ions); choice of, or the number of, anion precursors used (e.g., both NaOH then LiOH can be used to provide the hydroxide); choice of, or the number of, different phage sequences used; the presence or absence of a buffer solution; the different stages of the growing step (e.g., nanowires may be precipitated and cleaned and resuspended in a second solution and perform a second growth of the same material (thicker core) or different material to form a core/shell structure.
(434) Thus, libraries of nanowires can be generated with diverse physical properties and characteristics such as: composition, e.g., basic metal oxides (M.sub.xO.sub.y), size, shape, surface morphology, exposed crystal faces/edge density, crystallinity, dispersion, and stoichiometry and nanowire template physical characteristics including length, width, porosity and pore density. High throughput, combinatorial screening methods are then applied to evaluate the catalytic performance characteristics of the nanowires (see, e.g.,
(435) Direct Synthesis of Nanowires
(436) In some embodiments, the nanowires can be synthesized in a solution phase in the absence of a template. Typically, a hydrothermal or sol gel approach can be used to create straight (i.e., ratio of effective length to actual length equal to one) and substantially single crystalline nanowires. As an example, nanowires comprising a metal oxide can be prepared by (1) forming nanowires of a metal oxide precursor (e.g., metal hydroxide) in a solution of a metal salt and an anion precursor; (2) isolating the nanowires of the metal oxide precursor; and (3) calcining the nanowires of the metal oxide precursor to provide nanowires of a corresponding metal oxide. In other embodiments (for example MgO nanowires), the synthesis goes through an intermediate which can be prepared as a nanowire and then converted into the desired product while maintaining its morphology. Optionally, the nanowires comprising a metal oxide can be doped according to methods described herein. Dopant may be incorporated either before or after an optional calcincation step.
(437) In other certain embodiment, nanowires comprising a core/shell structure are prepared in the absence of a biological template. Such methods may include, for example, preparing a nanowire comprising a first metal and growing a shell on the outersurface of this nanowire, wherein the shell comprises a second metal. The first and second metals may be the same or different.
(438) In other aspects, a core/shell nanowire is prepared in the absence of a biological template. Such methods comprise preparing a nanowire comprising an inner core and an outer shell, wherein the inner core comprises a first metal, and the outer shell comprises a second metal, the method comprising: a) preparing a first nanowire comprising the first metal; and b) treating the first nanowire with a salt comprising the second metal.
(439) In some embodiments of the foregoing method, the method further comprises addition of an anion precurser to a mixture obtained in step b). In yet other examples, the first metal and the second metal are different. In yet further embodiments, the salt comprising the second metal is a halide or a nitrate. In certain aspects it may be advantageous to perform one or more sequential additions of the salt comprising the second metal and an anion precurser. Such sequential additions help prevent non-selective precipitation of the second metal and favor conditions wherein the second metal nucleates on the surface of the first nanowire to form a shell of the second metal. Furthermore, the first nanowire may be prepared by any method, for example via a template directed method (e.g., phage).
(440) As in the template-directed synthesis, the synthetic conditions and parameters of the direct synthesis of nanowires can also be adjusted to create diverse compositions and surface morphologies (e.g., crystal faces) and dopant levels. For example, variable synthetic parameters include: concentration ratios of metal and anions (e.g., hydroxide); reaction temperature; reaction time; sequence of adding anion and metal ions; pH; types of metal precursor salt; types of anion precursor; number of additions; the time that lapses between the additions of the metal salt and anion precursor, including, e.g., simultaneous (zero lapse) or sequential additions followed by respective incubation times for the metal salt and the anion precursor.
(441) In addition, the choice of solvents or surfactants may influence the crystal growth of the nanowires, thereby generating different nanowire dimensions (including aspect ratios). For example, solvents such as ethylene glycol, poly(ethylene glycol), polypropylene glycol and poly(vinyl pyrrolidone) can serve to passivate the surface of the growing nanowires and facilitate a linear growth of the nanowire.
(442) In some embodiments, nanowires can be prepared directly from the corresponding oxide. For example, metal oxides may be treated with ammonium salts to produce nanowires. The ammonium salt comprises salts with the formula NR.sub.4X, wherein each R is independently selected from H, alkyl, alkenyl, alkynyls and aryl (e.g., methyl, ethyl, propyl, isopropyl, butyl, tert-butyl, pentenyl, cyclohexyl, phenyl, tolyl, benzyl, hexynyl, octyl, octenyl, octynyl, dodecyl, cetyl, oleyl, stearyl, and the like) and X is an anion, for example halide, phosphate, hydrogenphosphate, dihydrogenphosphate, metatungstate, tungstate, molybdate, bicarbonate sulfate, nitrate or acetate. In other embodiments, X is phosphate, hydrogenphosphate, dihydrogenphosphate, metatungstate, tungstate, molybdate, bicarbonate sulfate, nitrate or acetate. Examples of the ammonium salt comprise ammonium chloride, dimethylammonium chloride, methylammonium chloride, ammonium acetate, ammonium nitrate, dimethylammonium nitrate, methylammonium nitrate, cetyl trimethylammonium bromide (CTAB) and the like. The methods may include treating the metal oxide and ammonium salts at temperatures ranging from room temperature (or lower) to reflux temperature in an appropriate solvent (e.g., water) for a time sufficient to produce the nanowires. Certain embodiments comprise heating the metal oxide and ammonium salt under hydrothermal conditions at temperatures ranging from reflux temperature (at atmospheric pressure) to 300° C. Such embodiments find particular utility in the context of lanthanide oxides, for example La.sub.2O.sub.3, are particularly useful since the procedure is quite simple and economically efficient. Nanowires comprising two or more metals and/or dopants may also be prepared according to these methods. Accordingly, in some embodiments at least one of the metal compounds is an oxide of a lanthanide element. Such methods are described in more detail in the examples.
(443) Accordingly, in one embodiment the present disclosure provides a method for preparing a nanowire in the absence of a biological template, the method comprising treating at least one metal compound with an ammonium salt. In certain embodiments, nanowires comprising more than one type of metal and/or one or more dopants can be prepared by such methods. For example, in one embodiment the method comprises treating two or more different metal compounds with an ammonium salt and the nanowire comprises two or more different metals. The nanowire may comprise a mixed metal oxide, metal oxyhalide, metal oxynitrate or metal sulfate.
(444) In some other embodiments of the foregoing, the ammonium salt is in the form of NR.sub.4X, wherein each R is independently selected from H, alkyl, alkenyl, and aryl and X is a halide, sulfate, nitrate or acetate. Examples of the ammonium salt comprise ammonium chloride, dimethylammonium chloride, methylammonium chloride, ammonium acetate, ammonium nitrate, dimethylammonium nitrate, methylammonium nitrate. In some other embodiments, each R is independently methyl, ethyl, propyl, isopropyl, butyl, tert-butyl, pentenyl, cyclohexyl, phenyl, tolyl, benzyl, hexynyl, octyl, octenyl, octynyl, dodecyl, cetyl, oleyl or stearyl. In yet other embodiments, the ammonium salt is contacted with the metal compound in solution or in the solid state.
(445) In certain embodiments, the method is useful for incorporation of one or more doping elements into a nanowire. For example, the method may comprise treating at least one metal compound with a halide in the presence of at least one doping element, and the nanowire comprises at least one doping element. In some aspects, the at least one doping element is present in the nanowire in an atomic percent ranging from 0.1 to 50 at %.
(446) Other methods for preparation of nanowires in the absence of a biological template include preparing a metal hydroxide gel by reaction of at least one metal salt and a base. In some embodiments the metal salt comprises a lanthanide halide and the resulting nanowire comprises a lanthanide oxide (e.g., La.sub.2O.sub.3). For example, the method may further comprise aging the gel, heating the gel or combinations thereof. Aging or heating the gel includes aging at temperatures ranging from room temperature (e.g., 20° C.) or below to reflux for a time sufficient to produce the desired nanowires. In certain other embodiments, the method comprises reaction of two or more different metal salts, and the nanowire comprises two or more different metals. In yet other embodiments, the method comprises reaction of two or more different metal salts, and the product comprises nanowires of two or more different metals.
(447) Doping elements may also be incorporated by using the hydroxide gel method described above, further comprising addition of at least one doping element to the hydroxide gel, and wherein the nanowire comprises the at least one doping element. For example, the at least one doping element may be present in the nanowire in an atomic percent ranging from 0.1 to 50 at %.
(448) In some embodiments, metal oxide nanowires can be prepared by mixing a metal salt solution and an anion precursor so that a gel of a metal oxide precursor is formed. This method can work for cases where the typical morphology of the metal oxide precursor is a nanowire. The gel is thermally treated so that crystalline nanowires of the metal oxide precursor are formed. The metal oxide precursor nanowires are converted to metal oxide nanowires by calcination, further chemical reaction or combinations thereof. In some embodiments, this method is useful for lanthanides and group 3 elements. In some embodiments, the thermal treatment of the gel is hydrothermal (or solvothermal) at temperatures above the boiling point (at standard pressure) of the reaction mixture and at pressures above ambient pressure, in other embodiments it's done at ambient pressure and at temperatures equal to or below the boiling point of the reaction mixture. In some embodiments the thermal treatment is done under reflux conditions at temperatures equal to the boiling point of the mixture. In some specific embodiments the anion precursor is a hydroxide, e.g. Ammonium hydroxide, sodium hydroxide, lithium hydroxide, tetramethyl ammonium hydroxide, and the like. In some other specific embodiments the metal salt is LnCl.sub.3 (Ln=Lanthanide), in other embodiment the metal salt is Ln(NO.sub.3).sub.3. In yet other embodiments, the metal salt is YCl.sub.3, ScCl.sub.3, Y(NO.sub.3).sub.3, Sc(NO.sub.3).sub.3. In some other embodiments, the metal precursor solution is an aqueous solution. In other embodiments, the thermal treatment is done at T=100° C. under reflux conditions.
(449) This method can be used to make mixed metal oxide nanowires, by mixing at least two metal salt solutions and an anion precursor so that a mixed oxide precursor gel is formed. In such cases, the first metal may be a lathanide or a group 3 element, and the other metals can be from other groups, including groups 1-14 and lanthanides.
(450) In some different embodiments, metal oxide nanowires can be prepared in a similar way as described above by mixing a metal salt solution and an anion precursor so that a gel of a metal hydroxide precursor is formed. This method works for cases where the typical morphology of the metal hydroxide precursor is a nanowire. The gel is treated so that crystalline nanowires of the metal hydroxide precursor are formed. The metal hydroxide precursor nanowires are converted to metal hydroxide nanowires by base treatment and finally converted to metal oxide nanowires by calcination. In some embodiments, this method may be especially applicable for group 2 elements, for example Mg. In some specific embodiments, the gel treatment is a thermal treatment at temperatures in the range 50-100° C. followed by hydrothermal treatment. In other embodiments, the gel treatment is an aging step. In some embodiments, the aging step takes at least one day. In some specific embodiments, the metal salt solution is a concentrated metal chloride aqueous solution and the anion precursor is the metal oxide. In some more specific embodiments, the metal is Mg. In certain embodiments of the above, these methods can be used to make mixed metal oxide nanowires. In these embodiments, the first metal is Mg and the other metal can be any other metal of groups 1-14+Ln.
(451) Catalytic Reactions
(452) The present disclosure provides for the use of catalytic nanowires as catalysts in catalytic reactions and related methods. In some embodiments, the catalytic reaction is any of the reactions described herein. The morphology and composition of the catalytic nanowires is not limited, and the nanowires may be prepared by any method. For example the nanowires may have a bent morphology or a straight morphology and may have any molecular composition. In some embodiments, the nanowires have better catalytic properties than a corresponding bulk catalyst (i.e., a catalyst having the same chemical composition as the nanowire, but prepared from bulk material). In some embodiments, the nanowire having better catalytic properties than a corresponding bulk catalyst has a ratio of effective length to actual length equal to one. In other embodiments, the nanowire having better catalytic properties than a corresponding bulk catalyst has a ratio of effective length to actual length of less than one. In other embodiments, the nanowire having better catalytic properties than a corresponding bulk catalyst comprises one or more elements from Groups 1 through 7, lanthanides or actinides.
(453) Nanowires may be useful in any number of reactions catalyzed by a heterogeneous catalyst. Examples of reactions wherein nanowires having catalytic activity may be employed are disclosed in Farrauto and Bartholomew, “Fundamentals of Industrial Catalytic Processes” Blackie Academic and Professional, first edition, 1997, which is hereby incorporated in its entirety. Other non-limiting examples of reactions wherein nanowires having catalytic activity may be employed include: the oxidative coupling of methane (OCM) to ethane and ethylene; oxidative dehydrogenation (ODH) of alkanes to the corresponding alkenes, for example oxidative dehydrogenation of ethane or propane to ethylene or propylene, respectively; selective oxidation of alkanes, alkenes, and alkynes; oxidation of CO, dry reforming of methane, selective oxidation of aromatics; Fischer-Tropsch, hydrocarbon cracking; combustion of hydrocarbons and the like. Reactions catalyzed by the disclosed nanowires are discussed in more detail below.
(454) The nanowires are generally useful as catalysts in methods for converting a first carbon-containing compound (e.g., a hydrocarbon, CO or CO.sub.2) to a second carbon-containing compound. In some embodiments the methods comprise contacting a nanowire, or material comprising the same, with a gas comprising a first carbon-containing compound and an oxidant to produce a carbon-containing compound. In some embodiments, the first carbon-containing compound is a hydrocarbon, CO, CO.sub.2, methane, ethane, propane, hexane, cyclohexane, octane or combinations thereof. In other embodiments, the second carbon-containing compound is a hydrocarbon, CO, CO.sub.2, ethane, ethylene, propane, propylene, hexane, hexene, cyclohexane, cyclohexene, bicyclohexane, octane, octene or hexadecane. In some embodiments, the oxidant is oxygen, ozone, nitrous oxide, nitric oxide, carbon dioxide, water or combinations thereof.
(455) In other embodiments of the foregoing, the method for conversion of a first carbon-containing compound to a second carbon-containing compound is performed at a temperature below 100° C., below 200° C., below 300° C., below 400° C., below 500° C., below 600° C., below 700° C., below 800° C., below 900° C. or below 1000° C. In other embodiments, the method for conversion of a first carbon-containing compound to a second carbon-containing compound is performed at a pressure above 0.5 ATM, above 1 ATM, above 2 ATM, above 5 ATM, above 10 ATM, above 25 ATM or above 50 ATM.
(456) The catalytic reactions described herein can be performed using standard laboratory equipment known to those of skill in the art, for example as described in U.S. Pat. No. 6,350,716, which is incorporated herein in its entirety.
(457) As noted above, the nanowires disclosed herein have better catalytic activity than a corresponding bulk catalyst. In some embodiments, the selectivity, yield, conversion, or combinations thereof, of a reaction catalyzed by the nanowires is better than the selectivity, yield, conversion, or combinations thereof, of the same reaction catalyzed by a corresponding bulk catalyst under the same conditions. For example, in some embodiments, the nanowire possesses a catalytic activity such that conversion of reactant to product in a reaction catalyzed by the nanowire is greater than at least 1.1 times, greater than at least 1.25 times, greater than at least 1.5 times, greater than at least 2.0 times, greater than at least 3.0 times or greater than at least 4.0 times the conversion of reactant to product in the same reaction catalyzed by a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(458) In other embodiments, the nanowire possesses a catalytic activity such that selectivity for product in a reaction catalyzed by the nanowire is greater than at least 1.1 times, greater than at least 1.25 times, greater than at least 1.5 times, greater than at least 2.0 times, greater than at least 3.0 times, or greater than at least 4.0 times the selectivity for product in the same reaction under the same conditions but catalyzed by a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(459) In yet other embodiments, the nanowire possesses a catalytic activity such that yield of product in a reaction catalyzed by the nanowire is greater than at least 1.1 times, greater than at least 1.25 times, greater than at least 1.5 times, greater than at least 2.0 times, greater than at least 3.0 times, or greater than at least 4.0 times the yield of product in the same reaction under the same conditions but catalyzed by a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(460) In yet other embodiments, the nanowire possesses a catalytic activity such that activation temperature of a reaction catalyzed by the nanowire is at least 25° C. lower, at least 50° C. lower, at least 75° C. lower, or at least 100° C. lower than the temperature of the same reaction under the same conditions but catalyzed by a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(461) In certain reactions (e.g., OCM), production of unwanted oxides of carbon (e.g., CO and CO.sub.2) is a problem that reduces overall yield of desired product and results in an environmental liability. Accordingly, in one embodiment the present disclosure addresses this problem and provides nanowires with a catalytic activity such that the selectivity for CO and/or CO.sub.2 in a reaction catalyzed by the nanowires is less than the selectivity for CO and/or CO.sub.2 in the same reaction under the same conditions but catalyzed by a corresponding bulk catalyst. Accordingly, in one embodiment, the present disclosure provides a nanowire which possesses a catalytic activity such that selectivity for CO.sub.x, wherein x is 1 or 2, in a reaction catalyzed by the nanowire is less than at least 0.9 times, less than at least 0.8 times, less than at least 0.5 times, less than at least 0.2 times or less than at least 0.1 times the selectivity for CO.sub.x in the same reaction under the same conditions but catalyzed by a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(462) In some embodiments, the absolute selectivity, yield, conversion, or combinations thereof, of a reaction catalyzed by the nanowires disclosed herein is better than the absolute selectivity, yield, conversion, or combinations thereof, of the same reaction under the same conditions but catalyzed by a corresponding bulk catalyst. For example, in some embodiments the yield of product in a reaction catalyzed by the nanowires is greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%. In other embodiments, the selectivity for product in a reaction catalyzed by the nanowires is greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%. In other embodiments, the conversion of reactant to product in a reaction catalyzed by the nanowires is greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(463) In addition to the improved catalytic performance of the disclosed nanowires, the morphology of the nanowires is expected to provide for improved mixing properties for the nanowires compared to standard colloidal (e.g., bulk) catalyst materials. The improved mixing properties are expected to improve the performance of any number of catalytic reactions, for example, in the area of transformation of heavy hydrocarbons where transport and mixing phenomena are known to influence the catalytic activity. In other reactions, the shape of the nanowires is expected to provide for good blending, reduce settling, and provide for facile separation of any solid material.
(464) In some other chemical reactions, the nanowires are useful for absorption and/or incorporation of a reactant used in chemical looping. For example, the nanowires find utility as NO.sub.x traps, in unmixed combustion schemes, as oxygen storage materials, as CO.sub.2 sorption materials (e.g., cyclic reforming with high H.sub.2 output) and in schemes for conversion of water to H.sub.2.
1. Oxidative Coupling of Methane (OCM)
(465) As noted above, the present disclosure provides nanowires having catalytic activity and related approaches to nanowire design and preparation for improving the yield, selectivity and/or conversion of any number of catalyzed reactions, including the OCM reaction. As mentioned above, there exists a tremendous need for catalyst technology capable of addressing the conversion of methane into high value chemicals (e.g., ethylene and products prepared therefrom) using a direct route that does not go through syngas. Accomplishing this task will dramatically impact and redefine a non-petroleum based pathway for feedstock manufacturing and liquid fuel production yielding reductions in GHG emissions, as well as providing new fuel sources.
(466) Ethylene has the largest carbon footprint compared to all industrial chemical products in part due to the large total volume consumed into a wide range of downstream important industrial products including plastics, surfactants and pharmaceuticals. In 2008, worldwide ethylene production exceeded 120 M metric tons while growing at a robust rate of 4% per year. The United States represents the largest single producer at 28% of the world capacity. Ethylene is primarily manufactured from high temperature cracking of naphtha (e.g., oil) or ethane that is separated from natural gas. The true measurement of the carbon footprint can be difficult as it depends on factors such as the feedstock and the allocation as several products are made and separated during the same process. However, some general estimates can be made based on published data.
(467) Cracking consumes a significant portion (about 65%) of the total energy used in ethylene production and the remainder is for separations using low temperature distillation and compression. The total tons of CO.sub.2 emission per ton of ethylene are estimated at between 0.9 to 1.2 from ethane cracking and 1 to 2 from naphtha cracking. Roughly, 60% of ethylene produced is from naphtha, 35% from ethane and 5% from others sources (Ren, T.; Patel, M. Res. Conserv. Recycl. 53:513, 2009). Therefore, based on median averages, an estimated amount of CO.sub.2 emissions from the cracking process is 114M tons per year (based on 120M tons produced). Separations would then account for an additional 61M tons CO.sub.2 per year.
(468) Nanowires provide an alternative to the need for the energy intensive cracking step. Additionally, because of the high selectivity of the nanowires, downstream separations are dramatically simplified, as compared to cracking which yields a wide range of hydrocarbon products. The reaction is also exothermic so it can proceed via an autothermal process mechanism. Overall, it is estimated that up to a potential 75% reduction in CO.sub.2 emission compared to conventional methods could be achieved. This would equate to a reduction of one billion tons of CO.sub.2 over a ten-year period and would save over 1M barrels of oil per day.
(469) The nanowires also permit converting ethylene into liquid fuels such as gasoline or diesel, given ethylene's high reactivity and numerous publications demonstrating high yield reactions, in the lab setting, from ethylene to gasoline and diesel. On a life cycle basis from well to wheel, recent analysis of methane to liquid (MTL) using F-T process derived gasoline and diesel fuels has shown an emission profile approximately 20% greater to that of petroleum based production (based on a worst case scenario) (Jaramillo, P., Griffin, M., Matthews, S., Env. Sci. Tech 42:7559, 2008). In the model, the CO.sub.2 contribution from plant energy was a dominating factor at 60%. Thus, replacement of the cracking and F-T process would be expected to provide a notable reduction in net emissions, and could be produced at lower CO.sub.2 emissions than petroleum based production.
(470) Furthermore, a considerable portion of natural gas is found in regions that are remote from markets or pipelines. Most of this gas is flared, re-circulated back into oil reservoirs, or vented given its low economic value. The World Bank estimates flaring adds 400M metric tons of CO.sub.2 to the atmosphere each year as well as contributing to methane emissions. The nanowires of this disclosure also provide economic and environmental incentive to stop flaring. Also, the conversion of methane to fuel has several environmental advantages over petroleum-derived fuel. Natural gas is the cleanest of all fossil fuels, and it does not contain a number of impurities such as mercury and other heavy metals found in oil. Additionally, contaminants including sulfur are also easily separated from the initial natural gas stream. The resulting fuels burn much cleaner with no measurable toxic pollutants and provide lower emissions than conventional diesel and gasoline in use today.
(471) In view of its wide range of applications, the nanowires of this disclosure can be used to not only selectively activate alkanes, but also to activate other classes of inert unreactive bonds, such as C—F, C—Cl or C—O bonds. This has importance, for example, in the destruction of man-made environmental toxins such as CFCs, PCBs, dioxins and other pollutants. Accordingly, while the invention is described in greater detail below in the context of the OCM reaction and other the other reactions described herein, the nanowire catalysts are not in any way limited to this particular reaction.
(472) The selective, catalytic oxidative coupling of methane to ethylene (i.e. the OCM reaction) is shown by the following reaction (1):
2CH.sub.4+O.sub.2.fwdarw.CH.sub.2CH.sub.2+2 H.sub.2O (1)
This reaction is exothermic (Heat of Reaction −67 kcals/mole) and usually occurs at very high temperatures (>700° C.). During this reaction, it is believed that the methane (CH.sub.4) is first oxidatively coupled into ethane (C.sub.2H.sub.6), and subsequently the ethane (C.sub.2H.sub.6) is oxidatively dehydrogenated into ethylene (C.sub.2H.sub.4). Because of the high temperatures used in the reaction, it has been suggested that the ethane is produced mainly by the coupling in the gas phase of the surface-generated methyl (CH.sub.3) radicals. Reactive metal oxides (oxygen type ions) are apparently required for the activation of CH.sub.4 to produce the CH.sub.3 radicals. The yield of C.sub.2H.sub.4 and C.sub.2H.sub.6 is limited by further reactions in the gas phase and to some extent on the catalyst surface. A few of the possible reactions that occur during the oxidation of methane are shown below as reactions (2) through (8):
CH.sub.4.fwdarw.CH.sub.3 radical (2)
CH.sub.3 radical.fwdarw.C.sub.2H.sub.6 (3)
CH.sub.3 radical+2.5 O.sub.2.fwdarw.CO.sub.2+1.5 H.sub.2O (4)
C.sub.2H.sub.6.fwdarw.C.sub.2H.sub.4+H.sub.2 (5)
C.sub.2H.sub.6+0.5 O.sub.2.fwdarw.C.sub.2H.sub.4+H.sub.2O (6)
C.sub.2H.sub.4+3 O.sub.2.fwdarw.2CO.sub.2+2H.sub.2O (7)
CH.sub.3 radical+C.sub.xH.sub.y+O.sub.2.fwdarw.Higher HC's-Oxidation/CO.sub.2+H.sub.2O (8)
(473) With conventional heterogeneous catalysts and reactor systems, the reported performance is generally limited to <25% CH.sub.4 conversion at <80% combined C.sub.2 selectivity, with the performance characteristics of high selectivity at low conversion, or the low selectivity at high conversion. In contrast, the nanowires of this disclosure are highly active and can optionally operate at a much lower temperature. In one embodiment, the nanowires disclosed herein enable efficient conversion of methane to ethylene in the OCM reaction at temperatures less than when the corresponding bulk material is used as a catalyst. For example, in one embodiment, the nanowires disclosed herein enable efficient conversion (i.e., high yield, conversion, and/or selectivity) of methane to ethylene at temperatures of less than 900° C., less than 800° C., less than 700° C., less than 600° C., or less than 500° C. In other embodiments, the use of staged oxygen addition, designed heat management, rapid quench and/or advanced separations may also be employed.
(474) Accordingly, one embodiment of the present disclosure is a method for the preparation of ethane and/or ethylene, the method comprising converting methane to ethane and/or ethylene in the presence of a catalytic material, wherein the catalytic material comprises at least one catalytic nanowire as disclosed herein.
(475) Accordingly, in one embodiment a stable, very active, high surface area, multifunctional nanowire catalyst is disclosed having active sites that are isolated and precisely engineered with the catalytically active metal centers/sites in the desired proximity (see, e.g.,
(476) The exothermic heats of reaction (free energy) follow the order of reactions depicted above and, because of the proximity of the active sites, will mechanistically favor ethylene formation while minimizing complete oxidation reactions that form CO and CO.sub.2. Representative nanowire compositions useful for the OCM reaction include, but are not limited to: highly basic oxides selected from the early members of the Lanthanide oxide series; Group 1 or 2 ions supported on basic oxides, such as Li/MgO, Ba/MgO and Sr/La.sub.2O.sub.3; and single or mixed transition metal oxides, such as VO.sub.x and Re/Ru that may also contain Group 1 ions. Other nanowire compositions useful for the OCM reaction comprise any of the compositions disclosed herein, for example MgO, La.sub.2O.sub.3, Na.sub.2WO.sub.4, Mn.sub.2O.sub.3, Mn.sub.3O.sub.4, Mg.sub.6MnO.sub.8, Zr.sub.2Mo.sub.2O.sub.8, NaMnO.sub.4, Mn.sub.2O.sub.3/Na.sub.2WO.sub.4, Mn.sub.3O.sub.4/Na.sub.2WO.sub.4 or Na/MnO.sub.4/MgO, Mn/WO4, Nd.sub.2O.sub.3, Sm.sub.2O.sub.3, Eu.sub.2O.sub.3 or combinations thereof. Activating promoters (i.e., dopants), such as chlorides, nitrates and sulfates, or any of the dopants described above may also be employed.
(477) As noted above, the presently disclosed nanowires comprise a catalytic performance better than corresponding bulk catalysts, for example in one embodiment the catalytic performance of the nanowires in the OCM reaction is better than the catalytic performance of a corresponding bulk catalyst. In this regard, various performance criteria may define the “catalytic performance” of the catalysts in the OCM (and other reactions). In one embodiment, catalytic performance is defined by C2 selectivity in the OCM reaction, and the C2 selectivity of the nanowires in the OCM reaction is >5%, >10%, >15%, >20%, >25%, >30%, >35%, >40%, >45%, >50%, >55%, >60%, >65%, >70%, >75% or >80%.
(478) Other important performance parameters used to measure the nanowires' catalytic performace in the OCM reaction are selected from single pass methane conversion percentage (i.e., the percent of methane converted on a single pass over the catalyst or catalytic bed, etc.), reaction inlet gas temperature, reaction operating temperature, total reaction pressure, methane partial pressure, gas-hour space velocity (GHSV), O.sub.2 source, catalyst stability and ethylene to ethane ratio. In certain embodiments, improved catalytic performance is defined in terms of the nanowires' improved performance (relative to a corresponding bulk catalyst) with respect to at least one of the foregoing performance parameters.
(479) The reaction inlet gas temperature in an OCM reaction catalyzed by the disclosed nanowires can generally be maintained at a lower temperature, while maintaining better performance characteristics (e.g., conversion, C2 yield, C2 selctivity and the like) compared to the same reaction catalyzed by a corresponding bulk catalyst under the same reaction conditions. In certain embodiments, the inlet gas temperature in an OCM reaction catalyzed by the disclosed nanowires is <700° C., <675° C., <650° C., <625° C., <600° C., <593° C., <580° C., <570° C., <560° C., <550° C., <540° C., <530° C., <520° C., <510° C., <500° C., <490° C., <480° C. or even <470° C.
(480) The reaction operating temperature in an OCM reaction catalyzed by the disclosed nanowires can generally be maintained at a lower temperature, while maintaining better performance characteristics compared to the same reaction catalyzed by a corresponding bulk catalyst under the same reaction conditions. In certain embodiments, the reaction operating temperature in an OCM reaction catalyzed by the disclosed nanowires is <700° C., <675° C., <650° C., <625° C., <600° C., <593° C., <580° C., <570° C., <560° C., <550° C., <540° C., <530° C., <520° C., <510° C., <500° C., <490° C., <480° C., <470° C.
(481) The single pass methane conversion in an OCM reaction catalyzed by the nanowires is also generally better compared to the single pass methane conversion in the same reaction catalyzed by a corresponding bulk catalyst under the same reaction conditions. For single pass methane conversion it is preferably >5%, >10%, >15%, >20%, >25%, >30%, >35%, >40%, >45%, >50%, >55%, >60%, >65%, >70%, >75%, >80%.
(482) In certain embodiments, the total reaction pressure in an OCM reaction catalyzed by the nanowires is >1 atm, >1.1 atm, >1.2 atm, >1.3 atm, >1.4 atm, >1.5 atm, >1.6 atm, >1.7 atm, >1.8 atm, >1.9 atm, >2 atm, >2.1 atm, >2.1 atm, >2.2 atm, >2.3 atm, >2.4 atm, >2.5 atm, >2.6 atm, >2.7 atm, >2.8 atm, >2.9 atm, >3.0 atm, >3.5 atm, >4.0 atm, >4.5 atm, >5.0 atm, >5.5 atm, >6.0 atm, >6.5 atm, >7.0 atm, >7.5 atm, >8.0 atm, >8.5 atm, >9.0 atm, >10.0 atm, >11.0 atm, >12.0 atm, >13.0 atm, >14.0 atm, >15.0 atm, >16.0 atm, >17.0 atm, >18.0 atm, >19.0 atm or >20.0 atm.
(483) In certain other embodiments, the total reaction pressure in an OCM reaction catalyzed by the nanowires ranges from about 1 atm to about 10 atm, from about 1 atm to about 7 atm, from about 1 atm to about 5 atm, from about 1 atm to about 3 atm or from about 1 atm to about 2 atm.
(484) In some embodiments, the methane partial pressure in an OCM reaction catalyzed by the nanowires is >0.3 atm, >0.4 atm, >0.5 atm, >0.6 atm, >0.7 atm, >0.8 atm, >0.9 atm, >1 atm, >1.1 atm, >1.2 atm, >1.3 atm, >1.4 atm, >1.5 atm, >1.6 atm, >1.7 atm, >1.8 atm, >1.9 atm, >2.0 atm, >2.1 atm, >2.2 atm, >2.3 atm, >2.4 atm, >2.5 atm, >2.6 atm, >2.7 atm, >2.8 atm, >2.9 atm, >3.0 atm, >3.5 atm, >4.0 atm, >4.5 atm, >5.0 atm, >5.5 atm, >6.0 atm, >6.5 atm, >7.0 atm, >7.5 atm, >8.0 atm, >8.5 atm, >9.0 atm, >10.0 atm, >11.0 atm, >12.0 atm, >13.0 atm, >14.0 atm, >15.0 atm, >16.0 atm, >17.0 atm, >18.0 atm, >19.0 atm or >20.0 atm.
(485) In some embodiments, the GSHV in an OCM reaction catalyzed by the nanowires is >20,000/hr, >50,000/hr, >75,000/hr, >100,000/hr, >120,000/hr, >130,000/hr, >150,000/hr, >200,000/hr, >250,000/hr, >300,000/hr, >350,000/hr, >400,000/hr, >450,000/hr, >500,000/hr, >750,000/hr, >1,000,000/hr, >2,000,000/hr, >3,000,000/hr, >4,000,000/hr.
(486) In contrast to other OCM reactions, the present inventors have discovered that OCM reactions catalyzed by the disclosed nanowires can be performed (and still maintain high C2 yield, C2 selectivity, conversion, etc.) using O.sub.2 sources other than pure O.sub.2. For example, in some embodiments the O.sub.2 source in an OCM reaction catalyzed by the disclosed nanowires is air, oxygen enriched air, pure oxygen, oxygen diluted with nitrogen (or another inert gas) or oxygen diluted with CO.sub.2. In certain embodiments, the O.sub.2 source is O.sub.2 diluted by >99%, >98%, >97%, >96%, >95%, >94%, >93%, >92%, >91%, >90%, 85%, >80%, >75%, >70%, >65%, >60%, >55%, >50%, >45%, >40%, >35%, >30%, >25%, >20%, >15%, >10%, >9%, >8%, >7%, >6%, >5%, >4%, >3%, >2% or >1% with CO.sub.2 or an inert gas, for example nitrogen.
(487) The disclosed nanowires are also very stable under conditions required to perform any number of catalytic reactions, for example the OCM reaction. The stability of the nanowires is defined as the length of time a catalyst will maintain its catalytic performance without a significant decrease in performance (e.g., a decrease >20%, >15%, >10%, >5%, or greater than 1% in C2 yield, C2 selectivity or conversion, etc.). In some embodiments, the nanowires have stability under conditions required for the OCM reaction of >1 hr, >5 hrs, >10 hrs, >20 hrs, >50 hrs, >80 hrs, >90 hrs, >100 hrs, >150 hrs, >200 hrs, >250 hrs, >300 hrs, >350 hrs, >400 hrs, >450 hrs, >500 hrs, >550 hrs, >600 hrs, >650 hrs, >700 hrs, >750 hrs, >800 hrs, >850 hrs, >900 hrs, >950 hrs, >1,000 hrs, >2,000 hrs, >3,000 hrs, >4,000 hrs, >5,000 hrs, >6,000 hrs, >7,000 hrs, >8,000 hrs, >9,000 hrs, >10,000 hrs, >11,000 hrs, >12,000 hrs, >13,000 hrs, >14,000 hrs, >15,000 hrs, >16,000 hrs, >17,000 hrs, >18,000 hrs, >19,000 hrs, >20,000 hrs, >1 yrs, >2 yrs, >3 yrs, >4 yrs or >5 yrs.
(488) In some embodiments, the ratio of ethylene to ethane in an OCM reaction catalyzed by the nanowires is better than the ratio of ethylene to ethane in an OCM reaction catalyzed by a corresponding bulk catalyst under the same conditions. In some embodiments, the ratio of ethylene to ethane in an OCM reaction catalyzed by the nanowires is >0.3, >0.4, >0.5, >0.6, >0.7, >0.8, >0.9, >1, >1.1, >1.2, >1.3, >1.4, >1.5, >1.6, >1.7, >1.8, >1.9, >2.0, >2.1, >2.2, >2.3, >2.4, >2.5, >2.6, >2.7, >2.8, >2.9, >3.0, >3.5, >4.0, >4.5, >5.0, >5.5, >6.0, >6.5, >7.0, >7.5, >8.0, >8.5, >9.0, >9.5, >10.0.
(489) As noted above, the OCM reaction employing known bulk catalysts suffers from poor yield, selectivity, or conversion. In contrast to a corresponding bulk catalyst, Applicants have found that certain nanowires, for example the exemplary nanowires disclosed herein, posses a catalytic activity in the OCM reaction such that the yield, selectivity, and/or conversion is better than when the OCM reaction is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the conversion of methane to ethylene in the oxidative coupling of methane reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the conversion of methane to ethylene compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the conversion of methane to ethylene in an OCM reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(490) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the yield of ethylene in the oxidative coupling of methane reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the yield of ethylene compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the yield of ethylene in an OCM reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(491) As noted above, the OCM reaction employing known bulk catalysts suffers from poor yield, selectivity, or conversion. In contrast to a corresponding bulk catalyst, Applicants have found that certain nanowires, for example the exemplary nanowires disclosed herein, posses a catalytic activity in the OCM reaction such that the yield, selectivity, and/or conversion is better than when the OCM reaction is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the conversion of methane in the oxidative coupling of methane reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the conversion of methane compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the conversion of methane in an OCM reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%. In some embodiments the conversion of methane is determined when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less, 700° C. or less, 650° C. or less or even 600° C. or less. The conversion of methane may also be determined based on a single pass of a gas comprising methane over the catalyst or may be determined based on multiple passes over the catalyst.
(492) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the C2 yield in the oxidative coupling of methane reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the C2 yield compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the C2 yield in an OCM reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%. In some embodiments the C2 yield is determined when the catalyst is employed as a heterogenous catalyst in the oxidative coupling of methane at a temperature of 750° C. or less, 700° C. or less, 650° C. or less or even 600° C. or less. The C2 yield may also be determined based on a single pass of a gas comprising methane over the catalyst or may be determined based on multiple passes over the catalyst.
(493) In another embodiment, the disclosure provides a nanowire having a catalytic activity in the OCM reaction such that the nanowire has the same catalytic activity (i.e., same selectivity, conversion or yield), but at a lower temperature, compared a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the catalytic activity of the nanowires in the OCM reaction is the same as the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 20° C. less. In some embodiments the catalytic activity of the nanowires in the OCM reaction is the same as the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 50° C. less. In some embodiments the catalytic activity of the nanowires in the OCM reaction is the same as the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 100° C. less. In some embodiments the catalytic activity of the nanowires in the OCM reaction is the same as the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 200° C. less.
(494) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the selectivity for CO or CO.sub.2 in the oxidative coupling of methane reaction is less than at least 0.9 times, 0.8 times, 0.5 times, 0.2 times, or 0.1 times the selectivity for CO or CO.sub.2 compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(495) In some other embodiments, a method for converting methane into ethylene comprising use of catalyst mixture comprising two or more catalysts is provided. For example, the catalyst mixture may be a mixture of a catalyst having good OCM activity and a catalyst having good ODH activity. Such catalyst mixture are described in more detail above.
(496) Typically, the OCM reaction is run in a mixture of oxygen and nitrogen or other inert gas. Such gasses are expensive and increase the overall production costs associated with preparation of ethylene or ethane from methane. However, the present inventors have now discovered that such expensive gases are not required and high yield, conversion, selectivity, etc. can be obtained when air is used as the gas mixture instead of pre-packaged and purified sources of oxygen and other gases. Accordingly, in one embodiment the disclosure provides a method for performing the OCM reaction in air.
(497) In addition to air or O.sub.2 gas, the presently disclosed nanowires and associated methods provide for use of other sources of oxygen in the OCM reaction. In this respect, an alternate source of oxygen such a CO.sub.2, H.sub.2O, SO.sub.2 or SO.sub.3 may be used either in place of, or in addition to, air or oxygen as the oxygen source. Such methods have the potential to increase the efficiency of the OCM reaction, for example by consuming a reaction byproduct (e.g., CO.sub.2 or H.sub.2O) and controlling the OCM exotherm as described below.
(498) As noted above, in the OCM reaction, methane is oxidatively converted to methyl radicals, which are then coupled to form ethane, which is subsequently oxidized to ethylene. In traditional OCM reactions, the oxidation agent for both the methyl radical formation and the ethane oxidation to ethylene is oxygen. In order to minimize full oxidation of methane or ethane to carbon dioxide, i.e. maximize C2 selectivity, the methane to oxygen ratio is generally kept at 4 (i.e. full conversion of methane into methyl radicals) or above. As a result, the OCM reaction is typically oxygen limited and thus the oxygen concentration in the effluent is zero.
(499) Accordingly, in one embodiment the present disclosure provides a method for increasing the methane conversion and increasing, or in some embodiments, not reducing, the C2 selectivity in an OCM reaction. The disclosed methods include adding to a traditional OCM catalyst another OCM catalyst that uses an oxygen source other than molecular oxygen. In some embodiments, the alternate oxygen source is CO.sub.2, H.sub.2O, SO.sub.2, SO.sub.3 or combinations thereof. For example in some embodiments, the alternate oxygen source is CO.sub.2. In other embodiments the alternate oxygen source is H.sub.2O.
(500) Because C2 selectivity is typically between 50% and 80% in the OCM reaction, OCM typically produces significant amounts of CO.sub.2 as a byproduct (CO.sub.2 selectivity can typically range from 20-50%). Additionally, H.sub.2O is produced in copious amounts, regardless of the C2 selectivity. Therefore both CO.sub.2 and H.sub.2O would are attractive oxygen sources for OCM in an O.sub.2 depleted environment.
(501) Accordingly, one embodiment of the present disclosure provides a catalyst (and related methods for use thereof) which is catalytic in the OCM reaction and which uses CO.sub.2, H.sub.2O, SO.sub.2, SO.sub.3 or another alternative oxygen source or combinations thereof as a source of oxygen. Other embodiments, provide a catalytic material comprising two or more catalysts, wherein the catalytic material comprises at least one catalyst which is catalytic in the OCM reaction and uses O.sub.2 for at least one oxygen source and at least one catalysts which is catalytic in the OCM reaction and uses at least of CO.sub.2, H.sub.2O, SO.sub.2, SO.sub.3, NO, NO.sub.2, NO.sub.3 or another alternative oxygen source. Methods for performing the OCM reaction with such catalytic materials are also provided. Such catalysts comprise any of the compositions disclosed herein and are effective as catalysts in an OCM reaction using an alternative oxygen source at temperatures of 900° C. or lower, 850° C. or lower, 800° C. or lower, 750° C. or lower, 700° C. or lower or even 650° C. or lower. In some embodiments of the above, the catalyst is a nanowire catalyst.
(502) Examples of OCM catalysts that use CO.sub.2 or other oxygen sources rather than O.sub.2 include, but are not limited to, catalysts comprising La.sub.2O.sub.3/ZnO, CeO.sub.2/ZnO, CaO/ZnO, CaO/CeO.sub.2, CaO/Cr.sub.2O.sub.3, CaO/MnO.sub.2, SrO/ZnO, SrO/CeO.sub.2, SrO/Cr.sub.2O.sub.3, SrO/MnO.sub.2, SrCO.sub.3/MnO.sub.2, Ba0/ZnO, BaO/CeO.sub.2, BaO/Cr.sub.2O.sub.3, BaO/MnO.sub.2, CaO/MnO/CeO.sub.2, Na.sub.2WO.sub.4/Mn/SiO.sub.2, Pr.sub.2O.sub.3, Tb.sub.2O.sub.3.
(503) Some embodiments provide a method for performing OCM, wherein a mixture of an OCM catalyst which use O.sub.2 as an oxygen source (referred to herein as an O.sub.2-OCM catalyst) and an OCM catalyst which use CO.sub.2 as an oxygen source (referred to herein as a CO.sub.2-OCM catalyst) is employed as the catalytic material, for example in a catalyst bed. Such methods have certain advantages. For example, the CO.sub.2-OCM reaction is endothermic and the O.sub.2-OCM reaction is exothermic, and thus if the right mixture and/or arrangement of CO.sub.2-OCM and O.sub.2-OCM catalysts is used, the methods are particularily useful for controlling the exotherm of the OCM reaction. In some embodiments, the catalyst bed comprises a mixture of O.sub.2-OCM catalyst and CO.sub.2-OCM catalysts. The mixture may be in a ratio of 1:99 to 99:1. The two catalysts work synergistically as the O.sub.2-OCM catalyst supplies the CO.sub.2-OCM catalyst with the necessary carbon dioxide and the endothermic nature of the C.sub.2-OCM reaction serves to control the exotherm of the overall reaction. Alternatively, the CO.sub.2 source may be external to the reaction (e.g., fed in from a CO.sub.2 tank, or other source) and/or the heat required for the CO.sub.2-OCM reaction is supplied from an external source (e.g., heating the reactor).
(504) Since the gas composition will tend to become enriched in CO.sub.2 as it flows through the catalyst bed (i.e., as the OCM reaction proceeds, more CO.sub.2 is produced), some embodiments of the present invention provide an OCM method wherien the catalyst bed comprises a gradient of catalysts which changes from a high concentration of O.sub.2-OCM catalysts at the front of the bed to a high concentration of CO.sub.2-OCM catalysts at the end of the catalyst bed.
(505) The O.sub.2-OCM catalyst and CO.sub.2 OCM catalyst may have the same or different compositions. For example, in some embodiments the O.sub.2-OCM catalyst and CO.sub.2-OCM catalyst have the same composition but different morphologies (e.g., nanowire, bent nanowire, bulk, etc.). In other embodiments the O.sub.2-OCM and the CO.sub.2-OCM catalyst have different compositions.
(506) Furthermore, CO.sub.2-OCM catalysts will typically have higher selectivity, but lower yields than an O.sub.2-OCM catalyst. Accordingly, in one embodiment the methods comprise use of a mixture of an O.sub.2-OCM catalyst and a CO.sub.2-OCM catalyst and performing the reaction in O.sub.2 deprived environment so that the CO.sub.2-OCM reaction is favored and the selectivity is increased. Under appropriate conditions the yield and selectivity of the OCM reaction can thus be optimized.
(507) In some other embodiments, the catalyst bed comprises a mixture of one or more low temperature O.sub.2-OCM catalyst (i.e., a catalyst active at low temperatures, for example less than 700° C.) and one or more high temperature CO.sub.2-OCM catalyst (i.e., a catalyst active at high temperatures, for example 800° C. or higher). Here, the required high temperature for the CO.sub.2-OCM may be provided by the hotspots produced by the O.sub.2-OCM catalyst. In such a scenario, the mixture may be sufficiently coarse such that the hotspots are not being excessively cooled down by excessive dilution effect.
(508) In other embodiments, the catalyst bed comprises alternating layers of O.sub.2-OCM and CO.sub.2-OCM catalysts. The catalyst layer stack may begin with a layer of O.sub.2-OCM catalyst, so that it can supply the next layer (e.g., a CO.sub.2-OCM layer) with the necessary CO.sub.2. The O.sub.2-OCM layer thickness may be optimized to be the smallest at which O2 conversion is 100% and thus the CH.sub.4 conversion of the layer is maximized. The catalyst bed may comprise any number of catalyst layers, for example the overall number of layers may be optimized to maximize the overall CH.sub.4 conversion and C2 selectivity.
(509) In some embodiments, the catalyst bed comprises alternating layers of low temperature O.sub.2-OCM catalysts and high temperature CO.sub.2-OCM catalysts. Since the CO.sub.2-OCM reaction is endothermic, the layers of CO.sub.2-OCM catalyst may be sufficiently thin such that in can be “warmed up” by the hotspots of the O.sub.2-OCM layers. The endothermic nature of the CO.sub.2-OCM reaction can be advantageous for the overall thermal management of an OCM reactor. In some embodiments, the CO.sub.2-OCM catalyst layers act as “internal” cooling for the O.sub.2-OCM layers, thus simplifying the requirements for the cooling, for example in a tubular reactor. Therefore, an interesting cycle takes place with the endothermic reaction providing the necessary heat for the endothermic reaction and the endothermic reaction providing the necessary cooling for the exothermic reaction.
(510) Accordingly, one embodiment of the present invention is a method for the oxidative coupling of methane, wherein the method comprises conversion of methane to ethane and/or ethylene in the presence of a catalytic material, and wherein the catalytic material comprises a bed of alternating layers of O.sub.2-OCM catalysts and CO.sub.2-OCM catalysts. In other embodiments the bed comprises a mixture (i.e., not alternating layers) of O.sub.2-OCM catalysts and CO.sub.2-OCM catalysts.
(511) In other embodiments, the OCM methods include use of a jacketed reactor with the exothermic O.sub.2-OCM reaction in the core and the endothermic CO.sub.2-OCM reaction in the mantel. In other embodiments, the unused CO.sub.2 can be recycled and reinjected into the reactor, optionally with the recycled CH.sub.4. Additional CO.sub.2 can also be injected to increase the overall methane conversion and help reduce greenhouse gases.
(512) In other embodiments, the reactor comprises alternating stages of O.sub.2-OCM catalyst beds and CO.sub.2-OCM catalyst beds. The CO.sub.2 necessary for the CO.sub.2-OCM stages is provided by the O.sub.2-OCM stage upstream. Additional CO.sub.2 may also be injected. The O.sub.2 necessary for the subsequent O.sub.2-OCM stages is injected downstream from the CO.sub.2-OCM stages. The CO.sub.2-OCM stages may provide the necessary cooling for the O.sub.2-OCM stages. Alternatively, separate cooling may be provided. Likewise, if necessary the inlet gas of the CO.sub.2-OCM stages can be additionally heated, the CO.sub.2-OCM bed can be heated or both.
(513) In related embodiments, the CO.sub.2 naturally occurring in natural gas is not removed prior to performing the OCM, alternatively CO2 is added to the feed with the recycled methane. Instead the CO.sub.2 containing natural gas is used as a feedstock for CO.sub.2-OCM, thus potentially saving a separation step. The amount of naturally occurring CO.sub.2 in natural gas depends on the well and the methods can be adjusted accordingly depending on the source of the natural gas.
(514) The foregoing methods can be generalized as a method to control the temperature of very exothermic reactions by coupling them with an endothermic reaction that uses the same feedstock (or byproducts of the exothermic reaction) to make the same product (or a related product). This concept can be reversed, i.e. providing heat to an endothermic reaction by coupling it with an exothermic reaction. This will also allow a higher per pass yield in the OCM reactor.
(515) For purpose of simplicity, the above descrirption relating to the use of O.sub.2-OCM and CO.sub.2-OCM catalysts was described in reference to the oxidative coupling of methane (OCM); however, the same concept is applicable to other catalytic reactions including but not limited to: oxidative dehydrogenation (ODH) of alkanes to their corresponding alkenes, selective oxidation of alkanes and alkenes and alkynes, etc. For example, in a related embodiment, a catalyst capable of using an alternative oxygen source (e.g., CO.sub.2, H.sub.2O, SO.sub.2, SO.sub.3 or combinations thereof) to catalyze the oxidative dehydrogenation of ethane is provided. Such catalysts, and uses thereof are described in more detail below.
(516) Furthermore, the above methods are applicable for creating novel catalysts by blending catalysts that use different reactants for the same catalytic reactions, for example different oxidants for an oxidation reaction and at least one oxidant is a byproduct of one of the catalytic reactions. In addition, the methods can also be generalized for internal temperature control of reactors by blending catalysts that catalyze reactions that share the same or similar products but are exothermic and endothermic, respectively. These two concepts can also be coupled together.
2. Oxidative Dehydrogenation
(517) Worldwide demand for alkenes, especially ethylene and propylene, is high. The main sources for alkenes include steam cracking, fluid-catalytic-cracking and catalytic dehydrogenation. The current industrial processes for producing alkenes, including ethylene and propylene, suffer from some of the same disadvantages described above for the OCM reaction. Accordingly, a process for the preparation of alkenes, which is more energy efficient and has higher yield, selectivity, and conversion than current processes is needed. Applicants have now found that nanowires, for example the exemplary nanowires disclosed herein, fulfill this need and provide related advantages.
(518) In one embodiment, the disclosed nanowires are useful as catalysts for the oxidative dehydrogenation (ODH) of hydrocarbons (e.g. alkanes, alkenes, and alkynes). For example, in one embodiment the nanowires are useful as catalysts in an ODH reaction for the conversion of ethane or propane to ethylene or propylene, respectively. Reaction scheme (9) depicts the oxidative dehydrogenation of hydrocarbons:
C.sub.xH.sub.y+½O.sub.2.fwdarw.C.sub.xH.sub.y-2+H.sub.2O (9)
(519) Representative catalysts useful for the ODH reaction include, but are not limited to nanowires comprising Zr, V, Mo, Ba, Nd, Ce, Ti, Mg, Nb, La, Sr, Sm, Cr, W, Y or Ca or oxides or combinations thereof. Activating promoters (i.e. dopants) comprising P, K, Ca, Ni, Cr, Nb, Mg, Au, Zn, or Mo, or combinations thereof, may also be employed.
(520) As noted above, improvements to the yield, selectivity, and/or conversion in the ODH reaction employing bulk catalysts are needed. Accordingly, in one embodiment, the present disclosure provides a nanowire which posses a catalytic activity in the ODH reaction such that the yield, selectivity, and/or conversion is better than when the ODH reaction is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the conversion of hydrocarbon to alkene in the ODH reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the conversion of alkane to alkene compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the conversion of hydrocarbon to alkene in an ODH reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(521) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the yield of alkene in an ODH reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the yield of alkenes compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the yield of alkene in an ODH reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(522) In another embodiment, the disclosure provides a nanowire having a catalytic activity in the ODH reaction such that the nanowire has the same catalytic activity, but at a lower temperature, compared a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the catalytic activity of the nanowires in the ODH reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 20° C. less. In some embodiments the catalytic activity of the nanowires in the ODH reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 50° C. less. In some embodiments the catalytic activity of the nanowires in the ODH reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 100° C. less. In some embodiments the catalytic activity of the nanowires in the ODH reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 200° C. less.
(523) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the selectivity for alkenes in an ODH reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the selectivity for alkenes compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the selectivity for alkenes in an ODH reaction catalyzed by the nanowire is greater than 50%, greater than 60%, greater than 70%, greater than 80%, greater than 90%, or greater than 95%.
(524) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the selectivity for CO or CO.sub.2 in an ODH reaction is less than at least 0.9 times, 0.8 times, 0.5 times, 0.2 times, or 0.1 times the selectivity for CO or CO.sub.2 compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire.
(525) In one embodiment, the nanowires disclosed herein enable efficient conversion of hydrocarbon to alkene in the ODH reaction at temperatures less than when the corresponding bulk material is used as a catalyst. For example, in one embodiment, the nanowires disclosed herein enable efficient conversion (i.e. high yield, conversion, and/or selectivity) of hydrocarbon to alkene at temperatures of less than 800° C., less than 700° C., less than 600° C., less than 500° C., less than 400° C., or less than 300° C.
(526) The stability of the nanowires is defined as the length of time a catalyst will maintain its catalytic performance without a significant decrease in performance (e.g., a decrease >20%, >15%, >10%, >5%, or greater than 1% in ODH activity or alkene selectivity, etc.). In some embodiments, the nanowires have stability under conditions required for the ODH reaction of >1 hr, >5 hrs, >10 hrs, >20 hrs, >50 hrs, >80 hrs, >90 hrs, >100 hrs, >150 hrs, >200 hrs, >250 hrs, >300 hrs, >350 hrs, >400 hrs, >450 hrs, >500 hrs, >550 hrs, >600 hrs, >650 hrs, >700 hrs, >750 hrs, >800 hrs, >850 hrs, >900 hrs, >950 hrs, >1,000 hrs, >2,000 hrs, >3,000 hrs, >4,000 hrs, >5,000 hrs, >6,000 hrs, >7,000 hrs, >8,000 hrs, >9,000 hrs, >10,000 hrs, >11,000 hrs, >12,000 hrs, >13,000 hrs, >14,000 hrs, >15,000 hrs, >16,000 hrs, >17,000 hrs, >18,000 hrs, >19,000 hrs, >20,000 hrs, >1 yrs, >2 yrs, >3 yrs, >4 yrs or >5 yrs.
(527) As noted above, one embodiment of the present disclosure is directed to a catalyst capable of using an alternative oxygen source (e.g., CO.sub.2, H.sub.2O, SO.sub.2, SO.sub.3 or combinations thereof) to catalyze the oxidative dehydrogenation of ethane is provided. For example, the ODH reaction may proceed according to the following reaction (10):
CO.sub.2.fwdarw.C.sub.xH.sub.y.fwdarw.C.sub.xH.sub.y-2+CO+H.sub.2O (10)
wherein x is an interger and Y is 2x+2. Compositions useful in this regard include Fe.sub.2O.sub.3, Cr.sub.2O.sub.3, MnO.sub.2, Ga.sub.2O.sub.3, Cr/SiO.sub.2, Cr/SO.sub.4—SiO.sub.2, Cr—K/SO.sub.4—SiO.sub.2, Na.sub.2WO.sub.4—Mn/SiO.sub.2, Cr-HZSM-5, Cr/Si-MCM-41 (Cr-HZSM-5 and Cr/Si-MCM-41 refer to known zeolites) and MoC/SiO.sub.2. In some embodiments, any of the foregoing catalyst compositions may be supported on SiO.sub.2, ZrO.sub.2, Al.sub.2O.sub.3, TiO.sub.2 or combinations thereof. In certain embodiments, the catalyst may be a nanpwire catalyst and in other embodiements the catalyst is a bulk catalyst.
(528) The catalysts having ODH activity with alternative oxygen sources (e.g., CO.sub.2, referred to herein as a CO.sub.2-ODH catalyst) have a number of advantages. For example, in some embodiments a method for converting methane to ethylene comprises use of an O.sub.2-OCM catalyst in the presence of a CO.sub.2-ODH catalyst is provided. Catalytic materials comprising at least one O.sub.2-OCM catalyst and at least one CO.sub.2-ODH catalyst are also provided in some embodiments. This combination of catalysts results in a higher yield of ethylene (and/or ratio of ethylene to ethane) since the CO.sub.2 produced by the OCM reaction is consumed and used to convert ethane to ethylene.
(529) In one embodiment, a method for preparation of ethylene comprises converting methane to ethylene in the presence of two or more catalysts, wherein at least one catalyst is an O.sub.2-OCM catalyst and at least one catalyst is a CO.sub.2-ODH catalyst. Such methods have certain advantages. For example, the CO2-ODH reaction is endothermic and the O.sub.2-OCM reaction is exothermic, and thus if the right mixture and/or arrangement of CO.sub.2-ODH and O.sub.2-OCM catalysts is used, the methods are particularily useful for controlling the exotherm of the OCM reaction. In some embodiments, the catalyst bed comprises a mixture of O.sub.2-OCM catalyst and CO2-ODH catalysts. The mixture may be in a ratio of 1:99 to 99:1. The two catalysts work synergistically as the O.sub.2-OCM catalyst supplies the CO.sub.2-ODH catalyst with the necessary carbon dioxide and the endothermic nature of the C.sub.2-OCM reaction serves to control the exotherm of the overall reaction.
(530) Since the gas composition will tend to become enriched in CO.sub.2 as it flows through the catalyst bed (i.e., as the OCM reaction proceeds, more CO.sub.2 is produced), some embodiments of the present invention provide an OCM method wherien the catalyst bed comprises a gradient of catalysts which changes from a high concentration of O.sub.2-OCM catalysts at the front of the bed to a high concentration of CO.sub.2-ODH catalysts at the end of the catalyst bed.
(531) The O.sub.2-ODH catalyst and CO.sub.2-ODH catalyst may have the same or different compositions. For example, in some embodiments the O.sub.2-ODH catalyst and CO.sub.2-ODH catalyst have the same composition but different morphologies (e.g., nanowire, bent nanowire, bulk, etc.). In other embodiments the O.sub.2-ODH and the CO.sub.2-ODH catalyst have different compositions.
(532) In other embodiments, the catalyst bed comprises alternating layers of O.sub.2-OCM and CO.sub.2-ODH catalysts. The catalyst layer stack may begin with a layer of O.sub.2-OCM catalyst, so that it can supply the next layer (e.g., a CO2-ODH layer) with the necessary CO.sub.2. The O.sub.2-OCM layer thickness may be optimized to be the smallest at which 02 conversion is 100% and thus the CH.sub.4 conversion of the layer is maximized. The catalyst bed may comprise any number of catalyst layers, for example the overall number of layers may be optimized to maximize the overall CH.sub.4 conversion and C2 selectivity.
(533) In some embodiments, the catalyst bed comprises alternating layers of low temperature O.sub.2-OCM catalysts and high temperature CO.sub.2-ODH catalysts. Since the CO.sub.2-ODH reaction is endothermic, the layers of CO.sub.2-ODH catalyst may be sufficiently thin such that in can be “warmed up” by the hotspots of the O.sub.2-OCM layers. The endothermic nature of the CO.sub.2-ODH reaction can be advantageous for the overall thermal management of an OCM reactor. In some embodiments, the CO.sub.2-ODH catalyst layers act as “internal” cooling for the O.sub.2-OCM layers, thus simplifying the requirements for the cooling, for example in a tubular reactor. Therefore, an interesting cycle takes place with the endothermic reaction providing the necessary heat for the endothermic reaction and the endothermic reaction providing the necessary cooling for the exothermic reaction.
(534) Accordingly, one embodiment of the present invention is a method for the oxidative coupling of methane, wherein the method comprises conversion of methane to ethane and/or ethylene in the presence of a catalytic material, and wherein the catalytic material comprises a bed of alternating layers of O.sub.2-OCM catalysts and CO.sub.2-ODH catalysts. In other embodiments the bed comprises a mixture (i.e., not alternating layers) of O.sub.2-OCM catalysts and CO.sub.2-ODH catalysts. Such methods increase the ethylene yield and/or ratio of ethylene to ethane compared to other known methods.
(535) In other embodiments, the OCM methods include use of a jacketed reactor with the exothermic O.sub.2-OCM reaction in the core and the endothermic CO.sub.2-ODH reaction in the mantel. In other embodiments, the unused CO.sub.2 can be recycled and reinjected into the reactor, optionally with the recycled CH.sub.4. Additional CO.sub.2 can also be injected to increase the overall methane conversion and help reduce greenhouse gases.
(536) In other embodiments, the reactor comprises alternating stages of O.sub.2-OCM catalyst beds and CO.sub.2-ODH catalyst beds. The CO.sub.2 necessary for the CO.sub.2-ODH stages is provided by the O.sub.2-OCM stage upstream. Additional CO.sub.2 may also be injected. The O.sub.2 necessary for the subsequent O2-OCM stages is injected downstream from the CO.sub.2-ODH stages. The CO.sub.2-ODH stages may provide the necessary cooling for the O.sub.2-OCM stages. Alternatively, separate cooling may be provided. Likewise, if necessary the inlet gas of the CO.sub.2-ODH stages can be additionally heated, the CO.sub.2-ODH bed can be heated or both.
(537) In related embodiments, the CO.sub.2 naturally occurring in natural gas is not removed prior to performing the OCM, alternatively CO.sub.2 is added to the feed with the recycled methane. Instead the CO.sub.2 containing natural gas is used as a feedstock for CO.sub.2-ODH, thus potentially saving a separation step. The amount of naturally occurring CO.sub.2 in natural gas depends on the well and the methods can be adjusted accordingly depending on the source of the natural gas.
3. Carbon Dioxide Reforming of Methane
(538) Carbon dioxide reforming (CDR) of methane is an attractive process for converting CO.sub.2 in process streams or naturally occurring sources into the valuable chemical product, syngas (a mixture of hydrogen and carbon monoxide). Syngas can then be manufactured into a wide range of hydrocarbon products through processes such as the Fischer-Tropsch synthesis (discussed below) to form liquid fuels including methanol, ethanol, diesel, and gasoline. The result is a powerful technique to not only remove CO.sub.2 emissions but also create a new alternative source for fuels that are not derived from petroleum crude oil. The CDR reaction with methane is exemplified in reaction scheme (11).
CO.sub.2+CH.sub.4.fwdarw.2CO+2H.sub.2 (11)
(539) Unfortunately, no established industrial technology for CDR exists today in spite of its tremendous potential value. While not wishing to be bound by theory, it is thought that the primary problem with CDR is due to side-reactions from catalyst deactiviation induced by carbon deposition via the Boudouard reaction (reaction scheme (12)) and/or methane cracking (reaction scheme (13)) resulting from the high temperature reaction conditions. The occurrence of the coking effect is intimately related to the complex reaction mechanism, and the associated reaction kinetics of the catalysts employed in the reaction.
2CO.fwdarw.C+CO.sub.2 (12)
CH.sub.4.fwdarw.C+2H.sub.2 (13)
(540) While not wishing to be bound by theory, the CDR reaction is thought to proceed through a multistep surface reaction mechanism.
(541) In one embodiment, the present disclosure provides nanowires, for example the exemplary nanowires disclosed herein, which are useful as catalysts for the carbon dioxide reforming of methane. For example, in one embodiment the nanowires are useful as catalysts in a CDR reaction for the production of syn gas.
(542) Improvements to the yield, selectivity, and/or conversion in the CDR reaction employing bulk catalysts are needed. Accordingly, in one embodiment, the nanowires posses a catalytic activity in the CDR reaction such that the yield, selectivity, and/or conversion is better than when the CDR reaction is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the conversion of CO.sub.2 to CO in the CDR reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the conversion of CO.sub.2 to CO compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the conversion of CO.sub.2 to CO in a CDR reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(543) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the yield of CO in a CDR reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the yield of CO compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the yield of CO in a CDR reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(544) In another embodiment, the disclosure provides a nanowire having a catalytic activity in a CDR reaction such that the nanowire has the same or better catalytic activity, but at a lower temperature, compared a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the catalytic activity of the nanowires in a CDR reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 20° C. less. In some embodiments the catalytic activity of the nanowires in a CDR reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 50° C. less. In some embodiments the catalytic activity of the nanowires in a CDR reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 100° C. less. In some embodiments the catalytic activity of the nanowires in a CDR reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 200° C. less.
(545) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the selectivity for CO in a CDR reaction is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the selectivity for CO compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the selectivity for CO in a CDR reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(546) In one embodiment, the nanowires disclosed herein enable efficient conversion of CO.sub.2 to CO in the CDR reaction at temperatures less than when the corresponding bulk material is used as a catalyst. For example, in one embodiment, the nanowires enable efficient conversion (i.e., high yield, conversion, and/or selectivity) of CO.sub.2 to CO at temperatures of less than 900° C., less than 800° C., less than 700° C., less than 600° C., or less than 500° C.
4. Fischer-Tropsch Synthesis
(547) Fischer-Tropsch synthesis (FTS) is a valuable process for converting synthesis gas (i.e., CO and H.sub.2) into valuable hydrocarbon fuels, for example, light alkenes, gasoline, diesel fuel, etc. FTS has the potential to reduce the current reliance on the petroleum reserve and take advantage of the abundance of coal and natural gas reserves. Current FTS processes suffer from poor yield, selectivity, conversion, catalyst deactivation, poor thermal efficiency and other related disadvantages. Production of alkanes via FTS is shown in reaction scheme (14), wherein n is an integer.
CO+2H.sub.2.fwdarw.(1/n)(C.sub.nH.sub.2n)+H.sub.2O (14)
(548) In one embodiment, nanowires are provided which are useful as catalysts in FTS processes. For example, in one embodiment the nanowires are useful as catalysts in a FTS process for the production of alkanes.
(549) Improvements to the yield, selectivity, and/or conversion in FTS processes employing bulk catalysts are needed. Accordingly, in one embodiment, the nanowires posses a catalytic activity in an FTS process such that the yield, selectivity, and/or conversion is better than when the FTS process is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the conversion of CO to alkane in an FTS process is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the conversion of CO to alkane compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the conversion of CO to alkane in an FTS process catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(550) In another embodiment, the disclosure provides a nanowire having a catalytic activity in an FTS process such that the nanowire has the same or better catalytic activity, but at a lower temperature, compared a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the catalytic activity of the nanowires in an FTS process is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 20° C. less. In some embodiments the catalytic activity of the nanowires in an FTS process is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 50° C. less. In some embodiments the catalytic activity of the nanowires in an FTS process is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 100° C. less. In some embodiments the catalytic activity of the nanowires in an FTS process is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 200° C. less.
(551) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the yield of alkane in a FTS process is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the yield of alkane compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the yield of alkane in an FTS process catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(552) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the selectivity for alkanes in an FTS process is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the selectivity for alkanes compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the selectivity for alkanes in an FTS process catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(553) In one embodiment, the nanowires disclosed herein enable efficient conversion of CO to alkanes in a CDR process at temperatures less than when the corresponding bulk material is used as a catalyst. For example, in one embodiment, the nanowires enable efficient conversion (i.e., high yield, conversion, and/or selectivity) of CO to alkanes at temperatures of less than 400° C., less than 300° C., less than 250° C., less than 200° C., less the 150° C., less than 100° C. or less than 50° C.
5. Oxidation of CO
(554) Carbon monoxide (CO) is a toxic gas and can convert hemoglobin to carboxyhemoglobin resulting in asphyxiation. Dangerous levels of CO can be reduced by oxidation of CO to CO.sub.2 as shown in reaction scheme 15:
CO+1/2O.sub.2.fwdarw.CO.sub.2 (15)
(555) Catalysts for the conversion of CO into CO.sub.2 have been developed but improvements to the known catalysts are needed. Accordingly in one embodiment, the present disclosure provides nanowires useful as catalysts for the oxidation of CO to CO.sub.2.
(556) In one embodiment, the nanowires posses a catalytic activity in a process for the conversion of CO into CO.sub.2 such that the yield, selectivity, and/or conversion is better than when the oxidation of CO into CO.sub.2 is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the conversion of CO to CO.sub.2 is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the conversion of CO to CO.sub.2 compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material and having the same chemical composition as the nanowire. In other embodiments, the conversion of CO to CO.sub.2 catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(557) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the yield of CO.sub.2 from the oxidation of CO is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the yield of CO.sub.2 compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the yield of CO.sub.2 from the oxidation of CO catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(558) In another embodiment, the disclosure provides a nanowire having a catalytic activity in an oxidation of CO reaction such that the nanowire has the same or better catalytic activity, but at a lower temperature, compared a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the catalytic activity of the nanowires in an oxidation of CO reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 20° C. less. In some embodiments the catalytic activity of the nanowires in an oxidation of CO reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 50° C. less. In some embodiments the catalytic activity of the nanowires in an oxidation of CO reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 100° C. less. In some embodiments the catalytic activity of the nanowires in an oxidation of CO reaction is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 200° C. less.
(559) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the selectivity for CO.sub.2 in the oxidation of CO is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the selectivity for CO.sub.2 compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the selectivity for CO.sub.2 in the oxidation of CO catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(560) In one embodiment, the nanowires disclosed herein enable efficient conversion of CO to CO.sub.2 at temperatures less than when the corresponding bulk material is used as a catalyst. For example, in one embodiment, the nanowires enable efficient conversion (i.e., high yield, conversion, and/or selectivity) of CO to CO.sub.2 at temperatures of less than 500° C., less than 400° C., less than 300° C., less than 200° C., less than 100° C., less than 50° C. or less than 20° C.
(561) Although various reactions have been described in detail, the disclosed nanowires are useful as catalysts in a variety of other reactions. In general, the disclosed nanowires find utility in any reaction utilizing a heterogeneous catalyst and have a catalytic activity such that the yield, conversion, and/or selectivity in reaction catalyzed by the nanowires is better than the yield, conversion and/or selectivity in the same reaction catalyzed by a corresponding bulk catalyst.
6. Combustion of Hydrocarbons
(562) In another embodiment, the present disclosure provides a nanowire having catalytic activity in a reaction for the catalyzed combustion of hydrocarbons. Such catalytic reactions find utility in catalytic converters for automobiles, for example by removal of unburned hydrocarbons in the exhaust by catalytic combustion or oxidation of soot captured on catalyzed particle filters resulting in reduction on diesel emissions from the engine. When running “cold”, the exhausts temperature of a diesel engine is quite low, thus a low temperature catalyst, such as the disclosed nanowires, is needed to efficiently eliminate all unburned hydrocarbons. In addition, in case of soot removal on catalyzed particulate filters, intimate contact between the soot and the catalyst is require; the open mesh morphology of nanowire catalyst coating is advandageous to promote such intimate contact between soot and oxidation catalyst.
(563) In contrast to a corresponding bulk catalyst, Applicants have found that certain nanowires, for example the exemplary nanowires disclosed herein, posses a catalytic activity (for example because of their morphology) in the combustion of hydrocarbons or soot such that the yield, selectivity, and/or conversion is better than when the combustion of hydrocarbons is catalyzed by a corresponding bulk catalyst. In one embodiment, the disclosure provides a nanowire having a catalytic activity such that the combustion of hydrocarbons is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the combustion of hydrocarbons compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In other embodiments, the total combustion of hydrocarbons catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(564) In another embodiment, the disclosure provides a nanowire having a catalytic activity such that the yield of combusted hydrocarbon products is greater than at least 1.1 times, 1.25 times, 1.50 times, 2.0 times, 3.0 times, or 4.0 times the yield of combusted hydrocarbon products compared to the same reaction under the same conditions but performed with a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the yield of combusted hydrocarbon products in a reaction catalyzed by the nanowire is greater than 10%, greater than 20%, greater than 30%, greater than 50%, greater than 75%, or greater than 90%.
(565) The stability of the nanowires is defined as the length of time a catalyst will maintain its catalytic performance without a significant decrease in performance (e.g., a decrease >20%, >15%, >10%, >5%, or greater than 1% in hydrocarbon or soot combustion activity). In some embodiments, the nanowires have stability under conditions required for the hydrocarbon combustion reaction of >1 hr, >5 hrs, >10 hrs, >20 hrs, >50 hrs, >80 hrs, >90 hrs, >100 hrs, >150 hrs, >200 hrs, >250 hrs, >300 hrs, >350 hrs, >400 hrs, >450 hrs, >500 hrs, >550 hrs, >600 hrs, >650 hrs, >700 hrs, >750 hrs, >800 hrs, >850 hrs, >900 hrs, >950 hrs, >1,000 hrs, >2,000 hrs, >3,000 hrs, >4,000 hrs, >5,000 hrs, >6,000 hrs, >7,000 hrs, >8,000 hrs, >9,000 hrs, >10,000 hrs, >11,000 hrs, >12,000 hrs, >13,000 hrs, >14,000 hrs, >15,000 hrs, >16,000 hrs, >17,000 hrs, >18,000 hrs, >19,000 hrs, >20,000 hrs, >1 yrs, >2 yrs, >3 yrs, >4 yrs or >5 yrs.
(566) In another embodiment, the disclosure provides a nanowire having a catalytic activity in the combustion of hydrocarbons such that the nanowire has the same or better catalytic activity, but at a lower temperature, compared a catalyst prepared from bulk material having the same chemical composition as the nanowire. In some embodiments the catalytic activity of the nanowires in the combustion of hydrocarbons is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 20° C. less. In some embodiments the catalytic activity of the nanowires in the combustion of hydrocarbons is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 50° C. less. In some embodiments the catalytic activity of the nanowires in the combustion of hydrocarbons is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 100° C. less. In some embodiments the catalytic activity of the nanowires in the combustion of hydrocarbons is the same or better than the catalytic activity of a catalyst prepared from bulk material having the same chemical composition as the nanowire, but at a temperature of at least 200° C. less.
7. Evaluation of Catalytic Properties
(567) To evaluate the catalytic properties of the nanowires in a given reaction, for example those reactions discussed above, various methods can be employed to collect and process data including measurements of the kinetics and amounts of reactants consumed and the products formed. In addition to allowing for the evaluation of the catalytic performances, the data can also aid in designing large scale reactors, experimentally validating models and optimizing the catalytic process.
(568) One exemplary methodology for collecting and processing data is depicted in
(569) As an example, in a laboratory setting, an Altamira Benchcat 200 can be employed using a 4 mm ID diameter quartz tube with a 0.5 mm ID capillary downstream. Quartz tubes with 2 mm or 6 mm ID can also be used. Nanowires are tested in a number of different dilutions and amounts. In some embodiments, the range of testing is between 10 and 300 mg. In some embodiments, the nanowires are diluted with a non-reactive diluent. This diluent can be quartz (SiO.sub.2) or other inorganic materials, which are known to be inert in the reaction condition. The purpose of the diluent is to minimize hot spots and provide an appropriate loading into the reactor. In addition, the catalyst can be blended with less catalytically active components as described in more detail above.
(570) In a typical procedure, 50 mg is the total charge of nanowire, optionally including diluent. On either side of the nanowires a small plug of glass wool is loaded to keep the nanowires in place. A thermocouple is placed on the inlet side of the nanowire bed into the glass wool to get the temperature in the reaction zone. Another thermocouple can be placed on the downstream end of the nanowire bed into the catalyst bed itself to measure the exotherms, if any.
(571) When blending the pure nanowire with diluent, the following exemplary procedure may be used: x (usually 10-50) mg of the catalyst (either bulk or test nanowire catalyst) is blended with (100-x) mg of diluent. Thereafter, about 2 ml of ethanol or water is added to form a slurry mixture, which is then sonicated for about 10 minutes. The slurry is then dried in an oven at about 100-140° C. for 2 hours to remove solvent. The resulting solid mixture is then scraped out and loaded into the reactor between the plugs of quartz wool.
(572) Once loaded into the reactor, the reactor is inserted into the Altamira instrument and furnace and then a temperature and flow program is started. In some embodiment, the total flow is 50 to 100 sccm of gases but this can be varied and programmed with time. In one embodiment, the temperatures range from 450° C. to 900° C. The reactant gases comprise air or oxygen (diluted with nitrogen or argon) and methane in the case of the OCM reaction and gas mixtures comprising ethane and/or propane with oxygen for oxidative dehydrogenation (ODH) reactions. Other gas mixtures can be used for other reactions.
(573) The primary analysis of these oxidation catalysis runs is the Gas Chromatography (GC) analysis of the feed and effluent gases. From these analyses, the conversion of the oxygen and alkane feed gases can easily be attained and estimates of yields and selectivities of the products and by-products can be determined.
(574) The GC method developed for these experiments employs 4 columns and 2 detectors and a complex valve switching system to optimize the analysis. Specifically, a flame ionization detector (FID) is used for the analysis of the hydrocarbons only. It is a highly sensitive detector that produces accurate and repeatable analysis of methane, ethane, ethylene, propane, propylene and all other simple alkanes and alkenes up to five carbons in length and down to ppm levels.
(575) There are two columns in series to perform this analysis, the first is a stripper column (alumina) which traps polar materials (including the water by-product and any oxygenates generated) until back-flushed later in the cycle. The second column associated with the FID is a capillary alumina column known as a PLOT column, which performs the actual separation of the light hydrocarbons. The water and oxygenates are not analyzed in this method.
(576) For the analysis of the light non-hydrocarbon gases, a Thermal Conductivity Detector (TCD) may be employed which also employees two columns to accomplish its analysis. The target molecules for this analysis are CO.sub.2, ethylene, ethane, hydrogen, oxygen, nitrogen, methane and CO. The two columns used here are a porous polymer column known as the Hayes Sep N, which performs some of the separation for the CO.sub.2, ethylene and ethane. The second column is a molecular sieve column, which uses size differentiation to perform the separation. It is responsible for the separation of H.sub.2, O.sub.2, N.sub.2, methane and CO.
(577) There is a sophisticated and timing sensitive switching between these two columns in the method. In the first 2 minutes or so, the two columns are operating in series but at about 2 minutes, the molecular sieve column is by-passed and the separation of the first 3 components is completed. At about 5-7 minutes, the columns are then placed back in series and the light gases come off of the sieve according to their molecular size.
(578) The end result is an accurate analysis of all of the aforementioned components from these fixed-bed, gas phase reactions. Analysis of other reactions and gases not specifically described above can be performed in a similar manner.
8. Downstream Products
(579) As noted above, in one embodiment the present disclosure is directed to nanowires useful as catalysts in reactions for the preparation of a number of valuable hydrocarbon compounds. For example, in one embodiment the nanowires are useful as catalysts for the preparation of ethylene from methane via the OCM reaction. In another embodiment, the nanowires are useful as catalysts for the preparation of ethylene or propylene via oxidative dehydrogenation of ethane or propane, respectively. Ethylene and propylene are valuable compounds, which can be converted into a variety of consumer products. For example, as shown in
(580) Accordingly, in one embodiment the invention is directed to a method for the preparation of C2 hydrocarbons via the OCM reaction, the method comprises contacting a catalyst as described herein with a gas comprising methane. In some embodiments the C2 hydrocarbons are selected from ethane and ethylene. In other embodiments the disclosure provides a method of preparing any of the downstream products of ethylene noted in
(581) In another embodiment, a process for the preparation of ethylene from methane comprising contacting a mixture comprising oxygen and methane at a temperature below 900° C., below 850° C., below 800° C., below 750° C., below 700° C. or below 650° C. with a nanowire catalyst as disclosed herein is provided.
(582) In another embodiment, the disclosure provides a method of preparing a product comprising low density polyethylene, high density polyethylene, ethylene dichloride, ethylene oxide, ethylbenzene, ethanol or vinyl acetate, alkenes, alkanes, aromatics, alcohols, or mixtures thereof. The method comprises converting ethylene into low density polyethylene, high density polyethylene, ethylene dichloride, ethylene oxide, ethylbenzene, ethanol or vinyl acetate, wherein the ethylene has been prepared via a catalytic reaction employing a nanowires, for example any of the exemplary nanowires disclosed herein.
(583) In more specific embodiments of any of the above methods, the ethylene is produced via an OCM or ODH reaction or combinations thereof.
(584) In one particular embodiment, the disclosure provides a method of preparing a downstream product of ethylene and/or ethane, wherein the downstream product is a hydrocarbon fuel. For example, the downstream product of ethylene may be a hydrocarbon fuel such as natural gasoline or a C.sub.4-C.sub.14 hydrocarbon, including alkanes, alkenes and aromatics. Some specific examples include 1-butene, 1-hexene, 1-octene, hexane, octane, benzene, toluene, xylenes and the like. The method comprises converting methane into ethylene, ethane or combinations thereof by use of a catalytic nanowire, for example any of the catalytic nanowires disclosed herein, and further oligomerizing the ethylene and/or ethane to prepare a downstream product of ethylene and/or ethane. For example, the methane may be converted to ethylene, ethane or combinations thereof via the OCM reaction as discussed above. The catalytic nanowire may be any nanowire and is not limited with respect to morphology or composition. The catalytic nanowire may be an inorganic catalytic polycrystalline nanowire, the nanowire having a ratio of effective length to actual length of less than one and an aspect ratio of greater than ten as measured by TEM in bright field mode at 5 keV, wherein the nanowire comprises one or more elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof. Alternatively, the catalytic nanowire may be an inorganic nanowire comprising one or more metal elements from any of Groups 1 through 7, lanthanides, actinides or combinations thereof and a dopant comprising a metal element, a semi-metal element, a non-metal element or combinations thereof. The nanowires may additionally comprise any number of doping elements as discussed above.
(585) As depicted in
(586) Ethylene is recovered and charged to an oligomerization reactor. Optionally the ethylene stream may contain CO.sub.2, H.sub.2O, N.sub.2, ethane, C3's and/or higher hydrocarbons. Oligomerization to higher hydrocarbons (e.g., C.sub.4-C.sub.14) then proceeds under any number of conditions known to those of skill in the art. For example oligomerization may be effected by use of any number of catalysts known to those skilled in the art. Examples of such catalysts include catalytic zeolites, crystalline borosilicate molecular sieves, homogeneous metal halide catalysts, Cr catalysts with pyrrole ligands or other catalysts. Exemplary methods for the conversion of ethylene into higher hydrocarbon products are disclosed in the following references: Catalysis Science & Technology (2011), 1(1), 69-75; Coordination Chemistry Reviews (2011), 255(7-8), 861-880; Eur. Pat. Appl. (2011), EP 2287142 A1 20110223; Organometallics (2011), 30(5), 935-941; Designed Monomers and Polymers (2011), 14(1), 1-23; Journal of Organometallic Chemistry 689 (2004) 3641-3668; Chemistry—A European Journal (2010), 16(26), 7670-7676; Acc. Chem. Res. 2005, 38, 784-793; Journal of Organometallic Chemistry, 695 (10-11): 1541-1549 May 15 2010; Catalysis Today Volume 6, Issue 3, January 1990, Pages 329-349; U.S. Pat. No. 5,968,866; 6,800,702; 6,521,806; 7,829,749; 7,867,938; 7,910,670; 7,414,006 and Chem. Commun., 2002, 858-859, each of which are hereby incorporated in their entirety by reference.
(587) In certain embodiments, the exemplary OCM and oligomerization modules depicted in
(588) Referring to
EXAMPLES
Example 1
Genetic Engineering/Preparation of Phage
(589) Phage were amplified in DH5 derivative E. coli(New England Biolabs, NEB5-alpha F′ Iq; genotype: F′ proA+B+laclq Δ(lacZ)M15 zzf::Tn10 (TetR)/fhuA2Δ(argF-lacZ)U169 phoA gInV44 ϕ80Δ(lacZ)M15 gyrA96 recA1 endA1 thi-1 hsdR17) and purified using standard polyethylene glycol and sodium chloride precipitation protocols as described in the following references: Kay, B. K.; Winter, J.; McCafferty, J. Phage Display of Peptides and Proteins: A Laboratory Manual; Academic Press: San Diego (1996); C. F. Barbas, et al., ed., Phage Display: A Laboratory Manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2001); and Joseph Sambrook and David W. Russell, Molecular Cloning, 3rd edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA, 2001.
Example 2
Preparation of Phage Solutions
(590) The phage solutions were additionally purified by centrifuging at an acceleration of 10000 g at least once (until no precipitated material was observed), decanting the supernatant and splitting it in 50 ml containers, which were then stored frozen at −20° C. The frozen phage solutions were thawed only shortly before being used.
(591) The concentration of the phage solutions was measured using a UV-VIS spectrometer. The concentration of each of the frozen phage aliquots was measured prior to use. This spectroscopic method relies on the absorption of the nucleotides in the DNA of the phage and is described in more detail in “Phage Display: A Laboratory Manual” by Barbas, Burton, Scott and Silverman (Cold Spring Harbor Laboratory Press, 2001). The concentration of phage solutions is expressed in pfu/ml (plague forming units per milliliter).
Example 3
Preparation Mg(OH).SUB.2 .Nanowires
(592)
(593) A magnesium solution and a base solution are added to the phage solution in order to precipitate Mg(OH).sub.2. The magnesium solution can be of any soluble magnesium salt, e.g. MgX2.6H2O (X=Cl, Br, I), Mg(NO.sub.3).sub.2, MgSO.sub.4, magnesium acetate, etc. The range of the magnesium concentration in the reaction mixture is quite narrow, typically at 0.01M. The combination of the phage concentration and the magnesium concentration (i.e. the ratio between the pVIII proteins and magnesium ions) is very important in determining both the nanowires formation process window and their morphology.
(594) The base can be any alkali metal hydroxide (e.g. LiOH, NaOH, KOH), soluble alkaline earth metal hydroxide (e.g. Sr(OH).sub.2, Ba(OH).sub.2) or any ammonium hydroxide (e.g., NR.sub.4OH, R═H, CH.sub.3, C.sub.2H.sub.5, etc.). Certain selection criteria for the base include: adequate solubility (at least several orders of magnitude higher than Mg(OH).sub.2 for Mg(OH).sub.2 nanowires), high enough strength (pH of the reaction mixture should be at least 11) and an inability to coordinate magnesium (for Mg(OH).sub.2 nanowires) to form soluble products. LiOH is a preferred choice for Mg(OH).sub.2 nanowires formation because lithium may additionally be incorporated in the Mg(OH).sub.2 as a dopant, providing a Li/MgO doped catalyst for OCM.
(595) Another factor concerning the base is the amount of base used or the concentration ratio of OH.sup.−/Mg.sup.2+, i.e. the ratio between the number of OH equivalents added and the number of moles of Mg added. In order to fully convert the Mg ions in solution to Mg(OH).sub.2, the OH/Mg ratio needed is 2. The OH.sup.−/Mg.sup.2+ used in the formation of Mg(OH).sub.2 nanowires ranges from 0.5 to 2 and, depending on this ratio, the morphology of the reaction product changes from thin nanowires to agglomerations of nanoparticles. The OH.sup.−/Mg.sup.2+ ratio is determined by the pH of the reaction mixture, which needs to be at least 11. If the pH is below 11, no precipitation is observed, i.e. no Mg(OH).sub.2 is formed. If the pH is above 12, the morphology of the nanowires begins to change and more nanoparticles are obtained, i.e. non-selective precipitation.
(596) Considering the narrow window of magnesium concentration in which Mg(OH).sub.2 nanowires can be obtained, the other key synthetic parameters that determine the nanowires formation and morphology include but are not limited to: phage sequence and concentration thereof, the concentration ratio of Mg.sup.2+/pVIII protein, the concentration ratio of OH.sup.−/Mg.sup.2+, the incubation time of phage and Mg.sup.2+; incubation time of phage and the OH.sup.−; the sequence of adding anion and metal ions; pH; the solution temperature in the incubation step and/or growth step; the types of metal precursor salt (e.g., MgCl.sub.2 or Mg(NO.sub.3).sub.2); the types of anion precursor (e.g., NaOH or LiOH); the number of additions; the time that lapses between the additions of the metal salt and anion precursor, including, e.g., simultaneous (zero lapse) or sequential additions.
(597) The Mg salt solution and the base were added sequentially, separated by an incubation time (i.e., the first incubation time). The sequence of addition has an effect on the morphology of the nanowires. The first incubation time can be at least 1 h and it should be longer in the case the magnesium salt solution is added first. The Mg salt solution and the base can be added in a single “shot” or in a continuous slow flow using a syringe pump or in multiple small shots using a liquid dispenser robot. The reaction is then carried either unstirred or with only mild to moderate stirring for a specific time (i.e., the second incubation time). The second incubation time is not as strong a factor in the synthesis of Mg(OH).sub.2 nanowires, but it should be long enough for the nanowires to precipitate out of the reaction solution (e.g., several minutes). For practical reasons, the second incubation time can be as long as several hours. The reaction temperature can be anything from just above freezing temperature (e.g., 4° C.) up to 80° C. The temperature affects the nanowires morphology.
(598) The precipitated Mg(OH).sub.2 nanowires are isolated by centrifuging the reaction mixture and decanting the supernatant. The precipitated material is then washed at least once with a water solution with pH >10 to avoid redissolution of the Mg(OH).sub.2 nanowires. Typically, the washing solution used can be ammonium hydroxide water solution or an alkali metal hydroxide solution (e.g., LiOH, NaOH, KOH). This mixture is centrifuged and the supernatant decanted. Finally, the product can be either dried (see, Example 5) or resuspended in ethanol for TEM analysis.
(599) The decanted supernatant of the reaction mixture can be analyzed by UV-VIS to determine the phage concentration (see, Example 2) and thus give an estimate of the amount of phage incorporated in the precipitated Mg(OH).sub.2, i.e. the amount of “mineralized” phage.
(600)
Example 4
Characterization of Mg(OH).SUB.2 .Nanowires
(601) Mg(OH).sub.2 nanowires prepared according to Example 3 were characterized by TEM in order to determine their morphology. First, a few microliters (˜500) of ethanol was used to suspend the isolated Mg(OH).sub.2. The nanowires were then deposited on a TEM grid (copper grid with a very thin carbon layer) placed on filter paper to help wick out any extra liquid. After allowing the ethanol to dry, the TEM grid was loaded in a TEM and characterized. TEM was carried out at 5 KeV in bright field mode in a DeLong LVEMS.
(602) The nanowires were additionally characterized by XRD (for phase identification) and TGA (for calcination optimization).
Example 5
Calclnation of Mg(OH).SUB.2 .Nanowires
(603) The isolated nanowires as prepared in Example 3 were dried in an oven at relatively low temperature (60-120° C.) prior to calcination.
(604) The dried material was placed in a ceramic boat and calcined in air at 450 C.° in order to convert the Mg(OH).sub.2 nanowires into MgO nanowires. The calcination recipe can be varied considerably. For example, the calcination can be done relatively quickly like in these two examples: load in a muffle oven preheated at 450° C., calcination time=120 min load in a muffle oven (or tube furnace) at room temperature and ramp to 450° C. with 5° C./min rate, calcination time=60 min
(605) Alternatively, the calcination can be done in steps that are chosen according to the TGA signals like in the following example: load in a muffle oven (or tube furnace) at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 60 min, ramp to 280° C. with 2° C./min rate, dwell for 60 min, ramp to 350° C. with 2° C./min rate, dwell for 60 min and finally ramp to 450° C. with 2° C./min rate, dwell for 60 min.
(606) Generally, a step recipe is preferable since it should allow for a better, smoother and more complete conversion of Mg(OH).sub.2 into MgO. Optionally, the calcined product is ground into a fine powder.
(607)
Example 6
Preparation of Li Doped Mgo Nanowires
(608) Doping of nanowires is achieved by using the incipient wetness impregnation method. Before impregnating the MgO nanowires with the doping solution, the maximum wettability (i.e. the ability of the nanowires to absorb the doping solution before becoming a suspension or before “free” liquid is observed) of the nanowires was determined. This is a very important step for an accurate absorption of the doping metal on the MgO surface. If too much dopant solution is added and a suspension is formed, a significant amount of dopant will crystallize unabsorbed upon drying and if not enough dopant solution is added, significant portions of the MgO surface will not be doped.
(609) In order to determine the maximum wettability of the MgO nanowires, small portions of water were dropped on the calcined MgO powder until a suspension was formed, i.e. until “free” liquid is observed. The maximum wettability was determined to be the total amount of water added before the suspension formed. The concentration of the doping solution was then calculated so that the desired amount of dopant was contained in the volume of doping solution corresponding to the maximum wettability of the MgO nanowires. In another way to describe the incipient wetness impregnation method, the volume of the doping solution is set to be equal to the pore volume of the nanowires, which can be determined by BET (Brunauer, Emmett, Teller) measurements. The doping solution is then drawn into the pores by capillary action.
(610) In one embodiment, the doping metal for MgO based catalysts for OCM is lithium (see, also,
(611) The calculated amount of dopant solution of the desired concentration was dropped onto the calcined MgO nanowires. The obtained wet powder was dried in an oven at relatively low temperature (60-120° C.) and calcined using one of the recipes described above. It is noted that, during this step, no phase transition occurs (MgO has already been formed in the previous calcination step) and thus a step recipe (see previous paragraph) may not be necessary.
(612) The dopant impregnation step can also be done prior to the calcination, after drying the Mg(OH).sub.2 nanowires isolated from the reaction mixture. In this case, the catalyst can be calcined immediately after the dopant impregnation, i.e. no drying and second calcination steps would be required since its goals are accomplished during the calcination step.
(613) Three identical syntheses were made in parallel. In each synthesis, 80 ml of concentrated solution of phages (SEQ ID NO: 3 at a concentration of ≥5E12 pfu/ml) were mixed in a 100 ml glass bottle with 0.4 ml of 1 M LiOH aqueous solution and left incubating for 1 h. 0.8 ml of 1 M MgCl.sub.2 aqueous solution were added using a pipette and the mixture was mixed by gently shaking it. The reaction mixture was left incubating unstirred for 72 h at 60° C. in an oven. After the incubation time, the mixture was centrifuged. The precipitated material was resuspended in 20 ml of 0.06 M NH.sub.4OH aqueous solution (pH=11), the mixture was centrifuged and the supernatant decanted. The obtained Mg(OH).sub.2 nanowires were resuspended in ethanol. The ethanol suspensions of the three identical syntheses were combined and a few microliters of the ethanol suspension were used for TEM analysis. The ethanol suspension was centrifuged and the supernatant decanted. The gel-like product was transferred in a ceramic boat and dried for 1 h at 120° C. in a vacuum oven.
(614) The dried product was calcined in a tube furnace using a step recipe (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 60 min, ramp to 280° C. with 2° C./min rate, dwell for 60 min, ramp to 350° C. with 2° C./min rate, dwell for 60 min, ramp to 450° C. with 2° C./min rate, dwell for 60 min and finally cool to room temperature). The yield was 24 mg. The calcined product was ground to a fine powder.
(615) 10 mg of the calcined product were impregnated with a LiOH aqueous solution. First, the maximum wettability was determined by adding water to the calcined product in a ceramic boat until the powder was saturated but no “free” liquid was observed. The maximum wettability was 12 μl. Since the target doping level was 1 wt % lithium, the necessary concentration of the LiOH aqueous solution was calculated to be 1.2 M. The calcined product was dried again for 1 h at 120° C. to remove the water used to determine the wettability of the powder. 12 μl of the 1.2 M LiOH solution were dropped on the MgO nanowires powder. The wet powder was dried for 1 h at 120° C. in a vacuum oven and finally calcined in a muffle oven (load at room temperature, ramp to 460° C. with 2° C./min ramp, dwell for 120 min).
Example 7
Creating Diversity by Varying the Reaction Parameters
(616) Certain synthetic parameters strongly influence the nanowire formation on phage, including selective binding of metal and/or anions, as well as surface morphologies.
(617) Thus, varying these and other reaction conditions may produce a diverse class of nanowire catalysts. In addition, certain correlation between the reaction conditions and the surface morphologies of the nanowires can be empirically established, thus enabling rational designs of catalytic nanowires.
Example 8
Preparation of Sr-Doped La.SUB.2.O.SUB.3 .Nanowires
(618) 23 ml of 2.5 e12 pfu solution of phages (SEQ ID NO: 3) was mixed in a 40 ml glass bottle with 0.046 ml of 0.1 M LaCl.sub.3 aqueous solution and left incubating for 16 h. After this incubation period, a slow multistep addition is conducted with 1.15 ml of 0.05 M LaCl.sub.3 solution and 1.84 ml of 0.3 M NH.sub.4OH. This addition is conducted in six hours and twenty steps. The reaction mixture was left stirred another 2 h at room temperature. After that time the suspension was centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then resuspended in 5 ml of water and centrifuged in order to further remove un-reacted species. A final wash was conducted with 2 ml ethanol. The gel-like product remaining is then dried for 30 minutes at 110° C. in a vacuum oven.
(619) The dried product was then calcined in a muffle furnace using a step recipe (load in the furnace at room temperature, ramp to 200° C. with 3° C./min rate, dwell for 120 min, ramp to 400° C. with 3° C./min rate, dwell for 120 min, cool to room temperature). The calcined product was then ground to a fine powder.
(620) 5 mg of the calcined product were impregnated with 0.015 ml Sr(NO.sub.3).sub.2 0.1M aqueous solution. Powder and solution is mixed on hot plate at 90 C until forming a paste. The paste was then dried for 1 h at 120° C. in a vacuum oven and finally calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 200° C. with 3° C./min rate, dwell for 120 min, ramp to 400° C. with 3° C./min rate, dwell for 120 min, ramp to 500° C. with 3° C./min rate, dwell for 120 min, cool to room temperature).
Example 9
Preparation of Zro.SUB.2./La.SUB.2.O.SUB.3 .Core/Shell Nanowires
(621) As an example,
(622) ZrO.sub.2/La.sub.2O.sub.3 nanowires were thus prepared by mixing 20 ml of 2.5e12 pfu E3 Phage solution to 0.1 ml of 0.5M ZrO(NO.sub.3).sub.2 aqueous solution. The solution was incubated under stirring for 16 hours. Any solids formed following incubation were removed by centrifugation at 4000 rpm for 5 minutes and redispersed in 0.5 ml ethanol. A small aliquot was retrieved for TEM characterization.
(623) Thereafter, the ethanol solution was mixed with 10 ml water and 2 ml of 0.05M ZrO(NO.sub.3).sub.2 with 2 ml of 0.1M NH.sub.4OH were added during a period of 200 minutes using syringe pumps. Wash solids with water and resuspend in ethanol for TEM observation.
(624) To about 18 mg of ZrO(OH).sub.2 nanowires in suspension, 10 ml of water was added, followed by the addition of 0.5 ml of LaCl.sub.3 0.083 M with 0.5 ml of NH.sub.4OH 0.3 M solution during a period of 50 minutes using syringe pumps. The solids thus formed were separated by centrifugation to obtain a powder, which was dried in a vacuum oven at 110° C. for one hour. A small aliquot of the dried powder is then suspended in ethanol for TEM observation.
Example 10
Preparation of La(OH).SUB.3./ZRO.SUB.2 .Core/shell Nanowires
(625) Similar to Example 9, La(OH).sub.3 nanowires were coated with ZrO.sub.2 shell according to the following process. To 6.8 mg of La(OH).sub.3 nanowires (prepared by LaCl.sub.3 and NH.sub.4OH in a process similar to that of Example 9), which had been dried at 110° C., was added 4 ml of water to suspend the solids. 0.5 ml of 0.05M ZrO(NO.sub.3).sub.2 and 0.5 ml of 0.1 M NH.sub.4OH were slowly added in 50 minutes. The solids were retrieved by centrifugation and calcined at 500° C. for one hour. TEM observation showed nanowires as the major morphology.
Example 11
Preparation of Hollow-Cored Zro.SUB.2 .Nanowires
(626) To the La(OH).sub.3/ZrO.sub.2 core/shell nanowires prepared Example 10, additional processing can be used to create hollow ZrO.sub.2 shell nanowires. The La(OH).sub.3 core can be etched using 1M citric acid solution. Controlled experiments on calcined and un-calcined La(OH).sub.3 nanowires shows that the entire nanowires are fully etched in about one hour at room temperature. Etching of La(OH).sub.3/ZrO.sub.2 core/shell nanowires was conducted overnight (about 16 hours).
(627) The remaining solid was then separated by centrifugation and TEM observation is conducted on the washed solids (water wash). Low contrast zirconia nanowires were observed after etching, which indicates that hollow zirconia “straws” can be formed using La(OH).sub.3 nanowire as template.
Example 12
Ocm Catalyzed by LA.SUB.2.O.SUB.3 .Nanowires
(628) A 20 mg sample of a phage-based Sr (5%) doped La.sub.2O.sub.3 catalyst was diluted with 80 mg of quartz sand and placed into a reactor (run WPS21). The gas flows were held constant at 9 sccm methane, 3 sccm oxygen and 6 sccm of argon. The upstream temperature (just above the bed) was varied from 500° C. to 800° C. in 100° C. increments and then decreased back down to 600° C. in 50° C. increments. The vent gas analysis was gathered at each temperature level.
(629) As a point of comparison, 20 mg of bulk 5% Sr on La.sub.2O.sub.3 catalyst was diluted in the same manner and run through the exact flow and temperature protocol.
(630)
(631)
(632)
(633) These results confirm that the nanowire catalysts behave differently from their bulk material counterparts. In particular, the nanowire catalysts allow for adjustments of the surface morphologies through synthetic design and screening to ultimately produce high-performance catalysts.
Example 13
Oxidative Dehydrogenation Catalyzed by Mgo Nanowires
(634) A 10 mg sample of phage-based Li doped MgO catalyst was diluted with 90 mg of quartz sand and placed in a reactor. The gas flows were held constant at 8 sccm alkane mix, 2 sccm oxygen and 10 sccm of argon. The upstream temperature (just above the bed) was varied from 500° C. to 750° C. in 50-100° C. increments. The vent gas analysis was gathered at each temperature level.
(635) As a point of comparison, 10 mg of bulk 1 wt % Li on MgO catalyst was diluted in the same manner and run through the exact flow and temperature protocol. The results of this experiment are shown in
Example 14
Synthesis of Sr Doped LA.SUB.2.O.SUB.3 .Nanowires
(636) Sr doped La.sub.2O.sub.3 nanowires were prepared according to the following non-template directed method.
(637) A La(OH).sub.3 gel was prepared by adding 0.395 g of NH.sub.4OH (25%) to 19.2 ml of water followed by addition of 2 ml of a 1 M solution of La(NO.sub.3).sub.3. The solution was then mixed vigorously. The solution first gelled but the viscosity dropped with continuous agitation. The solution was then allowed to stand for a period of between 5 and 10 minutes. The solution was then centrifuged at 10,000 g for 5 minutes. The centrifuged gel was retrieved and washed with 30 ml of water and the centrifugation washing procedure was repeated.
(638) To the washed gel was added 10.8 ml of water to suspend the solid. The suspension was then transferred to a hydrothermal bomb (20 ml volume, not stirred). The hydrothermal bomb was then loaded in a muffle furnace at 160° C. and the solution was allowed to stand under autogenous pressure at 160° C. for 16 hours.
(639) The solids were then isolated by centrifugation at 10,000 g for 5 minutes, and wash with 10 ml of water to yield about 260 mg of solid (after drying for 1 h at 120° C. in a vacuum oven).
(640) A 57 mg aliquot of nanowires was then mixed with 0.174 ml of a 0.1 M solution of Sr(NO.sub.3).sub.2. This mixture was then stirred on a hot plate at 90° C. until a paste was formed.
(641) The paste was then dried for 1 h at 120° C. in a vacuum oven and finally calcined in a muffle oven in air according to the following procedure: (1) load in the furnace at room temperature; (2) ramp to 200° C. with 3° C./min rate; (3) dwell for 120 min; (3) ramp to 400° C. with 3° C./min rate; (4) dwell for 120 min; (5) ramp to 500° C. with 3° C./min rate; and (6) dwell for 120 min. The calcined product was then ground to a fine powder.
(642)
Example 15
Synthesis of LA.SUB.2.O.SUB.3 .Nanowires
(643) La(NO.sub.3).sub.3.6 H.sub.2O (10.825 g) is added to 250 mL distilled water and stirred until all solids are dissolved. Concentrated ammonium hydroxide (4.885 mL) is added to this mixture and stirred for at least one hour resulting in a white gel. This mixture is transferred equally to 5 centrifuge tubes and centrifuged for at least 15 minutes. The supernatant is discarded and each pellet is rinsed with water, centrifuged for at least 15 minutes and the supernatant is again discarded.
(644) The resulting pellets are all combined, suspended in distilled water (125 mL) and heated at 105° C. for 24 hours. The lanthanum hydroxide is isolated by centrifugation and suspended in ethanol (20 mL). The ethanol supernatant is concentrated and the product is dried at 65° C. until all ethanol is removed.
(645) The lanthanum hydroxide nanowires prepared above are calcined by heating at 100° C. for 30 min., 400° C. for 4 hours and then 550° C. for 4 hours to obtain the La.sub.2O.sub.3 nanowires.
Example 16
Preparation of NA.SUB.10.MNW.SUB.5.O.SUB.17 .Nanowires
(646) 25 ml of concentrated reagent grade NH.sub.4OH are dissolved in 25 ml of distilled water, and 1 ml of 0.001M aqueous solution of M13 bacteriophage is then added. 0.62 g of Mn(NO.sub.3).sub.2, 1.01 g of NaCl and 2.00 g of WO.sub.3 are then added to the mixture with stirring. The mixture is heated at a temperature of about 95° C. for 15 minutes. The mixture is then dried overnight at about 110° C. and calcined at about 400° C. for 3 hours.
Example 17
Preparation of NA.SUB.10.MNW.SUB.5.O.SUB.17 .Nanowires
(647) 25 ml of concentrated reagent grade NH.sub.4OH are dissolved in 25 ml of distilled water, and 1 ml of 0.001 M aqueous solution of M13 bacteriophage is then added. 1.01 g of NaCl and 2.00 g of WO.sub.3 are then added to the mixture with stirring. The mixture is heated at a temperature of about 95° C. for 15 minutes. The mixture is then dried overnight at about 110° C. and calcined at about 400° C. for 3 hours. The resulting material is then suspended in 10 ml of distilled water and 0.62 g of Mn(NO.sub.3).sub.2 is added to the mixture with stirring. The mixture is heated at a temperature of about 115° C. for 15 minutes. The mixture is then dried overnight at about 110° C. and calcined at about 400° C. for 3 hours.
Example 18
Preparation of NA.SUB.10.MNW.SUB.5.O.SUB.17./SIO2 Nanowires
(648) Nanowire material Na.sub.10MnW.sub.5O.sub.17 (2.00 g), prepared as described in Example 16 above, is suspended in water, and about 221.20 g of a 40% by weight colloidal dispersion of SiO.sub.2 (silica) is added while stirring. The mixture is heated at about 100° C. until near dryness. The mixture is then dried overnight at about 110° C. and heated under a stream of oxygen gas (i.e., calcined) at about 400° C. for 3 hours. The calcined product is cooled to room temperature and then ground to a 10-30 mesh size.
Example 19
Preparation of LA.SUB.2.O.SUB.3 .Nanowires
(649) Two identical syntheses were made in parallel. In each synthesis, 360 ml of 4 e12 pfu/ml solution of phage (SEQ ID NO: 3) were mixed in a 500 ml plastic bottle with 1.6 ml of 0.1 M LaCl3 aqueous solution and left incubating for at least 1 hour. After this incubation period, a slow multistep addition was conducted with 20 ml of 0.1 M LaCl3 solution and 40 ml of 0.3 M NH4OH. This addition was conducted in 24 hours and 100 steps. The reaction mixture was left stirred for at least another hour at room temperature. After that time the suspension was centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then re-suspended in 25 ml of ethanol. The ethanol suspensions from the two identical syntheses were combined and centrifuged in order to remove un-reacted species. The gel-like product remaining was then dried for 15 hours at 65° C. in an oven and then calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 400° C. with 2° C./min rate, dwell for 240 min, ramp to 550° C. with 2° C./min rate, dwell for 240 min, cool to room temperature).
Example 20
Preparation of Mg/NA Doped LA.SUB.2.O.SUB.3 .Nanowires
(650) Two identical syntheses were made in parallel. In each synthesis, 360 ml of 4 e12 pfu solution of phage (SEQ ID NO: 3) were mixed in a 500 ml plastic bottle with 1.6 ml of 0.1 M LaCl.sub.3 aqueous solution and left incubating for at least 1 hour. After this incubation period, a slow multistep addition was conducted with 20 ml of 0.1 M LaCl.sub.3 solution and 40 ml of 0.3 M NH.sub.4OH. This addition was conducted in 24 hours and 100 steps. The reaction mixture was left stirred for at least another hour at room temperature. After that time, the suspension was centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then resuspended in 25 ml of ethanol. The ethanol suspensions from the two identical syntheses were combined and centrifuged in order to remove un-reacted species. The gel-like product remaining was then dried for 15 hours at 65° C. in an oven.
(651) The target doping level was 20 at % Mg and 5 at % Na at % refers to atomic percent). 182 mg of the dried product were suspended in 2.16 ml deionized water, 0.19 ml 1 M Mg(NO.sub.3).sub.2 aqueous solution and 0.05 ml 1M NaNO.sub.3 aqueous solution. The resulting slurry was stirred at room temperature for 1 hour, sonicated for 5 min, then dried at 120° C. in and oven until the powder was fully dried and finally calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 400° C. with 2° C./min rate, dwell for 60 min, ramp to 550° C. with 2° C./min rate, dwell for 60 min, ramp to 650° C. with 2° C./min rate, dwell for 60 min, ramp to 750° C. with 2° C./min rate, dwell for 240 min, cool to room temperature).
Example 21
Oxidative Coupling of Methane Catalyzed by Mg/NA Doped LA.SUB.2.O.SUB.3 .Nanowires
(652) 50 mg of Mg/Na-doped La.sub.2O.sub.3 nanowires catalyst from example 20 were placed into a reactor tube (4 mm ID diameter quartz tube with a 0.5 mm ID capillary downstream), which was then tested in an Altamira Benchcat 203. The gas flows were held constant at 46 sccm methane and 54 sccm air, which correspond to a CH.sub.4/O.sub.2 ratio of 4 and a feed gas-hour space velocity (GHSV) of about 130000/hour. The reactor temperature was varied from 400° C. to 450° C. in a 50° C. increment, from 450° C. to 550° C. in 25° C. increments and from 550° C. to 750° C. in 50° C. increments. The vent gases were analyzed with gas chromatography (GC) at each temperature level.
(653)
(654) In another example, 50 mg of Mg/Na-doped La.sub.2O.sub.3 nanowires catalyst from example 20 were placed into a reactor tube (4 mm ID diameter quartz tube with a 0.5 mm ID capillary downstream), which was then tested in an Altamira Benchcat 203. The gas flows were held constant at 46 sccm methane and 54 sccm air, which correspond to a feed gas-hour space velocity (GHSV) of about 130000 h.sup.−1. The CH4/O2 ratio was 5.5. The reactor temperature was varied from 400° C. to 450° C. in a 50° C. increment, from 450° C. to 550° C. in a 25° C. increments and from 550° C. to 750° C. in 50° C. increments. The vent gases were analyzed with gas chromatography (GC) at each temperature level.
(655)
Example 22
Nanowire Synthesis
(656) Nanowires may be prepared by hydrothermal synthesis from metal hydroxide gels (made from metal salt+base). In some embodiments, this method is applicable to lanthanides, for example La, Nd, Pr, Sm, Eu, and lanthanide containing mixed oxides.
(657) Alternatively, nanowires can be prepared by synthesis from metal hydroxide gel (made from metal salt+base) under reflux conditions. In some embodiments, this method is applicable to lanthanides, for example La, Nd, Pr, Sm, Eu, and lanthanide containing mixed oxides.
(658) Alternatively, the gel can be aged at room temperature. Certain embodiments of this method are applicable for making magnesium hydroxychloride nanowires, which can be converted to magnesium hydroxide nanowires and eventually to MgO nanowires. In a related method, hydrothermal treatment of the gel instead of aging is used.
(659) Nanowires may also be prepared by polyethyleneglycol assisted hydrothermal synthesis. For example, Mn containing nanowires may be prepared according to this method using methods known to those skilled in the art. Alternatively, hydrothermal synthesis directly from the oxide can be used.
Example 23
Preparation Of Nanowires
(660) Nanostructured catalyst materials can be prepared by a variety of starting materials. In certain embodiments, the rare earth oxides are attractive starting materials since they can be obtained at high purity and are less expensive than the rare earth salt precursors that are typically used in preparative synthesis work. Methods for making rare earth oxide nanowires and derivatives thereof are described below.
(661) Method A: Lanthanide oxide starting material can be hydrothermally treated in the presence of ammonium halide to prepare rare earth oxide nanowires. The preparation is a simple one-pot procedure with high yield. For example, one gram of lanthanum oxide was placed in 10 mL of distilled water. Ammonium chloride (0.98 g) was added to the water, the mixture was placed in an autoclave, and the autoclave was placed in a 160° C. oven for 18 h. The autoclave was taken out of the oven, cooled, and the product was isolated by filtration. Micron and submicron nanowires were observed in the TEM images of the product. This method could also be used to prepare mixed metal oxides, metal oxyhalides, metal oxynitrates, and metal sulfates.
(662) Method B: Metal oxide nanowires can be prepared using a solid-state reaction of rare earth oxide or bismuth oxide in the presence of ammonium halide. The solid-state reaction is used to prepare the rare earth or bismuth oxyhalide. The metal oxyhalide is then placed in water at room temperature and the oxyhalide is slowly converted to metal oxide with nanowire/needle morphology. This method could also be used to prepare mixed metal oxides. For example: lanthanum oxide, bismuth oxide, and ammonium chloride were ground and fired in a ceramic dish to make the mixed lanthanum bismuth oxychloride. The metal oxychloride is then placed in water to form the mixed lanthanum bismuth oxide nanowires.
Example 24
Preparation of Mgo/MN.SUB.2.O.SUB.3 .Core/Shell Nanowires
(663) 19.7 ml of concentrated solution of phages (e.g., SEQ ID NO: 3 at a concentration of ˜5E12 pfu/ml) were mixed in a 20 ml vial with 0.1 ml of 1 M LiOH aqueous solution and left incubating overnight (˜15 h). 0.2 ml of 1 M MgCl.sub.2 aqueous solution were then added using a pipette, and the mixture was mixed by gentle shaking. The reaction mixture was left incubating unstirred for 72 h. After the incubation time, the mixture was centrifuged and the supernatant decanted. The precipitated material was re-suspended in 5 ml of 0.001 M LiOH aqueous solution (pH=11), the mixture was centrifuged and the supernatant decanted.
(664) 19.8 ml of deionized water were added to the obtained Mg(OH).sub.2 nanowires. The mixture was left incubating for 1 h. After the incubation time, 0.2 ml of 1 M MnCl.sub.2 aqueous solution were then added using a pipette and the mixture was mixed by gentle shaking. The reaction mixture was left incubating unstirred for 24 h. After the incubation time, the mixture was centrifuged and the supernatant decanted. The precipitated material was re-suspended in 3 ml of 0.001 M LiOH aqueous solution (pH=11), the mixture was centrifuged and the supernatant decanted. The precipitated material was finally re-suspended in 7 ml ethanol, the mixture was centrifuged and the supernatant decanted.
(665) The obtained MnO(OH) coated Mg(OH).sub.2 nanowires were dried at 65° C. for 15 h in an oven. Finally, the dried product was calcined in a muffle furnace using a step recipe (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 60 min, ramp to 280° C. with 2° C./min rate, dwell for 60 min, ramp to 350° C. with 2° C./min rate, dwell for 60 min, ramp to 450° C. with 2° C./min rate, dwell for 60 min, ramp to 550° C. with 2° C./min rate, dwell for 60 min, cool to room temperature) to convert it to MgO/Mn.sub.2O.sub.3 core-shell nanowires.
(666) The surface area of the nanowires was determined by BET (Brunauer, Emmett, Teller) measurement at 111.5 m.sup.2/g.
Example 25
Preperation of Mn.SUB.2.O.SUB.3 .Nanowires
(667) 3.96 ml of concentrated solution of phages (e.g., SEQ ID NO: 3 at a concentration of ˜5E12 pfu/ml) were mixed in a 8 ml vial with 0.04 ml of 1 M MnCl.sub.2 aqueous solution and left incubating for 20 h. 0.02 ml of 1 M LiOH aqueous solution were then added using a pipette and the mixture was mixed by gentle shaking. The reaction mixture was left incubating unstirred for 72 h. After the incubation time, the mixture was centrifuged, and the supernatant was decanted. The precipitated material was re-suspended in 2 ml of 0.001 M LiOH aqueous solution (pH=11), the mixture was centrifuged and the supernatant decanted. The precipitated material was re-suspended in 2 ml ethanol, the mixture was centrifuged and the supernatant decanted. The obtained MnO(OH) nanowires were dried at 65° C. for 15 h in an oven. Finally, the dried product was calcined in a muffle furnace using a step recipe (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 60 min, ramp to 280° C. with 2° C./min rate, dwell for 60 min, ramp to 350° C. with 2° C./min rate, dwell for 60 min, ramp to 450° C. with 2° C./min rate, dwell for 60 min, ramp to 550° C. with 2° C./min rate, dwell for 60 min, cool to room temperature) to convert it to Mn.sub.2O.sub.3 nanowires.
Example 26
Preparation of V.SUB.2.O.SUB.5 .Nanowires
(668) 1.8 mg of V.sub.2O.sub.5 were dissolved in a 10 ml of a 2.5 wt % aqueous solution of HF. 1 ml of the V.sub.2O.sub.5/HF solution was mixed with 1 ml of concentrated solution of phages (e.g., SEQ ID NO: 3 at a concentration of ˜5E12 pfu/ml) in a 15 ml plastic centrifugation tube and left incubating for 2 h. 1 ml of a saturated solution of boric acid (supernatant of nominally 1 M boric acid aqueous solution) were then added using a pipette and the mixture was mixed by gentle shaking. The reaction mixture was left incubating unstirred for 170 h. After the incubation time, the mixture was centrifuged, and the supernatant was decanted. The precipitated material was suspended in 2 ml ethanol, the mixture was centrifuged and the supernatant decanted. The obtained V.sub.2O.sub.5 nanowires were characterized by TEM.
Example 27
Synthesis Of Mgo Nanowires
(669) 12.5 ml of a 4M MgCl.sub.2 aqueous solution were heated to 70° C. on a hotplate. 0.1 g of MgO (from Aldrich) were then slowly added, over a span of at least 5 minutes, to the solution while it was vigorously stirred. The mixture was kept stirring at 70° C. for 3 h and then cooled down overnight (˜15 h) without stirring.
(670) The obtained gel was transferred in a 25 ml hydrothermal bomb (Parr Bomb No. 4749). The hydrothermal bomb was then loaded in an oven at 120° C. and the solution was allowed to stand under autogenous pressure at 120° C. for 3 hours.
(671) The product was centrifuged and the supernatant decanted. The precipitated product was suspended in about 50 ml ethanol and filtered over a 0.45 μm polypropylene hydrophilic filter using a Büchner funnel. Additional 200 ml ethanol were used to wash the product.
(672) The obtained magnesium hydroxide chloride hydrate nanowires were suspended in 12 ml ethanol and 2.4 ml deionized water in a 20 ml vial. 1.6 ml of 5M NaOH aqueous solution were added and the vial was sealed with its cap. The mixture was then heated at 65° C. in an oven for 15 h.
(673) The product was filtered over a 0.45 μm polypropylene hydrophilic filter using a Büchner funnel. About 250 ml ethanol were used to wash the product. The obtained Mg(OH).sub.2 nanowires were dried at 65° C. for 15 h in an oven. Finally, the dried product was calcined in a muffle furnace using a step recipe (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 60 min, ramp to 280° C. with 2° C./min rate, dwell for 60 min, ramp to 350° C. with 2° C./min rate, dwell for 60 min, ramp to 450° C. with 2° C./min rate, dwell for 60 min, cool to room temperature) to convert it to MgO nanowires.
Example 28
Synthesis of Mg(OH).SUB.2 .Nanowires
(674) 6.8 g of MgCl.sub.2.H2O were dissolved in 5 ml deionized water in a 20 ml vial. 0.4 g of MgO (from Aldrich) were then slowly added to the solution while it was vigorously stirred. The mixture was kept stirring at room temperature until it completely jellified (˜2 h) and then it was left aging for 48 h without stirring.
(675) The gel was transferred in a 50 ml centrifuge tube, which was then filled with deionized water and vigorously shaken until a homogenous suspension was obtained. The suspension was centrifuged and the supernatant decanted. The precipitated product was suspended in about 50 ml ethanol and filtered over a 0.45 μm polypropylene hydrophilic filter using a Büchner funnel. Additional 350 ml ethanol were used to wash the product.
(676) The obtained magnesium hydroxide chloride hydrate nanowires were suspended in 24 ml ethanol in a 50 ml media bottle. The mixture was stirred for a few minutes, then 4.8 ml deionized water and 3.2 ml of 5M NaOH aqueous solution were added. The media bottle was sealed with its cap and the mixture was stirred for few more minutes. The mixture was then heated at 65° C. in an oven for 15 h.
(677) The product was filtered over a 0.45 μm polypropylene hydrophilic filter using a Büchner funnel. About 400 ml ethanol were used to wash the product. The obtained Mg(OH).sub.2 nanowires were dried at 65° C. for 72 h in an oven and then additionally dried at 120° C. for 2 h in a vacuum oven. About 0.697 g of Mg(OH).sub.2 nanowires were obtained and the surface area of the nanowires was determined by BET (Brunauer, Emmett, Teller) measurement at 100.4 m.sup.2/g.
Example 29
Synthesis of Mno/MN.SUB.2.O.SUB.3 .Core/Shell Nanowires
(678) This example describes a method for coating the Mg(OH).sub.2 nanowires from example 28 with MnO(OH).
(679) Three almost identical syntheses were conducted in parallel. In each synthesis, the Mg(OH).sub.2 nanowires, prepared using the method described in example 28 but without the drying steps, were mixed with 250 ml deionized water in a 500 ml plastic bottle and stirred for 20 minutes. 2.4 ml of a 1M MnCl.sub.2 solution were added to the first synthesis, 6 ml of a 1M MnCl.sub.2 solution were added to the second synthesis and 9.6 ml of a 1M MnCl.sub.2 solution were added to the third synthesis. The mixtures were stirred for 2 hours at room temperature. After this incubation period, a slow multistep addition was conducted with 1.2 ml, 3 ml and 4.8 ml of 0.1 M LiOH solution for the first, second and third synthesis, respectively. This addition was conducted in 2 hours and 20 steps. The reaction mixture was left stirred overnight (˜15 h) at room temperature. After that time the suspensions were centrifuged in order to separate the solid phase from the liquid phase. The precipitated materials were then re-suspended in 50 ml of ethanol for each synthesis and filtered over a 0.45 μm polypropylene hydrophilic filter using a Büchner funnel. Additional 350 ml ethanol were used to wash each product of the three synthesis.
(680) The obtained Mg(OH).sub.2/MnO(OH) core/shell nanowires were characterized by TEM before being dried at 65° C. for 72 h in an oven and then additionally dried at 120° C. for 2 h in a vacuum oven. The yield for the three syntheses was 0.675 g, 0.653 g and 0.688 g, respectively. The surface area of the nanowires was determined by BET (Brunauer, Emmett, Teller) measurement at 94.6 m.sup.2/g, 108.8 m.sup.2/g and 108.7 m.sup.2/g, respectively.
(681) The Mg(OH).sub.2/MnO(OH) core/shell nanowires can be converted into MgO/Mn.sub.2O.sub.3 nanowires by calcining them in a muffle furnace using a step recipe (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 60 min, ramp to 280° C. with 2° C./min rate, dwell for 60 min, ramp to 350° C. with 2° C./min rate, dwell for 60 min, ramp to 450° C. with 2° C./min rate, dwell for 60 min, ramp to 550° C. with 2° C./min rate, dwell for 60 min, cool to room temperature).
Example 30
Preparation of Nd.SUB.2.O.SUB.3., Eu.SUB.2.O.SUB.3 .and Pr.SUB.2.O.SUB.3 .Nanowires
(682) Three syntheses were made in parallel. In each synthesis, 10 ml of a 2.5 e12 pfu/ml solution of phage (SEQ ID NO: 14) were mixed in a 60 ml glass vial with 25 μl of 0.08M NdCl.sub.3, EuCl.sub.3 or PrCl.sub.3 aqueous solutions, respectively and left incubating for at least 1 hour. After this incubation period, a slow multistep addition was conducted with 630 μl of 0.08M LaCl.sub.3, EuCl.sub.3 or PrCl.sub.3 aqueous solutions, respectively and 500 μl of 0.3M NH4OH. This addition was conducted in 33 hours and 60 steps. The reaction mixtures were left stirred for at least another 10 hour at room temperature. After that time the suspensions were centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then re-suspended in 4 ml of ethanol. The ethanol suspensions were centrifuged in order to finish removing un-reacted species. The gel-like product remaining was then dried for 1 hours at 65° C. in an oven and then calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 500° C. with 2° C./min rate, dwell for 240 min, cool to room temperature). The obtained Nd(OH).sub.3, Eu(OH).sub.3 and Pr(OH).sub.3 nanowires were characterized by TEM before being dried.
Example 31
Preparation of Ce.SUB.2.O.SUB.3./LA.SUB.2.O.SUB.3 .Mixed Oxide Nanowires
(683) In the synthesis, 15 ml of a 5 e12 pfu/ml solution of phage (SEQ ID NO: 3) were mixed in a 60 ml glass vial with 15 μl of 0.1M La(NO.sub.3).sub.3 aqueous solution and left incubating for about 16 hour. After this incubation period, a slow multistep addition was conducted with 550 μl of 0.2M Ce(NO.sub.3).sub.3 aqueous solution, 950 μl of 0.2M La(NO.sub.3).sub.3 aqueous solution and 1500 μl of 0.4M NH.sub.4OH. This addition was conducted in 39 hours and 60 steps. The reaction mixtures were left stirred for at least another 10 hours at room temperature. After that time the suspensions were centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then re-suspended in 4 ml of ethanol. The ethanol suspensions were centrifuged in order to finish removing un-reacted species. The gel-like product remaining was then dried for 1 hours at 65° C. in an oven and then calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 500° C. with 2° C./min rate, dwell for 120 min, cool to room temperature).
Example 32
Synthesis of Pr.SUB.2.O.SUB.3./LA.SUB.2.O.SUB.3 .Mixed Oxide Nanowires
(684) 0.5 ml of 1M Pr(NO.sub.3).sub.3 aqueous solution and 4.5 ml of 1M La(NO.sub.3).sub.3 aqueous solution were mixed with 40 ml deionized water. Once well mixed, 5 ml of a 3M NH.sub.4OH aqueous solution were quickly injected in the mixture. A precipitate immediately formed. The suspension was kept stirring for another 10 minutes then transferred to centrifuge tubes and centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then re-suspended in 35 ml of deionized water. The solid fraction was separated again by centrifugation and the washing step was repeated one more time. The gel-like product remaining was then dispersed in deionized water and the suspension volume adjusted to 20 ml. The suspension was then transferred to a hydrothermal bomb and placed in an oven at 120° C. for 2 hours. The solids obtained after hydrothermal treatment were then separated by centrifugation and washed once with 35 ml of deionized water. The washed hydrothermally treated powder was then dried at 120° C. for 16 hours. The surface area, determine by BET, of the dried powder was about 41 m.sup.2/g. Transmission electron microscopy was used to characterize the morphology of this sample further. The powder was constituted of large aspect ratio particles with about 30 nm wide by 0.5 to 2 μm length. The powder was calcined in three temperature steps at 200, 400 and 500° C. with 3° C./min ramp and 2 hours of dwell time at each step. The surface area of the Pr.sub.2O.sub.3/La.sub.2O.sub.3 mixed oxide nanowires was about 36 m.sup.2/g.
Example 33
Synthesis of Mgo/EU.SUB.2.O.SUB.3 .Core/Shell Nanowires
(685) In this example, Mg(OH).sub.2 nanowires are used as a support to grow a shell of Eu(OH).sub.3. Mg(OH).sub.2 nanowires, prepared according to the methods described in example 28 (wet product, before being dried) were used to prepare a suspension in deionized water with a concentration of 3 g/l of dried Mg(OH).sub.2. To 30 ml of the Mg(OH).sub.2 suspension, 3 ml of 0.1M Eu(NO.sub.3).sub.3 aqueous solution and 3 ml of 0.3M NH.sub.4OH aqueous solution were added in a slow multistep addition. This addition was conducted in 48 hours and 360 steps. The solids were then separated using centrifugation. The powder is washed with 30 ml DI water and centrifuged again. An aliquot is retrieved prior to calcination for transmission electron miscopy evaluation of the sample morphology. The sample is mainly constituted of high aspect ratio wires with a rough surface. The general morphology of the support is preserved and no separate phase is observed.
(686) The remaining of the powder was dried at 120° C. for 3 hours and calcined in three steps at 200, 400 and 500° C. with 2 hours at each step and a ramp rate of 3° C./min. The surface area, determined by BET, of the MgO/Eu.sub.2O.sub.3 core/shell nanowires is 209 m.sup.2/g.
Example 34
Synthesis pf Y.SUB.2.O.SUB.3./LA.SUB.2.O.SUB.3 .Mixed Oxide Nanowires
(687) 0.5 ml of 1M Y(NO.sub.3).sub.3 aqueous solution and 4.5 ml of 1M La(NO.sub.3).sub.3 aqueous solution were mixed with 40 ml deionized water. Once well mixed, 5 ml of a 3M NH4OH aqueous solution was quickly injected in the mixture. A precipitate immediately forms. The suspension was kept stirring for another 10 minutes then transferred to centrifuge tubes and centrifuged in order to separate the solid phase from the liquid phase. The precipitated material was then re-suspended in 35 ml deionized water. The solid fraction was separated again by centrifugation and the washing step was repeated one more time. The gel-like product remaining was then dispersed in deionized water and the suspension volume adjusted to 20 ml. The suspension was then transferred to a hydrothermal bomb and placed in an oven at 120° C. for 2 hours. The solids obtained after hydrothermal treatment were then separated by centrifugation and washed once with 35 ml of deionized water.
(688) The washed hydrothermally treated powder was then dried at 120° C. for 16 hours. The surface area, determined by BET, of the dried powder is about 20 m2/g. Transmission electron microscopy was used to characterize the morphology of this sample further. The powder was constituted of large aspect ratio particles with about 20 to 40 nm wide by 0.5 to 2 micron length. The Y.sub.2O.sub.3/La.sub.2O.sub.3 mixed oxide nanowires ware calcined in three temperature steps at 200, 400 and 500° C. with 3° C./min ramp and 2 hours of dwell time at each step.
Example 35
Synthesis of La.SUB.2.O.SUB.3 .Nanowires
(689) 1 g of La.sub.2O.sub.3 (13.1 mmol) and 0.92 g of NH.sub.4Cl (18.6 mmol) were placed in a 25 ml stainless steel autoclave with a Teflon liner (Parr Bomb No. 4749). 10 ml deionized water were then added to the dry reactants. The autoclave was sealed and placed in a 160° C. oven for 12 h. After 12 h, the autoclave was allowed to cool. The nanowires were washed several times with 10 mL of water to remove any excess NH.sub.4Cl. The product was then dried in an oven for 15 hours at 65° C. in an oven and then calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 400° C. with 2° C./min rate, dwell for 240 min, ramp to 550° C. with 2° C./min rate, dwell for 240 min, cool to room temperature.)
Example 36
Synthesis of LA.SUB.2.O.SUB.3./ND.SUB.2.O.SUB.3 .Mixed Oxide Nanowires
(690) 0.5 g of La.sub.2O.sub.3 (1.5 mmol), 0.52 g of Nd.sub.2O.sub.3 (1.5 mmol), and 0.325 g of NH.sub.4Cl (6 mmol) were ground together using a mortar and pestle. Once the dry reactants were well mixed, the ground powder was placed in a ceramic crucible and then the crucible was transferred to a tube furnace. The tube furnace atmosphere was flushed with nitrogen for 0.5 h. The reactants were then calcined under nitrogen (25° C.-450° C., 2° C./min ramp, dwell 1 h; 450° C.-900° C.; 2° C./min ramp, 1 h hold, cool to room temperature.) The product (0.2 g) was placed in 10 mL of deionized water and stirred at room temperature for 24 h. The nanowires were then washed several times with deionized H.sub.2O and dried in an oven for 15 hours at 65° C. in an oven and then calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 400° C. with 2° C./min rate, dwell for 240 min, ramp to 550° C. with 2° C./min rate, dwell for 240 min, cool to room temperature.)
Example 37
Oligomerization of Ethylene to Liquid Hydrocarbon Fuels with High Aromatics Content
(691) 0.1 g of the zeolite ZSM-5 is loaded into a fixed bed micro-reactor and heated at 400° C. for 2 h under nitrogen to activate the catalyst. The OCM effluent, containing ethylene and ethane, is reacted over the catalyst at 400° C. at a flow rate of 50 mL/min and GSHV=3000-10000 mL/(g h). The reaction products are separated into liquid and gas components using a cold trap. The gas and liquid components are analyzed by gas chromatography. C5-C10 hydrocarbon liquid fractions, such as xylene and isomers thereof, represent 90% of the liquid product ratio while the C11-C15 hydrocarbon fraction represents the remaining 10% of the product ratio.
Example 38
Oligomerization of Ethylene to Liquid Hydrocarbon Fuels with High Olefins Content
(692) 0.1 g of the zeolite ZSM-5 doped with nickel is loaded into a fixed bed micro-reactor and heated at 350° C. for 2 h under nitrogen to activate the catalyst. The OCM effluent, containing ethylene and ethane, is reacted over the catalyst at 250-400° C. temperature rage with GSHV=1000-10000 mL/(g h). The reaction products are separated into liquid and gas components using a cold trap. The gas and liquid components are analyzed by gas chromatography. C.sub.4-C.sub.10 olefin hydrocarbon liquid fractions, such as butene, hexane and octene represent ≥95% of the liquid product ratio while the C.sub.12-C.sub.18 hydrocarbon fraction represents the remaining 5% of the product ratio. Some trace amounts of odd numbered olefins are also possible in the product.
Example 39
Synthesis of MNWO.SUB.4 .Nanowires
(693) 0.379 g of Na.sub.2WO.sub.4 (0.001 mol) was dissolved in 5 mL of deionized water. 0.197 g of MnCl.sub.2.6H2O (0.001 mol) was dissolved in 2 mL of deionized water. The two solutions were then mixed and a precipitate was observed immediately. The mixture was placed in a stainless steel autoclave with a Teflon liner (Parr Bomb No. 4749). 40 ml of deionized water was added to the reaction mixture and the pH was adjusted to 9.4 with NH4OH. The autoclave was sealed and placed in a 120° C. oven. The reaction was left to react for 18 h and then it was cooled to room temperature. The product was washed with deionized water and then dried in a 65° C. oven. The samples were calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 400° C. with 5° C./min rate, dwell for 2 h, ramp to 850° C. with 5° C./min rate, dwell for 8 h, cool to room temperature).
Example 40
Preparation of Supported MNWO.SUB.4 .Nanowire Catalysts
(694) Supported MnWO.sub.4 nanowires catalysts are prepared using the following general protocol. MnWO.sub.4 nanowires are prepared using the method described in example 42. Manganese tungstate nanowires, support, and water are slurried for 6 h at room temperature. The manganese tungstate to support ratio is 2-10 wt %. The mixture is dried in a 65° C. oven and then calcined in a muffle oven in air: load in the furnace at room temperature, ramp to 400° C. with 5° C./min rate, dwell for 2 h, ramp to 850° C. with 5° C./min rate, dwell for 8 h, cool to room temperature. The following is a list of exemplary supports that may be used: SiO.sub.2, Al.sub.2O.sub.3, SiO.sub.2—Al.sub.2O.sub.3, ZrO.sub.2, TiO.sub.2, HfO.sub.2, Silica-Aluminum Phosphate, and Aluminum Phosphate.
Example 41
Ocm Catalyzed by La.SUB.2.O.SUB.3 .Nanowires
(695) 50 mg of La.sub.2O.sub.3 nanowires catalyst, prepared using the method described in example 19, were placed into a reactor tube (4 mm ID diameter quartz tube with a 0.5 mm ID capillary downstream), which was then tested in an Altamira Benchcat 203. The gas flows were held constant at 46 sccm methane and 54 sccm air, which correspond to a CH4/O2 ratio of 4 and a feed gas-hour space velocity (GHSV) of about 130000/hour. The reactor temperature was varied from 400° C. to 500° C. in a 100° C. increment and from 500° C. to 850° C. in 50° C. increments. The vent gases were analyzed with gas chromatography (GC) at each temperature level.
(696)
Example 42
Synthesis of LA.SUB.2.O.SUB.3 .Nanowires
(697) La.sub.2O.sub.3 (3.1 mmol) and NH.sub.4NO.sub.3 (other lanthanides and different ammonium salts, e.g., Cl or acetate and the like may also be used) (18.6 mmol) were placed in a stainless steel autoclave with a Teflon liner. Water (10 mL) was then added to the dry reactants. The autoclave was sealed and placed in a 160° C. oven for 12 h. After 12 h, the autoclave was allowed to cool (the ammonium acetate catalyzed reaction required 48 h). The nanowires were washed several times with 10 mL of water to remove any excess NH.sub.4NO.sub.3. The product was then dried in an oven for 15 hours at 65° C. and then calcined in a muffle oven in air (load in the furnace at room temperature, ramp to 100° C. with 2° C./min rate, dwell for 30 min, ramp to 400° C. with 2° C./min rate, dwell for 240 min, ramp to 550° C. with 2° C./min rate, dwell for 240 min, cool to room temperature.) Nanowire formation was confirmed by TEM. Calcination by microwave may also be used.
Example 43
Synthesis of LA.SUB.2.O.SUB.3 .Nanowires
(698) La.sub.2O.sub.3 (1.02 g), NH.sub.4NO.sub.3 (1.64 g) and 20 mL of deionized water were added to a round bottom flask equipped with a stir-bar and a reflux condenser. The suspension was refluxed for 18 h. The product was washed with DI water and dried. The product was then calcined in a muffle oven according to the procedure described in Example 42. Nanowire formation was confirmed by TEM. Calcination by microwave may also be used.
Example 44
Purification of Bacteriophage M13 by TFF
(699) In this example, both the microfiltration and the ultrafiltration steps were performed using TFF. A batch of M13 filamentous bacteriophage genetically engineered to express AEEEDP at the N-terminus of the mature pVIII protein (SEQ ID NO: 3) was amplified by incubation with E. coli bacteria. The concentration of the amplified solution was quantified by titration to be 7.7E11 pfu/mL. 890 mL of the solution was purified using the following parameters. For microfiltration, a 0.2 μm nylon flat sheet membrane cartridge was used. Prior to purification the membrane was cleaned and the normalized water flux was verified to be ≥85% of factory rating. Flow parameters of 550 L/hr/m.sup.2 and transmembrane pressure at 15 psi were used. Prior to filtration the cell solution was recirculated for an hour at the same flow and pressure to equilibrate the membrane. Following this recirculation, the amplification culture was concentrated via TFF for ˜4 hrs, until the retentate volume was 100 mL (˜10 times less than original).
(700) The retentate obtained above was diafiltered with approximately 2.5 volumes (270 mL) of Tris buffered saline pH 7.5 (TBS). The TBS filtrate was also collected with the permeate solution, containing the phage. The final yield of phage in the permeate was 2.3% as verified by titration (1007 mL at 1.5E10 pfu/mL). For the ultrafiltration and diafiltration steps a 100 kD polyethersulfone flat sheet membrane cartridge was used. Prior to purification the membrane was cleaned and the normalized water flux was verified to be ≥85% of factory rating. The phage solution clarified through TFF microfiltration as described above was combined with another batch similarly prepared. The combination resulted in a total of 1953 mL of solution of phage at a concentration of 4E9 pfu/mL. Flow parameters of approximately 1640 L/hr/m.sup.2 and a transmembrane pressure of 7 psi were used. The retentate containing the phage product was concentrated 17 times and diafiltered with 10 volumes of deionized water. After sample collection, the system was rinsed through with a volume equivalent to the hold up volume (45 mL). The final yield of phage in the retentate was ˜100% as verified by titration (113 mL, 6.8E10 pfu/mL).
Example 45
Purification of Bacteriophage M13 by Depth Filtration and TFF
(701) In this example, instead of TFF microfiltration, depth filtration was used for the initial step to clarify the amplification phage (SEQ ID NO: 3) culture of bacterial cells, grown similarly as described in Example 44, of bacterial cells and cell debris. The second step to filter out media components and smaller contaminating bacterial cell particles such as proteins was performed with TFF ultrafiltration and diafiltration. 2660 mL of the amplification culture with an initial phage concentration of 1.2E12 pfu/mL was purified using the following parameters. Depth filtration was performed using a path containing two filters, a glass fiber cartridge with a nominal porosity rating of 1.2 μm, followed by a filter with double pleated polyethersulfone membranes, rated at 0.8 μm and 0.45 μm respectively. The filtration was performed at a constant pressure of 7 psi. The yield of phage in the filtrate was 86% (2500 mL 1.1E12 pfu/mL). For the ultrafiltration and diafiltration steps a 500 kD polyethersulfone flat sheet membrane cartridge was used. Prior to purification the membrane was cleaned and the normalized water flux was verified to be 85% of original. 2007 mL of phage purified by depth filtration above (1.1E12 pfu/mL) was purified. Flow parameters of approximately 2200 L/hr/m.sup.2 and a transmembrane pressure of 7 psi were used. The solution was concentrated with the TFF 1 hr and 35 min until ˜180 mL were remaining in the retentate (˜10x concentration). The phage solution was then diafiltered with 2000 mL deionized water with recirculation for approximately one hour. The final volume collected was 156 mL at a concentration of 1.4E13 pfu/mL which corresponds to ˜98% of starting phage material.
Example 46
Preparation of Catalytic Material Comprising Cordierite Honeycomb Ceramic Supported Nd.SUB.2.O.SUB.3 .Nanowires
(702) Nd.sub.2O.sub.3 nanowires were prepared in a manner analogous to Example 14 by substituting La(NO.sub.3).sub.3 with Nd(NO.sub.3).sub.3.
(703) A 400 mg aliquot of Nd.sub.2O.sub.3 nanowires is mixed with 2 g of DI water and placed into a 5 ml glass vial containing 2 mm Yttria Stabilized Zirconia milling balls. The vial is placed on a shaker at 2000 RPM and agitated for 30 minutes. A thick slurry is obtained.
(704) A ⅜ inch diameter core is cut along the channel direction into a 400 CPSI (channel per square inche) cordierite honeycomb monolith and cut in length so the core volume is approximately 1 ml.
(705) The core is placed into a ⅜ inch tube, and the catalyst slurry is fed on top of the ceramic core and pushed with compressed air through the monolith channel. The excess slurry is captured into a 20 ml vial. The coated core is removed from the ⅜ inch tube and placed into a drying oven at 200° C. for 1 hour.
(706) The coating step is repeated twice more time with the remaining slurry followed by drying at 200° C. and calcination at 500° C. for 4 hours. The catalyst amount deposited on the monolith channel walls is approximatively 50 mg and comprises very good adhesion to the ceramic wall.
Example 47
Preparation of Catalytic Material Comprising Silicon Carbide Ceramic Foam Supported Nd.SUB.2.O.SUB.3 .Nanowires
(707) Nd.sub.2O.sub.3 nanowires were prepared in a manner analogous to Example 14 by substituting La(NO.sub.3).sub.3 with Nd(NO.sub.3).sub.3.
(708) A 400 mg aliquot of Nd.sub.2O.sub.3 nanowires is mixed with 2 g of DI water and placed into a 5 ml glass vial containing 2 mm Yttria Stabilized Zirconia milling balls. The vial is placed on a shaker at 2000 RPM and agitated for 30 minutes. A thick slurry is obtained.
(709) A ⅜ inch diameter core is cut from a 65 PPI (Pore Per Inch) SiC foam and cut in length so the core volume is approximately 1 ml.
(710) The core is placed into a ⅜ inch tube and the catalyst slurry is fed on top of the ceramic core and pushed with compressed air through the monolith channel. The excess slurry is captured into a 20 ml vial. The coated core is removed from the ⅜ inch tube and placed into a drying oven at 200° C. for 1 hour.
(711) The coating step is repeated twice more time with the remaining slurry followed by drying at 200° C. and calcination at 500° C. for 4 hours. The catalyst amount deposited on the monolith channel walls is approximatively 60 mg and comprises very good adhesion to the ceramic mesh.
Example 48
Preparation of Catalytic Material Comprising Silicon Carbide and Nd.SUB.2.O.SUB.3 .Nanowires
(712) Nd.sub.2O.sub.3 nanowires were prepared in a manner analogous to Example 14 by substituting La(NO.sub.3).sub.3 with Nd(NO.sub.3).sub.3.
(713) A 400 mg aliquot of Nd.sub.2O.sub.3 nanowires is dry blend mixed with 400 mg of 200-250 mesh SiC particles for 10 minutes or until the mixture appears homogeneous and wire clusters are no longer visible. The mixture is then placed into a ¼ inch die and pressed in 200 mg batches. The pressed pellets are then placed into an oven and calcined at 600° C. for 2 hours. The crush strength of the pellet obtained is comparable to the crush strength of a pellet made with only Nd.sub.2O.sub.3 nanowires.
Example 49
Ocm Activity of Various Nanowire Catalysts
(714) Exemplary nanowire catalysts comprising La.sub.2O.sub.3, Nd.sub.2O.sub.3 or La.sub.3NdO.sub.6 with one, two, three or four different dopants selected from Eu, Na, Sr, Ho, Tm, Zr, Ca, Mg, Sm, W, La, K, Ba, Zn, and Li, were prepared and tested for their OCM activity according to the general procedures described in the above examples. Each of the exemplary catalysts produced a C2 yield above 10%, a C2 selectivity above 50%, and a CH.sub.4 conversion above 20%, when tested as OCM catalysts at 650° C. or lower at pressures ranging from 1 to 10 atm.
Example 50
Preparation of Sr Doped LA.SUB.2.O.SUB.3 .Nanowires
(715) Sr doped La.sub.2O.sub.3 nanowires are prepared according to the following method.
(716) A 57 mg aliquot of La.sub.2O.sub.3 nanowires prepared as described herein is then mixed with 0.174 ml of a 0.1 M solution of Sr(NO.sub.3).sub.2. This mixture is then stirred on a hot plate at 90° C. until a paste was formed.
(717) The paste is then dried for 1 h at 120° C. in a vacuum oven and finally calcined in a muffle oven in air according to the following procedure: (1) load in the furnace at room temperature; (2) ramp to 200° C. with 3° C./min rate; (3) dwell for 120 min; (3) ramp to 400° C. with 3° C./min rate; (4) dwell for 120 min; (5) ramp to 500° C. with 3° C./min rate; and (6) dwell for 120 min. The calcined product is then ground to a fine powder.
(718) The various embodiments described above can be combined to provide further embodiments. All of the U.S. patents, U.S. patent application publications, U.S. patent applications, foreign patents, foreign patent applications and non-patent publications referred to in this specification and/or listed in the Application Data Sheet, are incorporated herein by reference, in their entirety. Aspects of the embodiments can be modified, if necessary to employ concepts of the various patents, applications and publications to provide yet further embodiments. These and other changes can be made to the embodiments in light of the above-detailed description. In general, in the following claims, the terms used should not be construed to limit the claims to the specific embodiments disclosed in the specification and the claims, but should be construed to include all possible embodiments along with the full scope of equivalents to which such claims are entitled. Accordingly, the claims are not limited by the disclosure.