BICARBONATE BIOSENSORS, CALCIUM BIOSENSORS, AND USES THEREOF

20200284811 ยท 2020-09-10

    Inventors

    Cpc classification

    International classification

    Abstract

    The present subject matter provides biosensors for bicarbonate and calcium as well as compositions, devices, and methods comprising such biosensors.

    Claims

    1. A biosensor for a ligand, comprising a ligand-binding protein and a reporter group that transduces a detectable signal, wherein the reporter group is attached to the ligand-binding protein so that a signal transduced by the reporter group when the ligand-binding protein to ligand differs from a signal transduced by the reporter group when the ligand-binding protein is not bound to ligand, wherein the ligand comprises bicarbonate or Ca.sup.2+, and wherein the ligand-binding protein does not comprise an enzyme.

    2. The biosensor of claim 1, wherein the ligand-binding protein comprises amino acids in the sequence set forth as SEQ ID NO: 64, 53, or 38, and wherein Pacific Blue or Badan is attached to a cysteine of said ligand-binding protein.

    3. (canceled)

    4. The biosensor of claim 1, wherein the ligand-binding protein comprises a mutation compared to a naturally occurring protein, wherein at least one amino acid of the naturally occurring protein has been substituted with a cysteine.

    5. The biosensor of claim 1, wherein the ligand-binding protein comprises a mutation compared to a naturally occurring protein, wherein the ligand-binding protein has no deletions or insertions compared to the naturally occurring protein.

    6. The biosensor of claim 1, wherein the ligand-binding protein comprises a mutation compared to a naturally occurring protein, wherein the ligand-binding protein comprises (i) less than about 5, 4, 3, 2, or 1 inserted amino acids, and/or (ii) less than about 5, 4, 3, 2, or 1 deleted amino acids compared to the naturally occurring protein.

    7. The biosensor of claim 1, wherein the ligand-binding protein comprises a mutant of a microbial bicarbonate-binding protein.

    8. The biosensor of claim 7, wherein the mutant comprises a mutation that alters the mutant's affinity and/or specificity for bicarbonate or Ca.sup.2+ compared to the microbial bicarbonate-binding protein.

    9. (canceled)

    10. (canceled)

    11. The biosensor of claim 1, wherein the ligand-binding protein comprises or comprises a mutant of: a Synechocystis sp. bicarbonate-binding protein, a mutant of a Thermosynechococcus sp. bicarbonate-binding protein, a mutant of a Chroococcidiopsis sp. bicarbonate-binding protein, a mutant of a Calothrix sp. bicarbonate-binding protein, a mutant of a Anabaena sp. bicarbonate-binding protein, or a mutant of a Chamaesiphon sp. bicarbonate-binding protein.

    12. The biosensor of claim 1, wherein the ligand-binding protein comprises or comprises a mutant of: a bicarbonate-binding protein from Synechocystis sp. (synBicarbBP1l; SEQ ID NO: 1, 15, or 75); a bicarbonate-binding protein from Thermosyneochococcus elongatus (teBicarbBP2; SEQ ID NO: 2, 16, or 76); a bicarbonate-binding protein from Chroococcidiopsis thermalis (ctBicarbBP3; SEQ ID NO: 3, 17, or 77); a bicarbonate-binding protein from Calothrix sp. (calBicarbBP4; SEQ ID NO: 4, 18, or 78); a bicarbonate-binding protein from Anabaena variabilis (avBicarbBP5; SEQ ID NO: 5, 19, or 79); or a bicarbonate-binding protein from Chamaesiphon minutus (cmBicarbBP6; SEQ ID NO: 6, 20, or 80).

    13. The biosensor of claim 1, wherein the ligand-binding protein comprises an amino acid sequence that is between 10% and 100% identical to the amino acid sequence of synBicarbBP1, teBicarbBP2, ctBicarbBP3, calBicarbBP4, avBicarbBP5, or cmBicarbBP6.

    14.-18. (canceled)

    19. The biosensor of claim 7, wherein said microbial-bicarbonate-binding protein comprises a ferric-bicarbonate binding protein.

    20. The biosensor of claim 1, wherein the ligand-binding protein comprises or comprises a mutant of: a Mannheimia sp. bicarbonate and iron binding protein, a mutant of an Exiguobacterium sp. bicarbonate and iron binding protein, a mutant of a Thermosynechococcus sp. bicarbonate and iron binding protein, a mutant of a Candidatus Nitrospira sp. bicarbonate and iron binding protein, a mutant of a Thermus sp. bicarbonate and iron binding protein, a mutant of a Meiothermus sp. bicarbonate and iron binding protein, a mutant of a Salinibacter sp. bicarbonate and iron binding protein, or a mutant of a Halorubrum sp. bicarbonate and iron binding protein.

    21. The biosensor of claim 1, wherein the ligand-binding protein comprises or comprises a mutant of: a bicarbonate and iron binding protein from Mannheimia haemolytica (mhFeBP1; SEQ ID NO: 7, 21, or 81); a bicarbonate and iron binding protein from Exiguobacterium sp. (exiFeBP2; SEQ ID NO: 8, 22, or 82); a bicarbonate and iron binding protein from Thermosynechoccus elongatus (teFeBP3; SEQ ID NO: 9, 23, or 83); a bicarbonate and iron binding protein from Candidatus nitrospira (cnFeBP4; SEQ ID NO: 10, 24, or 84); a bicarbonate and iron binding protein from Thermus thermophilus (ttFeBP5; SEQ ID NO: 11, 25, or 85); a bicarbonate and iron binding protein from Meiothermus silvanus (msFeBP6; SEQ ID NO: 12, 26, or 86); a bicarbonate and iron binding protein from Salinibacter ruber (srFeBP7; SEQ ID NO: 13, 27, or 87); or a bicarbonate and iron binding protein from Halorubrum lacusprofundi (hlFeBP8; SEQ ID NO: 14, 28, or 88).

    22. The biosensor of claim 1, wherein the ligand-binding protein comprises an amino acid sequence that is between 10% and 100% identical to the amino acid sequence of mhFeBP1, exiFeBP2, teFeBP3, cnFeBP4, ttFeBP5, msFeBP6, srFeBP7, or hlFeBP8.

    23.-27. (canceled)

    28. The biosensor of claim 1, wherein the Ca root-mean-square deviation (RMSD) between the backbone of the ligand-binding protein and synBicarbBP1, teBicarbBP2, ctBicarbBP3, calBicarbBP4, avBicarbBP5, cmBicarbBP6, mhFeBP1, exiFeBP2, teFeBP3, cnFeBP4, ttFeBP5, msFeBP6, srFeBP7, or hlFeBP8 is between about 0-3 , 0-1 , 0-1.5 , 0-2 , 0.1-3 , 0.5-1 , 0.5-1.5 , or 0.5-2 , or less than about 0.1 , 0.2 , 0.3 , 0.4 , 0.5 , 0.6 , 0.7 , 0.8 , 0.9 , 1.0 , 1.5 , 1.6 , 1.7 , 1.8 , 1.9 , 2.0 , 2.5 , or 3 .

    29.-32. (canceled)

    33. The biosensor of claim 1, wherein the ligand-binding protein is a mutant of avBicarbBP5 comprising one or more of the following substitutions: I16X, P17X, I18X, W49X, Q71X, C96X, F140X, T141X, F142X, P143X, N146X, T190X, and W194X, wherein X is any amino acid, an amino acid that results in a conservative substitution, or a cysteine, and where each position is counted in avBicarbBP5 with the signal peptide replaced with a methionine (SEQ ID NO: 19 or 79).

    34.-36. (canceled)

    37. The biosensor of claim 1, wherein the ligand-binding protein is a mutant of teFeBP3 comprising one or more of the following substitutions: A8X, H10X, D12X, T13X, E35X, A36X, V58X, R135X, N139X, 1140X, N176X, C184X, N195X, N268X, and E270X, where X is any amino acid, an amino acid that results in a conservative substitution, or a cysteine, and where each position is counted in teFeBP3 with the signal peptide replaced with a methionine (SEQ ID NO: 23 or 83).

    38.-42. (canceled)

    43. The biosensor of claim 1, wherein the reporter group is covalently attached to the ligand-binding protein.

    44.-46. (canceled)

    47. The biosensor of claim 1, wherein the reporter group is conjugated to a cysteine of the ligand-binding protein.

    48. (canceled)

    49. The biosensor of claim 1, wherein the reporter group comprises a fluorophore.

    50.-63. (canceled)

    64. A method of detecting the presence or concentration of a ligand in a sample, the method comprising: (a) contacting the biosensor of claim 1 with the sample; (b) measuring a signal from the biosensor; and (c) comparing the signal to a ligand control value, wherein a difference in signal indicates the presence of ligand in the sample.

    65.-90. (canceled)

    91. A method for monitoring the level of a ligand in a subject, comprising (a) administering a biosensor according to claim 1 or a device comprising a biosensor according to claim 1 to the subject, wherein after administration the biosensor is in contact with a bodily fluid or surface of the subject, and (b) detecting (i) a signal produced by a reporter group of the biosensor continuously or repeatedly at intervals less than about 30 minutes apart, and/or (ii) whether a signal is produced by a reporter group of the biosensor continuously or repeatedly at intervals less than about 30 minutes apart.

    92.-139. (canceled)

    Description

    DESCRIPTION OF THE DRAWINGS

    [0399] FIG. 1A is a cartoon and FIGS. 1B-D are graphs illustrating fluorescently responsive sensors. FIG. 1A: FRSs can be constructed by site-specifically attaching a fluorophore to a protein that undergoes a conformational change upon binding ligand (triangle) in a location between the two lobes of the protein (periplasmic binding protein or engineered derivative thereof), such that the shape and intensities of the fluorescent conjugate emission spectra changes. FIG. 1B: In the absence of ligand, the emitted fluorescence color is predominantly blue, whereas the ligand complex fluoresces green. Arrows indicate the direction of change upon ligand addition. FIG. 1C: The ligand dependence of the absolute blue and green intensities. FIG. 1D: The ratio of the blue and green emission intensities enables ligand binding to be determined.

    [0400] FIG. 2 is a diagram of the bicarbonate buffering system establishes the equilibria between carbon dioxide (CO.sub.2), carbonic acid (H.sub.2CO.sub.3), hydrogen ions and bicarbonate (HCO.sub.3.sup.). This system is essential for maintaining the physiological acid-base balance.

    [0401] FIG. 3A shows the structure of the bicarbonate-binding protein from Synechocyslis PCC 6803, synBicarbBP1 [PDB identifier 2i4c (Koropatkin 2007)]. The three dimensional structure is shown. Arrows point to bicarbonate, and Ca.sup.2+, and residues of the primary complementary surface; small gray spheres show the location of cysteine mutations. FIG. 3B: Ca.sup.2+ coordination. The calcium coordination sphere forms a typical pentagonal bipyramid, with a bidentate contribution from the bound bicarbonate. FIG. 3C: Residues involved in binding of HCO.sub.3.sup. and Ca.sup.2+. The PCS sequence filter used to identify the subset of bicarbonate-calcium binding proteins within a family of sequence synBicarbBP1 homologs. Residue numbering according to PDB accession 2i4c (SEQ ID NO: 166).

    [0402] FIGS. 4A and B show the structures of the bicarbonate-binding proteins. Arrows point to Fe.sup.III, bicarbonate, and residues of the primary complementary surface. FIG. 4A: structure of the Mannheimia haemolytica bicarbonate-binding protein. FIG. 4B: structure of the Thermus thermophilus bicarbonate-binding protein. FIG. 4C: The PCS sequence filter used to identify bicarbonate binding protein. The 1SI0 seed sequence (corresponding to mhFeBP1; SEQ ID NO: 167) and the 4ELR seed sequence (corresponding to ttFeBP5; SEQ ID NO: 168) were used.

    [0403] FIG. 5 shows an alignment of selected sequence hits using Synechocystic PCC 6803 as seed, with a PCS defined by its structure (PDB accession 2i4c; sequence numbering according to PDB file). Leader peptide and PCS positions indicated in gray. Ca.sup.23-coordinating residues underlined.

    [0404] FIGS. 6A and B show alignments of FeHCO.sub.3 binding proteins. FIG. 6A: Seed is Mannheimia haemolytica FeHCO.sub.3 binding protein (sequence numbering and secondary structure assignments according to PDB accession 1si0). FIG. 6B: Seed is Thermus thermophilus FeHCO.sub.3 binding protein (sequence numbering and secondary structure assignments according to PDB accession 4elr). Leader peptide sequences removed in expression constructs and PCS residues are highlighted. Tyrosine residues participating in iron coordination are underlined. Note the difference in the location of the tyrosine in helix B. In the mhFeBP1 homologs it is located at the N-terminus of that helix: in the tthFeBP5 homologs it is located two residues ( helical turn) in from the N-terminus.

    [0405] FIGS. 7A-C are graphs showing the fluorescent response of avBicarbBP5 194CPacific Blue, ZifOregon Green to bicarbonate in the presence of CaCl.sub.2 (1 mM). FIG. 7A: Corrected emission spectra (purple line, no bicarbonate: red line, 700 mM bicarbonate: black lines, intermediate bicarbonate concentrations). FIG. 7B: Dichromatic signal (.sub.1=455 nm, .sub.2=519 nm; black circles, experimental data points; gray lines, fit to binding isotherm, .sup.appK.sub.d=24 mM). FIG. 7C: Monochromatic signal (gray, 455 nm data points and fit: black, 519 nm data points and fit: .sup.trueK.sub.d=61 mM).

    [0406] FIGS. 8A-C are graphs showing the fluorescent response of teFeBP3 270CBadan to bicarbonate. FIG. 8A: Corrected emission spectra (purple line, no bicarbonate: red line, 700 mM bicarbonate: black lines, intermediate bicarbonate concentrations). FIG. 8B: Dichromatic signal (.sub.1=455 nm, .sub.2=489 nm: black circles, experimental data points; gray lines, fit to binding isotherm, .sup.appK.sub.d=48 mM). FIG. 8C: Monochromatic signal (blue, 455 nm data points and fit: black, 489 nm data points and fit; .sup.trueK.sub.d=35 mM).

    [0407] FIGS. 9A-C are graphs showing the fluorescent response of avBicarbBP5 18CBadan to calcium. FIG. 9A: Corrected emission spectra Arrows indicate direction of change with increased calcium concentration FIG. 9B: Monochromatic signal (green, 489 nm data points and fit; blue, 525 nm data points and fit; .sup.trueK.sub.d=1.0 mM). FIG. 9C: Dichromatic signal (.sub.1=489 nm, .sub.2=525 nm: blue circles, experimental data points; red/green lines, fit to binding isotherm. .sup.appK.sub.d=0.62 mM).

    [0408] FIGS. 10A-C are graphs showing that the avBicarb5 18C, 16FPacific Blue, Zif5-IAF conjugate exhibits a dichromatic response to bicarbonate in the presence of CaCl.sub.2 (1 mM). FIG. 10A: Emission spectra. Arrows, change in intensity with increased bicarbonate concentration. FIG. 10B: Monochromatic signal (blue, 445 nm data points and fit; green, 517 nm data points and fit; .sup.trueK.sub.d=20 mM). FIG. 10C: Dichromatic signal (.sub.1=445 nm, .sub.2=517 nm; blue circles, experimental data points; red/green lines, fit to binding isotherm, .sup.appK.sub.d=15 mM).

    [0409] FIGS. 11A-C are graphs showing that the avBicarb5 16F18CPacific Blue-Zif5-IAF doubly labeled conjugate exhibits a dichromatic response to Ca.sup.2+. FIG. 11A: Emission spectra. Arrows, change in intensity with increased CaCl.sub.2 concentration. FIG. 11B: Monochromatic signal (blue, 455 nm data points and fit; green, 520 nm data points and fit; .sup.trueK.sub.d=1.1 mM). FIG. 11C: Dichromatic signal (.sub.1=445 nm, .sub.2=520 nm; blue circles, experimental data points: red/green lines, fit to binding isotherm, .sup.appK.sub.d=0.96 mM).

    [0410] FIGS. 12A-C are diagrams showing three dominant factors that affect ngmFRET between donor and acceptors in which one partner responds to ligand binding. FIG. 12A: Simplified Jablonski diagram illustrating radiative and non-radiative pathways in the donor and acceptor. The donor excited state (D*) is formed through illumination by the excitation source (wavy arrow) whereas the acceptor excited state (A*) is formed by resonance energy transfer (dashed arrow). The fluorescence intensity is determined by the ratio of radiative decay (gray arrows) of the excited states (gray lines) to the ground state (black line) relative to all non-radiative processes (black arrows), and the resonance energy transfer rate, k.sub.t, from donor to acceptor. FIG. 12B: Inter-dipole geometry. Top, FRET efficiency (f=Q.sub.r/(Q.sub.0Q.sub.), where the Q.sub.r, Q.sub.0, Q.sub. are the quantum efficiencies at distances r, closest approach, and infinity, respectively) varies as the 6.sup.th power of the distance between two dipoles. Bottom, FRET efficiency varies as the square of the orientation factor , where =sin .sub.D sin .sub.A cos 2 cos .sub.D cos .sub.A with .sub.D and .sub.A the angles of the donor (blue) and acceptor (red) electronic transition dipoles with the line connecting them, and x the angle between the planes within which they lie. FIG. 12C: Spectral overlap (gray area) between the donor fluorescence emission (.sup.DI, blue) and acceptor fluorescence excitation (A, black) spectra. This overlap increases with bathochromic or hypsochromic shifts of the donor emission (red arrow) and acceptor excitation (dotted blue arrow) spectra, respectively. Shifts in the opposite directions decreases spectral overlap.

    [0411] FIG. 13 shows the sequence of an exemplary synBicarbBP1 expression construct (SEQ ID NO: 95).

    [0412] FIG. 14 shows the sequence of an exemplary teBicarbBP2 expression construct (SEQ ID NO: 96).

    [0413] FIG. 15 shows the sequence of an exemplary ctBicarbBP3 expression construct (SEQ ID NO: 97).

    [0414] FIG. 16 shows the sequence of an exemplary calBicarbBP4 expression construct (SEQ ID NO: 98).

    [0415] FIG. 17 shows the sequence of an exemplary avBicarbBP5 expression construct (SEQ ID NO: 99).

    [0416] FIG. 18 shows the sequence of an exemplary cmBicarbBP6 expression construct (SEQ ID NO: 100).

    [0417] FIG. 19 shows the sequence of an exemplary mhFeBP1 expression construct (SEQ ID NO: 101).

    [0418] FIG. 20 shows the sequence of an exemplary exiFeBP2 expression construct (SEQ ID NO: 102).

    [0419] FIG. 21 shows the sequence of an exemplary teFeBP3 expression construct (SEQ ID NO: 103).

    [0420] FIG. 22 shows the sequence of an exemplary cnFeBP4 expression construct (SEQ ID NO: 104).

    [0421] FIG. 23 shows the sequence of an exemplary ttFeBP5 expression construct (SEQ ID NO: 105).

    [0422] FIG. 24 shows the sequence of an exemplary msFeBP6 expression construct (SEQ ID NO: 106).

    [0423] FIG. 25 shows the sequence of an exemplary srFeBP7 expression construct (SEQ ID NO: 107).

    [0424] FIG. 26 shows the sequence of an exemplary hlFeBP8 expression construct (SEQ ID NO: 108).

    [0425] FIG. 27 shows the sequence of an exemplary avBicarBP5_16C expression construct (SEQ ID NO: 109).

    [0426] FIG. 28 shows the sequence of an exemplary avBicarBP5_17C expression construct (SEQ ID NO: 110).

    [0427] FIG. 29 shows the sequence of an exemplary avBicarBP5_18C expression construct (SEQ ID NO: 111).

    [0428] FIG. 30 shows the sequence of an exemplary avBicarBP5_49C expression construct (SEQ ID NO: 112).

    [0429] FIG. 31 shows the sequence of an exemplary avBicarBP5_71C expression construct (SEQ ID NO: 113).

    [0430] FIG. 32 shows the sequence of an exemplary avBicarBP5_140C expression construct (SEQ ID NO: 114).

    [0431] FIG. 33 shows the sequence of an exemplary avBicarBP5_141C expression construct (SEQ ID NO: 115).

    [0432] FIG. 34 shows the sequence of an exemplary avBicarBP5_142C expression construct (SEQ ID NO: 116).

    [0433] FIG. 35 shows the sequence of an exemplary avBicarBP5_143C expression construct (SEQ ID NO: 117).

    [0434] FIG. 36 shows the sequence of an exemplary avBicarBP5_146C expression construct (SEQ ID NO: 118).

    [0435] FIG. 37 shows the sequence of an exemplary avBicarBP5_190C expression construct (SEQ ID NO: 119).

    [0436] FIG. 38 shows the sequence of an exemplary avBicarBP5_194C expression construct (SEQ ID NO: 120).

    [0437] FIG. 39 shows the sequence of an exemplary teFeBP3_A8C expression construct (SEQ ID NO: 121).

    [0438] FIG. 40 shows the sequence of an exemplary teFeBP3_H10C expression construct (SEQ ID NO: 122).

    [0439] FIG. 41 shows the sequence of an exemplary teFeBP3_D12C expression construct (SEQ ID NO: 123).

    [0440] FIG. 42 shows the sequence of an exemplary teFeBP3_T13C expression construct (SEQ ID NO: 124).

    [0441] FIG. 43 shows the sequence of an exemplary teFeBP3_A36C expression construct (SEQ ID NO: 125).

    [0442] FIG. 44 shows the sequence of an exemplary teFeBP3_V58C expression construct (SEQ ID NO: 126).

    [0443] FIG. 45 shows the sequence of an exemplary teFeBP3_R135C expression construct (SEQ ID NO: 127).

    [0444] FIG. 46 shows the sequence of an exemplary teFeBP3_NI 39C expression construct (SEQ ID NO: 128).

    [0445] FIG. 47 shows the sequence of an exemplary teFeBP3_I140C expression construct (SEQ ID NO: 129).

    [0446] FIG. 48 shows the sequence of an exemplary teFeBP3_N176C expression construct (SEQ ID NO: 130).

    [0447] FIG. 49 shows the sequence of an exemplary teFeBP3_N195C expression construct (SEQ ID NO: 131).

    [0448] FIG. 50 shows the sequence of an exemplary teFeBP3_N268C expression construct (SEQ ID NO: 132).

    [0449] FIG. 51 shows the sequence of an exemplary teFeBP3_E270C expression construct (SEQ ID NO: 133).

    [0450] FIG. 52 shows the sequence of an exemplary avBicarbBP5_16C_bZif expression construct (SEQ ID NO: 134).

    [0451] FIG. 53 shows the sequence of an exemplary avBicarbBP5_17C_bZif expression construct (SEQ ID NO: 135).

    [0452] FIG. 54 shows the sequence of an exemplary avBicarbBP5_18C_bZif expression construct (SEQ ID NO: 136).

    [0453] FIG. 55 shows the sequence of an exemplary avBicarbBP5_190C_bZif expression construct (SEQ ID NO: 137).

    [0454] FIG. 56 shows the sequence of an exemplary avBicarbBP5_194C_bZif expression construct (SEQ ID NO: 138).

    [0455] FIG. 57 shows the sequence of an exemplary avBicarbBP5_16C_71 D_bZif expression construct (SEQ ID NO: 139).

    [0456] FIG. 58 shows the sequence of an exemplary avBicarbBP5_16C_71N_bZif expression construct (SEQ ID NO: 140).

    [0457] FIG. 59 shows the sequence of an exemplar) avBicarbBP5_16C_71E_bZif expression construct (SEQ ID NO: 141).

    [0458] FIG. 60 shows the sequence of an exemplary avBicarbBP5_16C_71M_bZif expression construct (SEQ ID NO: 142).

    [0459] FIG. 61 shows the sequence of an exemplary avBicarbBP5_18C_16M_bZif expression construct (SEQ ID NO: 143).

    [0460] FIG. 62 shows the sequence of an exemplary avBicarbBP5_18C_16F_bZif expression construct (SEQ ID NO: 144).

    [0461] FIG. 63 shows the sequence of an exemplary avBicarbBP5_18C_16Y_bZif expression construct (SEQ ID NO: 145).

    [0462] FIG. 64 shows the sequence of an exemplary avBicarbBP5_18C_16W_bZif expression construct (SEQ ID NO: 146).

    [0463] FIG. 65 shows the sequence of an exemplary avBicarbBP5_18C_16E_bZif expression construct (SEQ ID NO: 147).

    [0464] FIG. 66 shows the sequence of an exemplar) avBicarbBP5_18C_49F_bZif expression construct (SEQ ID NO: 148).

    [0465] FIG. 67 shows the sequence of an exemplary avBicarbBP5_18C_49Y_bZif expression construct (SEQ ID NO: 149).

    [0466] FIG. 68 shows the sequence of an exemplary avBicarbBP5_18C_141V_bZif expression construct (SEQ ID NO: 150).

    [0467] FIG. 69 shows the sequence of an exemplary avBicarbBP5_18C_141F_bZif expression construct (SEQ ID NO: 151).

    [0468] FIG. 70 shows the sequence of an exemplary avBicarbBP5_18C_141Y_bZif expression construct (SEQ ID NO: 152).

    [0469] FIG. 71 shows the sequence of an exemplary avBicarbBP5_18C_141W_bZif expression construct (SEQ ID NO: 153).

    [0470] FIG. 72 shows the sequence of an exemplary avBicarbBP5_18C_141Q_bZif expression construct (SEQ ID NO: 154).

    [0471] FIG. 73 are illustrations of fluorophore structures. Naphthalene family (arrows indicate known or potential internal twists): FIG. 73A shows Acrylodan: FIG. 73B shows Badan: FIG. 73C shows IAEDANS. Xanthene family: FIG. 73D shows Fluorescein (5-IAF and 6-IAF); FIG. 73E shows Oregon Green; FIG. 73F shows Alexa 432: FIG. 73G shows Alexa532: FIG. 73H shows Alexa 546; FIG. 73I shows Texas Red. Coumarin family: FIG. 73J shows Pacific Blue: FIG. 73K shows CPM. Benzoxadiazole family: FIG. 73L shows IANBD. Boradiazaindacine (BODIPY) family: FIG. 73M shows BODIPY 499/508; FIG. 73N shows BODIPY 507/545. Cyanine family: FIG. 73O shows Cy5. Miscellaneous: FIG. 73P shows PyMPO.

    [0472] FIG. 74 is a diagram relating to directly responsive partners and indirectly responsive partners in ngmFRET pathways.

    DETAILED DESCRIPTION

    [0473] Fluorescently responsive sensors (FRSs) based on engineered proteins that couple ligand-binding events to changes in the emission properties of fluorophores (being fluorescent by themselves and regardless of the presence of any other fluorophore/partner) or semi-synthetically incorporated chromophores have wide-ranging applications in cell biology and analytical chemistry. If the fluorescence emission spectrum of an engineered FRS changes shape in response to ligand binding such that the ratio of intensities at two appropriately chosen wavelengths reports on ligand concentration (dichromatic response), then ratiometric measurements can be used to monitor analyte concentrations. Ratiometry is essential for devices that rely on changes in fluorescence emission intensities, because it provides an internally consistent reference. The self-calibrating nature of a ratiometric measurement removes the necessity for carrying out on-board calibration tests prior to each measurement, obviating the need for multiple components and fluidic circuitry. Accordingly, reagentless, ratiometric fluorescent sensors have many uses in process engineering, environmental or clinical chemistry, including single-use point-of-care applications, wearable devices, or implanted tattoos that are interrogated transdermally.

    [0474] The periplasmic binding protein (PBP) superfamily provide a rich source of FRSs, because PBPs combine a large diversity of ligand specificities with a common structural mechanism that is well suited to the construction of fluorescence signal transduction schemes. The three-dimensional PBP monomer structure comprises two / domains linked by a -strand hinge. Binding of ligand is accompanied by a large hinge-bending motion that transitions the protein from an open to a closed state in which the ligand is enveloped within a cleft between the two domains. Semi-synthetic FRSs can be engineered with PBPs by site-specifically attaching single, thiol-reactive, environmentally sensitive fluorophores that respond to the ligand-mediated conformational change (FIGS. 1A-D). Semisynthetic, fluorescently labeled glucose-binding proteins in the periplasmic binding protein superfamily have been engineered successfully as reagentless, ratiometric glucose biosensors that can be used for point-of-care diagnostics and in vivo continuous glucose monitoring applications.

    [0475] Here we present the construction of reagentless, ratiometric, fluorescent bicarbonate and calcium sensors based on engineered periplasmic binding proteins. There are two known classes of bicarbonate-binding proteins in the PBP superfamily. Both bind bicarbonate as a metal complex: either as calcium-bicarbonate, or as iron (Fe.sup.III)-bicarbonate. The Ca.sup.IIHCO.sub.3 binding proteins typically are found in photosynthetic bacteria where they participate in HCO.sub.3.sup. uptake processes for conversion into and fixation of CO.sub.2 in carboxysomes (Price 2008), whereas the Fe.sup.IIIHCO.sub.3 binding proteins are more wide-spread and participate in bacterial iron uptake systems (Siburt 2012). We have converted and optimized a representative member of each class into bicarbonate sensors, and optimized their performance for sensing in the clinically relevant bicarbonate concentration range (20-30 mM): the Ca.sup.IIHCO.sub.3 binding protein from Anabaena variabilis (avBicarbBP5), and the Fe.sup.IIIHCO.sub.3 binding protein from Thermosynechococcus elongatus (teFBP3). We further engineered the Ca.sup.IIHCO.sub.3 binding protein into a sensor for ionized calcium. Ca.sup.2+, with optimal performance in the 1 mM concentration range, required for sensing Ca.sup.2+ in clinical samples.

    [0476] Bicarbonate is an essential component for maintaining acid-base homeostasis in blood (Warrel 2010) (FIG. 2). The clinical reference range for bicarbonate is 20-30 mM (Burtis 2012). Various acidosis and alkalosis conditions alter this concentration. Together with the blood pH, determination of the concentration of this important buffer therefore provides information on the pathogenesis of the imbalance (Warrel 2010). Clinical automation instrumentation uses either sample acidification in combination with a CO.sub.2-selective electrode, or alkalinization followed by a colorimetric coupled enzyme assay (Burtis 2012). The fluorescent sensors presented here offer a significantly simpler measurement principle.

    [0477] There are three major forms of extracellular calcium in blood: bound to protein (albumin), complexed to phosphate or citrate, and the free Ca.sup.2+ ion (Warrel 2010). The concentration of free Ca.sup.2+ is tightly regulated in the 1.2-1.3 mM range (Burtis 2012). Deviations from this range are indicative of various diseases: ionized Ca.sup.2+ determination therefore is a common clinical chemistry test (Burtis 2012). Because of the importance of Ca.sup.2+ in intracellular biochemical signaling mechanisms, many fluorescent indicators have been developed for measuring intracellular Ca.sup.2+ levels (Valeur 2012). These are tuned for the micromolar range and therefore are not appropriate for measuring extracellular levels. By contrast, the construction of semi-synthetic Ca.sup.2+ biosensors based on engineered avBicarbBP5, tuned for the 0.5-10 mM range provide fluorescent sensors that are appropriate for clinical chemistry applications.

    Biosensors

    [0478] Biosensors are molecular recognition elements that transduce ligand-binding events into physical signals. Biosensors as detailed herein bind at least one ligand and emit a signal. A ligand-bound biosensor results in a signal that is different from the unbound biosensor. This difference facilitates detection of the at least one ligand and/or determination of ligand concentration. The biosensors may be used without the assistance of other reagents.

    [0479] Described herein are novel engineered biosensors. These biosensors may have altered ligand-binding affinities, tailored ligand-binding specificities, and/or temperature dependencies of ligand binding or stability. For example, the herein described engineered ligand biosensors provide high-accuracy information related to extended ligand concentration ranges.

    [0480] Binding of ligand mediates conformational changes in the biosensor, such as hinge-bending motions of the polypeptide. The conformational changes affect the environment of the reporter such that a change in the reporter-generated signal occurs. That is, without ligand bound, the biosensor results in signal generated from the reporter, and when ligand is bound, the signal generated from the reporter changes. The ligand-bound biosensor results in a reporter-generated signal that is different from the unbound biosensor.

    [0481] In some embodiments, the methods and compositions include a plurality of a single type of biosensor. The biosensors may be identical in structure and function. For example, the biosensors of a single type may have the same polypeptide, the same reporter, and the same ligand affinity.

    [0482] In other embodiments, the methods and compositions include a plurality of different types of biosensors. A plurality of these different types of biosensors may be arranged or incorporated in a panel. As used herein, a panel refers to two or more biosensors. The two or more biosensors may be different from each other. The biosensors may differ in structure and/or function. Biosensors may differ in polypeptide sequence, reporter, ligand affinities, or a combination thereof. Accordingly, there may be different types of biosensors. In some embodiments, each biosensor in the panel comprises the same reporter group. In some embodiments, each biosensor in the panel comprises a different reporter group. The panel may include at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, or at least 100 biosensors.

    [0483] The panel of biosensors includes at least one sensor element. Sensor element refers to a single spot, site, location, or well for the at least one biosensor, to which a sample or aliquot thereof may be applied. The panel may be a composite sensor or an array.

    [0484] In some embodiments, the panel is a composite sensor. In a composite sensor, each sensor element includes a mixture of two or more different biosensors. In some embodiments, the composite sensor includes one sensor element. In some embodiments, the composite sensor includes two or more sensor elements. In some embodiments, signals are measured from a composite sensor in which the signals arise from one or more biosensors in the sensor element. For example, signals may be measured from a composite sensor in which the signals arise from a subset of the total number of biosensors in the sensor element. For example, signals may be measured from a composite sensor in which the signals arise from two of five biosensors in the sensor element.

    [0485] In some embodiments, the panel is an array. In an array, each sensor element includes a single type of biosensor. An array comprises a plurality of individually and spatially localized sensor elements. Each sensor element includes a biosensor that is different than or the same as the biosensor of a different sensor element. In some embodiments, signals are measured from an array in which the signals arise separately from two or more selected biosensors in separate sensor elements. An array may comprise a plurality of sensor elements of a variety of sizes and configurations. An array may comprise a plurality of sensor elements arranged linearly. For example, an array may comprise a plurality of micrometer-sized sensor elements arranged in a single row. An array may comprise a plurality of sensor elements arranged in a grid. The grid may be two- or three-dimensional. In some embodiments, the grid is a spatially addressable grid. In some embodiments, the biosensors are incorporated into an array, such as a multichannel or multiplexed array.

    [0486] The biosensors of the present disclosure can be used in any setting where ligand detection is required or desired, such a medical setting (e.g., determining the level of blood ligand in a subject), environmental setting (e.g., determining the level of ligand in an environmental sample), biological setting (e.g., determining the presence or amount of ligand in a reaction), or in process engineering, such as monitoring the amount of ligand in a fermentation reaction (e.g., a bacterial culture, a yeast culture, beer/wine production, etc.). Other examples include, but are not limited to, uses in the food industry (Suleiman et al, In: Biosensor Design and Application: Mathewson and Finley Eds; American Chemical Society, Washington, D.C. 1992, vol. 511); in clinical chemistry (Wilkins et al., Med. Eng. Phys. 1996, 18, 273-288: Pickup, Tr. Biotech. 1993, 11, 285-291: Meyerhoff et al., Endricon 1966, 6, 51-58; Riklin et al., Nature 1995, 376, 672-675); Willner et al., J. Am. Chem. Soc. 1996, 118, 10321-10322); as the basis for the construction of a fluorescent flow cell containing immobilized ligand binding protein-FAST conjugates (see, e.g., Wilkins et al., Med. Eng. Phys. 1966, 18, 273-288; Pickup, Tr. Biotech. 1993, 11, 285-291; Meyerhoff et al., Endricon. 1966, 6, 51; Group, New Engl. J. Med. 1993, 329, 977-986; Gough et al., Diabetes 1995, 44, 1005-1009); and in an implantable devices.

    [0487] The biosensors as detailed herein may be administered in a variety of ways known by those of skill in the art, as appropriate for each application. Biosensors may be provided in a solution. The solution may be buffered. Biosensors may be provided in a solution and mixed directly with a sample. In some embodiments, a biosensor is immobilized onto a surface. Biosensors may be immobilized within a disposable cartridge into which a sample may be introduced or applied. Biosensors may be implanted or incorporated in a wearable device. The biosensor may be provided as an optode.

    [0488] The biosensor may be attached to or incorporated in a wearable device. Wearable devices may include, for example, adhesive strips, patches, and contact lenses. The biosensor may be configured for placement in contact with a subject's skin or mucosal surface. In some embodiments, the biosensor is configured as an adhesive strip. In some embodiments, the biosensor is configured within or on the surface of a contact lens. In some embodiments, the contact lens is formed from a transparent substrate shaped to be worn directly over a subject's eye, as described in, for example, U.S. Pat. No. 8,608,310.

    [0489] The biosensor may be implanted. The biosensor may be implanted in a subject's body. The biosensor may be implanted in a subject's blood vessel, vein, eye, natural or artificial pancreas, skin, or anywhere in the alimentary canal including the stomach, intestine and esophagus. The biosensor may be implanted in a subject with a microbead. In some embodiments, the biosensor is configured to be implanted in the skin. The biosensor may be implanted in a subject sub-dermally. The biosensor may generate the signal trans-dermally. In some embodiments, the biosensor may be implanted in a subject with transdermal microbeads, wherein the optical signals can be transmitted remotely between the biosensor and detecting device.

    [0490] In some embodiments, the biosensor is administered as an optode. As used herein, optode refers to an optical fiber with a single biosensor, or a composite biosensor, immobilized at the surface or at the end. An optode may also be referred to as an optrode. In some embodiments, the biosensor is implanted in a subject as an optode. The optode may be incorporated with or into a needle. The optode may be incorporated with a probe such as endoscopy or colonoscopy probes. The optode may be used in a tumor, near a tumor, or at the periphery of a tumor. In some embodiments, the biosensor may be implanted in a subject as an optode, wherein the optical signals can be transmitted between the biosensor and detecting device using physical links. In some embodiments, the biosensor is administered as an optode to a sample or reaction. The optode may be contacted with a sample or reaction. In some embodiments, an optode is used to continuously or episodically monitor a ligand in a sample or reaction.

    Methods of Detecting the Presence of a Ligand

    [0491] Provided herein is a method of detecting the presence of a ligand in a sample. The method may include contacting the biosensor with the sample; measuring a signal from the biosensor; and comparing the signal to a ligand-free control. A difference in signal indicates the presence of ligand in the sample.

    [0492] Also provided herein is a method of detecting the presence of ligand in a sample. The method may include (a) providing a biosensor disclosed herein in which the reporter group is attached the ligand-binding protein so that a signal transduced by the reporter group when the ligand-binding protein is bound to ligand differs from a signal transduced by the reporter group when the ligand-binding protein is not bound to ligand; (b) contacting the biosensor with the test sample under conditions such that the biosensor can bind to ligand present in the test sample; and (c) comparing the signal transduced by the reporter group when the biosensor is contacted with the test sample with the signal transduced by the reporter group when the biosensor is contacted with a ligand-free control sample, wherein a difference in the signal transduced by the reporter group when the biosensor is contacted with the test sample, as compared to when the biosensor is contacted with the control sample, indicates that the test sample contains ligand.

    Methods of Determining the Concentration of a Ligand

    [0493] Provided herein is a method of determining the concentration of a ligand in a sample. The method may include contacting the biosensor with the sample: measuring a signal from the biosensor; and comparing the signal to a standard hyperbolic ligand binding curve to determine the concentration of ligand in the test sample. The standard hyperbolic ligand binding curve may be prepared by measuring the signal transduced by the biosensor when contacted with control samples containing known concentrations of ligand.

    [0494] Another aspect of the present disclosure provides a method of determining the concentration of ligand in a test sample comprising, consisting of, or consisting essentially of: (a) providing a biosensor comprising a biosensor as described herein in which the reporter group is attached the ligand-binding protein so that a signal transduced by the reporter group when the ligand-binding protein is bound to ligand differs from a signal transduced by the reporter group when the ligand-binding protein is not bound to ligand: (b) contacting the biosensor with the test sample under conditions such that the biosensor can bind to ligand present in the test sample; and (c) comparing the signal transduced by the reporter group when the biosensor is contacted with the test sample with a standard hyperbolic binding curve prepared by measuring the signal transduced by the reporter group when the biosensor is contacted with control samples containing known quantities of ligand to determine the concentration of ligand in the test sample.

    Methods of Monitoring the Presence of a Ligand

    [0495] The present invention is directed to a method of episodically or continuously monitoring the presence of a ligand in a reaction. In certain embodiments, the biosensors may be used in the continuous monitoring of ligand in a reaction. In certain embodiments, the ligand sensors may be used in episodic monitoring of sample aliquots.

    [0496] The method of episodically or continuously monitoring the presence of a ligand in a reaction may include contacting the biosensor with the reaction: maintaining the reaction under conditions such that the polypeptide is capable of binding ligand present in the reaction; and episodically or continuously monitoring the signal from the biosensor in the reaction.

    [0497] The method of episodically or continuously monitoring the presence of a ligand in a reaction may include contacting the biosensor with the reaction; maintaining the reaction under conditions such that the polypeptide is capable of binding ligand present in the reaction: episodically or continuously monitoring the signal from the biosensor in the reaction; and comparing the signal to a standard hyperbolic ligand binding curve to determine the concentration of ligand in the test sample. The standard hyperbolic ligand binding curve may be prepared by measuring the signal transduced by the biosensor when contacted with control samples containing known concentrations of ligand.

    [0498] In some embodiments, the method further includes comparing the signal to a ligand-free control, wherein a difference in signal indicates the presence of ligand in the reaction.

    [0499] In some embodiments, the method further includes comparing the signal to a standard hyperbolic ligand binding curve to determine the concentration of ligand in the test sample. The standard hyperbolic ligand binding curve may be prepared by measuring the signal transduced by the biosensor when contacted with control samples containing known concentrations of ligand.

    [0500] Another aspect of the present disclosure provides a method of continuously monitoring the presence of ligand in a reaction comprising, consisting of, or consisting essentially of: (a) providing a biosensor as described herein in which the reporter group is attached the ligand-binding protein so that a signal transduced by the reporter group when the ligand-binding protein is bound to ligand differs from a signal transduced by the reporter group when the ligand-binding protein is not bound to ligand (b) maintaining the biosensor within the reaction and under conditions such that the biosensor can bind to ligand present in the reaction: (c) continuously monitoring the signal transduced by the reporter group when the biosensor is contacted with the ligand present in the reaction; and optionally (d) comparing the signal transduced by the reporter group when the biosensor is contacted with the ligand present in the reaction with the signal transduced by the reporter group when the biosensor is contacted with a ligand-free control sample, wherein a difference in the signal transduced by the reporter group when the biosensor is contacted with the ligand present in the reaction, as compared to when the biosensor is contacted with the control sample, indicates ligand is present in the reaction.

    [0501] Yet another aspect of the present disclosure provides a method of continuously monitoring the concentration of ligand in a reaction comprising, consisting of, or consisting essentially of: (a) providing a biosensor as described herein in which the reporter group is attached the ligand-binding protein so that a signal transduced by the reporter group when the ligand-binding protein is bound to ligand differs from a signal transduced by the reporter group when the ligand-binding protein is not bound to ligand; (b) maintaining the biosensor within the reaction under conditions such that the biosensor can bind to ligand present in the reaction; and (c) continuously monitoring the signal transduced by the reporter group when the biosensor is contacted with the ligand present in the reaction; and (d) comparing the signal transduced by the reporter group when the biosensor is contacted with the ligand present in the reaction with a standard hyperbolic ligand binding curve prepared by measuring the signal transduced by the reporter group when the biosensor is contacted with control samples containing known quantities of ligand to determine the concentration of ligand in the reaction.

    General Definitions

    [0502] Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art (e.g., in cell culture, molecular genetics, and biochemistry).

    [0503] As used herein, the term about in the context of a numerical value or range means10% of the numerical value or range recited or claimed, unless the context requires a more limited range.

    [0504] In the descriptions above and in the claims, phrases such as at least one of or one or more of may occur followed by a conjunctive list of elements or features. The term and/or may also occur in a list of two or more elements or features. Unless otherwise implicitly or explicitly contradicted by the context in which it is used, such a phrase is intended to mean any of the listed elements or features individually or any of the recited elements or features in combination with any of the other recited elements or features. For example, the phrases at least one of A and B; one or more of A and B; and A and/or B are each intended to mean A alone, B alone, or A and B together. A similar interpretation is also intended for lists including three or more items. For example, the phrases at least one of A, B, and C; one or more of A. B, and C; and A, B. and/or C are each intended to mean A alone, B alone, C alone, A and B together, A and C together, B and C together, or A and B and C together. In addition, use of the term based on, above and in the claims is intended to mean, based at least in part on, such that an unrecited feature or element is also permissible

    [0505] It is understood that where a parameter range is provided, all integers within that range, and tenths thereof, are also provided by the invention. For example, 0.2-5 mg is a disclosure of 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg etc. up to and including 5.0 mg.

    [0506] A small molecule is a compound that is less than 2000 daltons in mass. The molecular mass of the small molecule is preferably less than 1000 daltons, more preferably less than 600 daltons, e.g., the compound is less than 500 daltons, 400 daltons, 300 daltons, 200 daltons, or 100 daltons.

    [0507] As used herein, an isolated or purified nucleic acid molecule, polynucleotide, polypeptide, or protein, is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized. Purified compounds are at least 60% by weight (dry weight) the compound of interest. Preferably, the preparation is at least 75%, more preferably at least 90%. and most preferably at least 99%, by weight the compound of interest. For example, a purified compound is one that is at least 90%, 91%, 92%, 93%, 94%, 95%, 98%, 99%, or 100% (w/w) of the desired compound by weight. Purity is measured by any appropriate standard method, for example, by column chromatography, thin layer chromatography, or high-performance liquid chromatography (HPLC) analysis. A purified or isolated polynucleotide (ribonucleic acid (RNA) or deoxyribonucleic acid (DNA)) is free of the genes/nucleic acids or sequences/amino acids that flank it in its naturally-occurring state. Purified also defines a degree of sterility that is safe for administration to a human subject, e.g., lacking infectious or toxic agents.

    [0508] Similarly, by substantially pure is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it. Typically, the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.

    [0509] The transitional term comprising, which is synonymous with including, containing, or characterized by, is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase consisting of excludes any element, step, or ingredient not specified in the claim. The transitional phrase consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention.

    [0510] Subject as used herein refers to any organism from which a biological sample is obtained. For example, the sample is a biological fluid or tissue. For example, a subject is one who wants or is in need of detecting ligand or determining the concentration of ligand with the herein described biosensors. The subject may be a human or a non-human animal. The subject may be a mammal. The mammal may be a primate or a non-primate. The mammal can be a primate such as a human; a non-primate such as, for example, dog, cat, horse, cow, pig, mouse, rat, camel, llama, goat, rabbit, sheep, hamster, and guinea pig: or non-human primate such as, for example, monkey, chimpanzee, gorilla, orangutan, and gibbon. The subject may be of any age or stage of development, such as, for example, an adult, an adolescent, or an infant.

    [0511] As used herein, an expression vector is a DNA or RNA vector that is capable of effecting expression of one or more polynucleotides. Preferably, the expression vector is also capable of replicating within the host cell. Expression vectors can be either prokaryotic or eukaryotic, and are typically include plasmids. Expression vectors of the present invention include any vectors that function (i.e., direct gene expression) in host cells of the present invention, including in one of the prokaryotic or eukaryotic cells described herein, e.g., gram-positive, gram-negative, pathogenic, non-pathogenic, commensal, cocci, bacillus, or spiral-shaped bacterial cells; archaeal cells; or protozoan, algal, fungi, yeast, plant, animal, vertebrate, invertebrate, arthropod, mammalian, rodent, primate, or human cells. Expression vectors of the present invention contain regulatory sequences such as transcription control sequences, translation control sequences, origins of replication, and other regulatory sequences that are compatible with the host cell and that control the expression of a polynucleotide. In particular, expression vectors of the present invention include transcription control sequences. Transcription control sequences are sequences which control the initiation, elongation, and termination of transcription. Particularly important transcription control sequences are those which control transcription initiation such as promoter, enhancer, operator and repressor sequences. Suitable transcription control sequences include any transcription control sequence that can function in at least one of the cells of the present invention. A variety of such transcription control sequences are known to those skilled in the art.

    [0512] As used herein, the singular forms a, an, and the include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to a disease. a disease state, or a nucleic acid is a reference to one or more such embodiments, and includes equivalents thereof known to those skilled in the art and so forth.

    [0513] As used herein, pharmaceutically acceptable carrier or excipient refers to a carrier or excipient that is suitable for use with humans and/or animals without undue adverse side effects (such as toxicity, irritation, and allergic response) commensurate with a reasonable benefit/risk ratio. It can be, e.g., a pharmaceutically acceptable solvent, suspending agent or vehicle, for delivering the instant compounds to the subject.

    [0514] The term diagnosis refers to a determination that a disease is present in the subject. Similarly, the term prognosis refers to a relative probability that a certain future outcome may occur in the subject. For example, in the context of the present disclosure, prognosis can refer to the likelihood that an individual will develop a disease, or the likely severity of the disease (e.g., severity of symptoms, rate of functional decline, survival, etc.).

    [0515] Unless required otherwise by context, the terms polypeptide and protein are used interchangeably herein.

    [0516] A polypeptide or class of polypeptides may be defined by the extent of identity (% identity) of its amino acid sequence to a reference amino acid sequence, or by having a greater % identity to one reference amino acid sequence than to another. A variant of any of genes or gene products disclosed herein may have, e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%, sequence identity to the nucleic acid or amino acid sequences described herein. The term % identity, in the context of two or more nucleic acid or polypeptide sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection. For example, % identity is relative to the entire length of the coding regions of the sequences being compared, or the length of a particular fragment or functional domain thereof. Variants as disclosed herein also include homologs, orthologs, or paralogs of the genes or gene products described herein. In some embodiments, variants may demonstrate a percentage of homology or identity, for example, at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 900%, 95%, 96%, 97%, 98%, or 99% identity conserved domains important for biological function, e.g., in a functional domain, e.g. a ligand-binding or catalytic domain.

    [0517] For sequence comparison, one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Percent identity is determined using BLAST. For the BLAST searches, the following parameters were employed: (1) Expect threshold is 10; (2) Gap cost is Existence: 11 and Extension: 1; (3) The Matrix employed is BLOSUM62; (4) The filter for low complexity regions is on.

    [0518] The present invention also provides for functional fragments of the genes or gene products described herein. A fragment of a protein is characterized by a length (number of amino acids) that is less than the length of the full length mature form of the protein. A fragment, in the case of these sequences and all others provided herein, may be a part of the whole that is less than the whole. Moreover, a fragment ranges in size from a single nucleotide or amino acid within a polynucleotide or polypeptide sequence to one fewer nucleotide or amino acid than the entire polynucleotide or polypeptide sequence. Finally, a fragment is defined as any portion of a complete polynucleotide or polypeptide sequence that is intermediate between the extremes defined above.

    [0519] For example, fragments of any of the proteins or enzymes disclosed herein or encoded by any of the genes disclosed herein can be 10 to 20 amino acids, 10 to 30 amino acids, 10 to 40 amino acids, 10 to 50 amino acids, 10 to 60 amino acids, 10 to 70 amino acids, 10 to 80 amino acids, 10 to 90 amino acids, 10 to 100 amino acids, 50 to 100 amino acids, 75 to 125 amino acids, 100 to 150 amino acids, 150 to 200 amino acids, 200 to 250 amino acids, 250 to 300 amino acids, 300 to 350, 350-400, or 350-450 amino acids. The fragments encompassed in the present subject matter comprise fragments that retain functional fragments. As such, the fragments preferably retain the binding domains that are required or are important for functional activity. Fragments can be determined or generated by using the sequence information herein, and the fragments can be tested for functional activity using standard methods known in the art. For example, the encoded protein can be expressed by any recombinant technology known in the art and the binding activity of the protein can be determined.

    [0520] As used herein a biologically active fragment is a portion of a polypeptide which maintains an activity of a full-length reference polypeptide. Biologically active fragments as used herein exclude the full-length polypeptide. Biologically active fragments can be any size as long as they maintain the defined activity. Preferably, the biologically active fragment maintains at least 10%, at least 50%, at least 75% or at least 90%, of the activity of the full length protein.

    [0521] Amino acid sequence variants/mutants of the polypeptides of the defined herein can be prepared by introducing appropriate nucleotide changes into a nucleic acid defined herein, or by in vitro synthesis of the desired polypeptide. Such variants/mutants include, for example, deletions, insertions or substitutions of residues within the amino acid sequence. A combination of deletion, insertion and substitution can be made to arrive at the final construct, provided that the final peptide product possesses the desired activity and/or specificity.

    [0522] Mutant (altered) peptides can be prepared using any technique known in the art. For example, a polynucleotide defined herein can be subjected to in vitro mutagenesis or DNA shuffling techniques as broadly described by Harayama (1998). Products derived from mutated/altered DNA can readily be screened using techniques described herein to determine if they possess, for example, ligand binding activity.

    [0523] In designing amino acid sequence mutants, the location of the mutation site and the nature of the mutation will depend on characteristic(s) to be modified. The sites for mutation can be modified individually or in series, e.g., by (1) substituting first with conservative amino acid choices and then with more radical selections depending upon the results achieved, (2) deleting the target residue, or (3) inserting other residues adjacent to the located site.

    [0524] Amino acid sequence deletions generally range from about 1 to 15 residues, more preferably about 1 to 10 residues and typically about 1 to 5 contiguous residues. In some embodiments, a mutated or modified protein does not comprise any deletions or insertions. In various embodiments, a mutated or modified protein has less than about 10, 9, 8, 7, 6, 5, 4, 3, or 2 deleted or inserted amino acids.

    [0525] Substitution mutants have at least one amino acid residue in the polypeptide molecule removed and a different residue inserted in its place. Sites may be substituted in a relatively conservative manner in order to maintain activity and/or specificity. Such conservative substitutions are shown in the table below under the heading of exemplary substitutions.

    [0526] In certain embodiments, a mutant/variant polypeptide has only, or not more than, one or two or three or four conservative amino acid changes when compared to a naturally occurring polypeptide. Details of conservative amino acid changes are provided in the table below. As the skilled person would be aware, such minor changes can reasonably be predicted not to alter the activity of the polypeptide when expressed in a recombinant cell.

    TABLE-US-00006 Original Residue Exemplary Substitutions Alanine (Ala) Val; Leu; Ile; Gly Arginine (Arg) Lys Asparagine (Asn) Gln; His Cysteine (Cys) Ser Glutamine (Gln) Asn; His Glutamic Acid (Glu) Asp Glycine (Gly) Pro; Ala Histidine (His) Asn; Gln Isoleucine (Ile) Leu; Val; Ala Leucine (Leu) Ile; Val; Met; Ala; Phe Lysine (Lys) Arg Methionine (Met) Leu; Phe Phenylalanine (Phe) Leu; Val; Ala Proline (Pro) Gly Serine (Ser) Thr Threonine (Thr) Ser Tryptophan (Trp) Tyr Tyrosine (Tyr) Trp; Phe Valine (Val) Ile; Leu; Met; Phe; Ala

    Exemplary Substitutions

    [0527] Mutations can be introduced into a nucleic acid sequence such that the encoded amino acid sequence is altered by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. Certain amino acids have side chains with more than one classifiable characteristic. These families include amino acids with basic side chains (e.g., lysine. arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, tryptophan, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tyrosine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid residue in a given polypeptide is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of a given coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for given polypeptide biological activity to identify mutants that retain activity. Conversely, the invention also provides for variants with mutations that enhance or increase the endogenous biological activity. Following mutagenesis of the nucleic acid sequence, the encoded protein can be expressed by any recombinant technology known in the art and the activity/specificity of the protein can be determined. An increase, decrease, or elimination of a given biological activity of the variants disclosed herein can be readily measured by the ordinary person skilled in the art, i.e., by measuring the capability for binding a ligand and/or signal transduction.

    [0528] In various embodiments, a polypeptide comprises mutations such that 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, or less than about 10, 9, 8, 7, 6, 5, 4, 3, or 2 amino acids is substituted with a cysteine and/or a lysine.

    [0529] Polypeptides can be produced in a variety of ways, including production and recovery of natural polypeptides or recombinant polypeptides according to methods known in the art. In one embodiment, a recombinant polypeptide is produced by culturing a cell capable of expressing the polypeptide under conditions effective to produce the polypeptide, such as a host cell defined herein.

    Key to the Sequence Listing

    [0530]

    TABLE-US-00007 SEQIDNO SequenceName 1 synBicarbBP1[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_005410477.1andWP_010874027.1] 2 teBicarbBP2[U.S.NationalCenterforBiotechnologyInformation (NCB1)AccessionNo.NP_682790.1] 3 ctBicarbBP3[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_007090308.1andWP_015152989.1] 4 calBicarbBP4[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_007137061.1andWP_015197735.1] 5 avBicarbBP5[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_321546.1andWP_011317875.1] 6 cmBicarbBP6[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_007099445.1andWP_015162006.1] 7 mhFeBP1[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_07884192.1andWP_006253500.1] 8 exiFeBP2[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_002886303.1andWP_015880417.1] 9 teFeBP3[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNo.,NP_681303.1] 10 cnFeBP4[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_003796723.1andWP_013247623.1] 11 ttFeBP5[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNo.YP_144894.1] 12 msFeBPG[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_003686074.1andWP_013159102.1] 13 srFeBP7[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNos.YP_003572493.1andWP_013062602.1] 14 hlFeBP8[U.S.NationalCenterforBiotechnologyInformation (NCBI)AccessionNosYP_2564837.1andWP_012659409.1] 15 synBicarbBP1(withsignalpeptidereplacedwithManda GGSHHHHHHatC-terminus) 16 teBicarbBP2(withC247AandC260Asubstitutionmutations,the signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 17 ctBicarbBP3(withsignalpeptidereplacedwithManda GGSHHHHHHatC-terminus) 18 calBicarbBP4(withsignalpeptidereplacedwithMand aGGSHHHHHHatC-terminus) 19 avBicarbBP5(withC96Asubstitutionmutation,signalpeptide replacedwithM,andaGGSHHHHHHatC-terminus) 20 cmBicarbBP6(withC254Asubstitutionmutation,signalpeptide replacedwithM,andaGGSHHHHHHatC-terminus) 21 mhFeBP1(withC135AandC191Asubstitutionmutations,the signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 22 exiFeBP2(withsignalpeptidereplacedwithMandaGGSHHHHHH atC-terminus) 23 teFeBP3(withC184Ssubstitutionmutation,thesignalpeptide replacedwithM,andaGGSHHHHHHatC-terminus) 24 cnFeBP4(withsignalpeptidereplacedwithMandaGGSHHHHHH atC-terminus) 25 ttFeBPS(withsignalpeptidereplacedwithMandaGGSHHHHHH atC-terminus) 26 msFeBP6(withsignalpeptidereplacedwithMandaGGSHHHHHH atC-terminus) 27 srFeBP7(withsignalpeptidereplacedwithMandaGGSHHHHHH atC-terminus) 28 hlFeBP8(withC138AandC176Asubstitutionmutations,thesignalpeptide replacedwithM,andaGGSHHHHHHatC-terminus) 29 avBicarBP5_16C(withI16CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 30 avBicarBP5_17C(withP17CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 31 avBicarBP5_18C(withI18CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 32 avBicarBP5_49C(withW49CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 33 avBicarBP5_71C(withQ71CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 34 avBicarBP5_140C(withF140CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 35 avBicarBP5_141C(withT141CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 36 avBicarBP5_142C(withF142CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 37 avBicarBP5_143C(withP143CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 38 avBicarBP5_l46C(withN146CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 39 avBicarBP5_190C(withT190CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 40 avBicarBP5_194C(withW194CandC96Asubstitutionmutations, signalpeptidereplacedwithM,andaGGSHHHHHHatC-terminus) 41 teFeBP3_A8C(withA8CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 42 teFeBP3_H10C(withH10CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHMHHatC-terminus) 43 teFeBP3_D12C(withD12CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHMHHatC-terminus) 44 teFeBP3_T13C(withT13CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 45 teFeBP3_A36C(withA36CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 46 teFeBP3_V58C(withV58CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 47 teFeBP3_R135C(withR135CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 48 teFeBP3_N139C(withN139CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 49 teFeBP3_I140C(withI140CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 50 teFeBP3_N176C(withN176CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 51 teFeBP3_N195C(withN195CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 52 teFeBP3_N268C(withN268CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 53 teFeBP3_E270C(withE270CandC184Ssubstitutionmutations,thesignal peptidereplacedwithM,andaGGSHHHHHHatC-terminus) 54 avBicarbBP5_16C_bZif(withI16Csubstitutionmutation,signalpeptide replacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 55 avBicarbBP5_17C_bZif(withP17Csubstitutionmutation,signalpeptide replacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 56 avBicarbBP5_18C_bZif(withI18Csubstitutionmutation,signalpeptide replacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 57 avBicarbBP5_190C_bZif(withT190Csubstitutionmutation,signalpeptide replacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 58 avBicarbBP5_194C_bZif(withW194Csubstitutionmutation,signalpeptide replacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 59 avBicarbBP5_16C_71D_bZif(withI16CandQ71Dsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 60 avBicarbBP5_16C_71N_bZif(withI16CandQ71Nsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 61 avBicarbBP5_16C_71E_bZif(withI16CandQ71Esubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 62 avBicarbBP5_16C_71M_bZif(withI16CandQ71Msubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 63 avBicarbBP5_18C_16M_bZif(withI18CandI16Msubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 64 avBicarbBP5_18C_16F_bZif(withI18CandI16Fsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 65 avBicarbBP5_18C_16Y_bZif(withI18CandI16Ysubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 66 avBicarbBP5_18C_16W_bZif(withI18CandI16Wsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 67 avBicarbBP5_18C_16E_bZif(withI18CandI16Fsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 68 avBicarbBPS_18C_49F_bZif(withI18CandW49Fsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 69 avBicarbBP5_18C_49Y_bZif(withI18CandW49Ysubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 70 avBicarbBP5_18C_141V_bZif(withI18CandT141Vsubstitutionmutations, signalpeptidereplacedwithM,abZiffusion,andaGGSHHHHHHatC-terminus) 71 avBicarbBP5_18C_14IF_bZif(withI18CandT141Fsubstitution mutations,signalpeptidereplacedwithM,abZiffusion,anda GGSHHHHHHatC-terminus) 72 avBicarbBP5_18C_141Y_bZif(withI18CandT141Ysubstitution mutations,signalpeptidereplacedwithM,abZiffusion,anda GGSHHHHHHatC-terminus) 73 avBicarbBP5_18C_141W_bZif(withI18CandT141Wsubstitution mutations,signalpeptidereplacedwithM,abZiffusion,anda GGSHHHHHHatC-terminus) 74 avBicarbBP5_18C_141Q_bZif(withI18CandT141Qsubstitution mutations,signalpeptidereplacedwithM,abZiffusion,anda GGSHHHHHHatC-terminus) 75 synBicarbBP1(withsignalpeptidereplacedwithM) 76 eBicarbBP2(withC247AandC260Asubstitutionmutationsand signalpeptidereplacedwithM) 77 tBicarbBP3(withsignalpeptidereplacedwithM) 78 calBicarbBP4(withsignalpeptidereplacedwithM) 79 avBicarbBP(withC96Asubstitutionmutationandsignalpeptide replacedwithM) 80 cmBicarbBP6(withC254Asubstitutionmutationandsignalpeptide replacedwithM) 81 mhFeBP1(withC135AandC191Asubstitutionmutationsand signalpeptidereplacedwithM) 82 exiFeBP2(withsignalpeptidereplacedwithM) 83 teFeBP3(withC184Ssubstitutionmutationandsignalpeptide replacedwithM) 84 cnFeBP4(withsignalpeptidereplacedwithM) 85 ttFeBP5(withsignalpeptidereplacedwithM) 86 msFeBP6(withsignalpeptidereplacedwithM) 87 srFeBP7(withsignalpeptidereplacedwithM) 88 hlFeBP8(withC138AandC176Asubstitutionmutationsandsignal peptidereplacedwithM) 89 GGSHHHHHH 90 Zif 91 ZF-QNK 92 HexahistidineTag 93 HexalysineTag 94 ecGGBP(withsignalpeptideremoved) 95 ExemplaryExpressionConstructforsynBicarbBP1 96 ExemplaryExpressionConstructforteBicarbBP2 97 ExemplaryExpressionConstructforctBicarbBP3 98 ExemplaryExpressionConstructforcalBicarbBP4 99 ExemplaryExpressionConstructforavBicarbBP5 100 ExemplaryExpressionConstructforcmBicarbBP6 101 ExemplaryExpressionConstructformhFeBP1 102 ExemplaryExpressionConstructforexiFeBP2 103 ExemplaryExpressionConstructforteFeBP3 104 ExemplaryExpressionConstructforcnFeBP4 105 ExemplaryExpressionConstructforttFeBP5 106 ExemplaryExpressionConstructformsFeBP6 107 ExemplaryExpressionConstructforsrFeBP7 108 ExemplaryExpressionConstructforhlFeBP8 109 ExemplaryExpressionConstructforavBicarBP5_16C 110 ExemplaryExpressionConstructforavBicarBP5_17C 111 ExemplaryExpressionConstructforavBicarBP5_18C 112 ExemplaryExpressionConstructforavBicarBP5_49C 113 ExemplaryExpressionConstructforavBicarBP5_71C 114 ExemplaryExpressionConstructforavBicarBP5_140C 115 ExemplaryExpressionConstructforavBicarBP5_141C 116 ExemplaryExpressionConstructforavBicarBP5_142C 117 ExemplaryExpressionConstructforavBicarBP5_143C 118 ExemplaryExpressionConstructforavBicarBP5_146C 119 ExemplaryExpressionConstructforavBicarBP5_190C 120 ExemplaryExpressionConstructforavBicarBP5_194C 121 ExemplaryExpressionConstructforteFeBP3_A8C 122 ExemplaryExpressionConstructforteFeBP3_H10C 123 ExemplaryExpressionConstructforteFeBP3_D12C 124 ExemplaryExpressionConstructforteFeBP3_T13C 125 ExemplaryExpressionConstructforteFeBP3_A36C 126 ExemplaryExpressionConstructforteFeBP3_V58C 127 ExemplaryExpressionConstructforteFeBP3_R135C 128 ExemplaryExpressionConstructforteFeBP3_N139C 129 ExemplaryExpressionConstructforteFeBP3_I140C 130 ExemplaryExpressionConstructforteFeBP3_N176C 131 ExemplaryExpressionConstructforteFeBP3_N195C 132 ExemplaryExpressionConstructforteFeBP3_N268C 133 ExemplaryExpressionConstructforteFeBP3_E270C 134 ExemplaryExpressionConstructforavBicarbBP5_16C_bZif 135 ExemplaryExpressionConstructforavBicarbBP5_17C_bZif 136 ExemplaryExpressionConstructforavBicarbBP5_18CbZif 137 ExemplaryExpressionConstructforavBicarbBP5_190C_bZif 138 ExemplaryExpressionConstructforavBicarbBP5_194C_bZif 139 ExemplaryExpressionConstructforavBicarbBP5_16C_71D_bZif 140 ExemplaryExpressionConstructforavBicarbBP5_16C_71N_bZif 141 ExemplaryExpressionConstructforavBicarbBP5_16C_71E_bZif 142 ExemplaiyExpressionConstructforavBicarbBP5_16C_71M_bZif 143 ExemplaryExpressionConstructforavBicarbBP5_18C_16M_bZif 144 ExemplaryExpressionConstructforavBicarbBP5_18C_16F_bZif 145 ExemplaryExpressionConstructforavBicarbBP5_18C_16Y_bZif 146 ExemplaryExpressionConstructforavBicarbBP5_18C_16W_bZif 147 ExemplaryExpressionConstructforavBicarbBP5_18C_16E_bZif 148 ExemplaryExpressionConstructforavBicarbBP5_18C_49F_bZif 149 ExemplaryExpressionConstructforavBicarbBP5_18C_49Y_bZif 150 ExemplaryExpressionConstructforavBicarbBP5_18C_141V_bZif 151 ExemplaryExpressionConstructforavBicarbBP5_18C_141F_bZif 152 ExemplaryExpressionConstructforavBicarbBP5_18C_141Y_bZif 153 ExemplaryExpressionConstructforavBicarbBP5_18C_141W_bZif 154 ExemplaryExpressionConstructforavBicarbBP5_18C_141Q_bZif 155 KLGXIXIXEXAP(conservedsequence) 156 DGGQXQMPMP(conservedsequence) 157 GNGIA(conservedsequence 158 TFXXVNQD(conservedsequence 159 HPEEY(conservedsequence) 160 VYSXR(conservedsequence) 161 GLXXR(conservedsequence) 162 YYXX(conservedsequence) 163 YXGR(conservedsequence 164 SPAD(conservedsequence) 165 GWXPXY(conservedsequence) 166 2I4Cseedsequence(synBicarbBP1) 167 1SI0seedsequence(mhFeBP1) 168 4ELRseedsequence(ttFeBP5) 169 ecTrx 170 Adaptor0 171 Adaptor1.0 172 Adaptor2.0a 173 Adaptor2.0b 174 Adaptor3.0 175 Adaptor4.0 176 Adaptor5.0 177 Adaptor6.0 178 Adaptor7.0 179 Adaptor8.0 180 Adaptor9.0 181 Adaptor10.0 182 Adaptor11.0 183 Adaptor12.0 184 Adaptor13.0 185 Adaptor14.0 186 Adaptor15.0 187 Adaptor16.0

    [0531] The terms bZif and fZif are used synonymously herein.

    [0532] Exemplary amino acid sequences are listed below for convenience.

    TABLE-US-00008 synBicarbBP1 SARDNVTIGSQGGGIDGGQWQMPMPHLITEGIITNGNKVPMYVLAQLITQ GNGIAVAPMHEGKGVNLDITKAADYIKGFNKTNGRKFKAAHTFPNVNQDF WIRYWFAAGGVDPDTDIDLLAVPPAETVQGMRNGTMDAFSTGDPWPYRIV TENIGYMAGLTAQIWPYHPEEYLAIRADWVDKNPKATKALLKGIMEAQQW IDDPKNRPEVVQFVSGRNYFNVPTTILESPFKGQYTMGDGQPAIDDFQKG PLYWRDGIGNVSYPYRSHDLWFLTESIRWGFHRNAIPDLDTAQRIIDRVN REDLWREAATEAGFTADIPSSTSRGVETFFDGITFDPANPSAYLQSLAfR RVGGSHHHHHH** teBicarbBP2 MLETDTIRLGFIPIVESAPLIIAKERGFFARHGLTNAELSRQANWASARD NVVIGSAGGGIDGGQWQMPMPYLISEGIITLNNQRLPMYVLAQLNTQGNG IAISGANKGRGLHLRIADPDYIKGFAARNGRKFKAAHTFPHVNQDLWIRY WFAANGIDPDRDIELLAVPPAETVAGMRNGTMDAFSTGDPWPFRIVSDDI GYMATLTAQIWPYHPEEYLAVRADWVDKHPKATKALLKAVMEAQQWADDK ANRPELIQIASRREYFNIPGNILTPPYEGTYTMGDGQPNFNDFNIGPLYW RDPNGNSISYPYKSHDLWFLTENLRWGFNADKLKDFDNIKQMIGRVNRSD LWQEAAKELGIPAAEIPTTESRGVETFFDGIKFDPDNPQAYLDSLKIKVK SGGSHHHHHH** ctBicarbBP3 MPEQAPETTRVKLGYIPIVEAAPIIIAKEKGFFAKYGMTDVDVSKQASWG SMRDNTEIGAAGGGVDGGQYQMPMPHLITEGRITKGNKPIPMYVLAQLNT QGNGIAIAEKHRGKGIELELAKGGKNLFGQLKSANTPFTAAYTFAQVNQD FWIRYWLAAGGVNPDADVKLIPVPAAQTVANMKTGTMDAFSTGDPWPYRI VKDKIGFLAMLTADMWEFHPEEYLALRAEWVDKHPKATKALLKGIMEAQQ WLDNFDNREEAAKILGGRNYFNLPAEILAGPFAGKYDMGEGRTVDDRNKA VLYWRDPRGSVSYPYKSHDLWFLTESVRWGFLPPDSLTKAQALIDKVNRE DLWKEAAKELGVAAADIPTSTSRGVETFFDGVKFDPENPAAYLRSLRIRR AGGSHHHHHH** calBicarbBP4 MPEQRPETETVRLGYIPIVESAPLIIARERGLFARYGMTRVELARQASWG AARDNVEIGSAGGGIDGGQWQMPMPHLITAGLITRGNREIPMYVLAQLVT HGNGIAIADRHRGRGLGLRLDGARSLFRELRSSFPFTAAFTFPHVNQDLW IRYWLAASGLDPDADVKLLTVPAAQTVANMRTGTMDAFSTGDPWPFRIVN DRIGFMALLTAEMWKNHPEEYLAMRGDWVDRHPRATRAILRAVMEAQQWL DNFENRREAATILAGRRYFDLSSPEILLDPYQGRYDMGDGRRIDDRLMAP YYWKDERGSVSYPYRSHDLWFITENVRWGFLPRDYLANNAAKAKELrNKV NREDIWREAARDLGIAAADIPTSTSRGVEEFFDGVRFDPERPEEYLRSLR IRRAGVGGSHHHHHH** avBicarbBP5 MAEQAPEVTTVKLGYTPIVESAPLIIAKEKGFFAKYGLTNVELSRQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITRGNQRIPMYVLAQLIT HGNGIAIANRHQGRGISLRLEGARSLFSQLRSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVRLLTVPAAQTVANMRTGTMDAFSTGDPWPFRLVN DRIGYMAALTAEIWRNHPEEYLAMRADWVDRYPRATRALLKGIMEAQQWL DNFDNRREAAQILAGRNYFNLNNPEILADPYVGRYDMGDGRRIDDRSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGFKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** cmBicarbBP6 MSSATTPETTAVKLGYIAIAESAPLIIAREKGFFARHGMTDVDVSKQASW GSARDNIEIGSSNGGIDGGQWQMPMPQLISEGIITKGNRKIPMLSLAQLS TQGNGIAISTQHAGKGFGLDVSGAAEYVRDMKADGKPFKAAYTFPRVNQD FWIRYWLAAGGIDPNKDIDLIAVPAAQTVASMRTGSMDGFSTGDPWPSRI LRDRRKYGFLAVLTAQIWPAHPEEYFAMREDWVRKHPKAAKAILKGIMEA QMWADDPKNRAEMAAILAQRKYFNVPSDLLIGPYVGEYILGADRKTVKDE KLAIRYWKDARGNVSYPYKSHDLWFLTESVRWGFLPQGALGEADRIINAV SGEKYWREAAQELGIASADIPPSTSRGIEKFFDGAEFNPEKPKAYLDSLK IKNLKAGGSHHHHHH** mhFeBP1 MANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGEL SPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLT TRARVFYTSKDRVGKLPAGFDYLDLAKPEYKGKVAVRSGKNSYNVSLFAA MIEHYGlEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGIADYSIGNSYY YGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKL IEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAK NYEAALKLVDEVKFDDFGGSHHHHHH** exiFeBP2 MNVVNVYSSRHYDVDQQLYKQFEEETGIKVNVVEGKSDELLERLNTEGEN TEADLFITADAGNLYQAKEAGHLQAVDSDELESNIPEKYRDTDNEWFGLT KRARVIVYSKDRVKPEDLSTYEALTEEQWNGKVLVRPSENMYNISLLASF IEVNGVDEAKEWAKGLVNNMARDPQGNDRDQAKAVVAGEGDVAIMNTYYM GLMLNSEDEEEKKVAEQLGVFFPNQDTTGTHVNISGIAMTKASKNTENAQ KLMEFMSEPSAQEKFASVNYEYPVNESVEPNELLQSWGEFKEQDINLSAL GENQQEAIRIFNEVGWKGGSHHHHHH** teFeBP3 MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** cnFeBP4 MKLVVYSGRAERLIKPVLDEFQAKSGIQIELLSSGTTELVNRLQAEGDHT PADVFLTNDAGSLEHARELKLLRPMNMREVERAIPSQFRAADNSWIGLSG RFWIVVYNTNLVKPDQIKSLFDLTQPQWKDKIAVPNSGSEYLQAGVSVIK ATFGDERTKQFLQGLKANAGTQVYQKSSQIVEAVAKGQVAAGIVNHYYIY RHLATQPTAPIAAVMTDQQEGGMGAIMNVTGIGVTRASKHVESAKLLIEF LVAQAGQKMFADLDKEYPLHPDVKADPTLIDRRTFRAAQVPLARLAELRE ATLTLIEQVGLRGGSHHHHHH** ttFeBP5 MSPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGS RSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTV RLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMV AGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHY YVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYL LSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDR ALRLLRETGVLGGSHHHHHH** msFeBP6 MSLTLYTGRSQALVDKLVQQFQKDTGIKVNVRYGRDAEILAALQEEGSRS PADVFWANTSGALEEAVKRNLLVQLPASLTRQPQEFVPSHGRWVPVSVRF RVAAYNPTKVKDSDFPASVMDLPKVAKFKGRIGWTPTYSSFQDFITAMRV VKGEAATKAWLQAMIAAGAKAYPSNPPMLEAMQAGEIDVALTNHYYIQRI LAGVGEGEYEGKEESEEEEKKELAAREAKAGVATHYFAPGDVGGLALVTG AGILATSKHQTNATRFLNYLLSKKAQPYFVDEVREYPVIAGVRVAKGMLP FANAIRLSPKIDFAKLTDLEGTLKLLREVGLLGGSHHHHHH** srFeBP7 MLVIYSGRSKALVDSLVQQYROQADVPVRVRYGTDSQLLAALQEEGDQSP ADVFWANTTGALGNAVNNGLLTELPDTLANRAARFTPSNQRWTPVTTRFR VLAYNSDAVSPEDLPDSVLDLPEHEEFEGRVGWTPAYSSFQDFVTALRVT EGAETARTWLSDMQALNPNSYTSNTPMVQALEAGEIDVALTNHYYVLRLK HGGAEGEYEGEEEEGEEHEEEHEEEATPRASAPVEMYHFADGDLGNLALV TGAGALQTSNQPDAANRFLRFLLSEQAQSFAATRVNEYPVVSGASVPDYL MPADEALKMSPEFDLQKLQNMEPTLDLLRDAGALGGSHHHHHH** hlFeBPX MLTVYSGRGEFLVGELVEYIEDQYDDFDLTVRYAGSTDLVNQILNEGDGS PADVFYSVNAGSLGTLAGEGRSQALSSEITDMVRSEFRTEQWIGTSGRAR TVPYNTGEFSDDDLPDDIMAYPEEFAGSLGWAPSYGSAQAFITAMRLIEG EEATLAWLESVVEAGISSYPDEFAAAQAIADGEIDAAFTNHYYIQRVLDG NPDASIGTAFTSGDAGAVFNVAGAAVVDTASDATLAENFIRHLLSAEAQD YFARSTFEYPLIPDVEPIGDLPTIDELDVPDIDLTELSDLEPTIDLMREA GVEVGGSHHHHHH** avBicarBP5CysteineScans avBicarBP5_16C MAEQAPEVTTVKLGYCPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_17C MAEQAPEVTTVKLGYICIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_18C MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_49C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASCG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFFFENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_71C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWCMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_140C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAACTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_141C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFCFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_142C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTCPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADVWDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_143C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFCHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_146C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVETGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVCQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_190C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSCGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** avBicarBP5_194C MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPCPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSHHHHHH** teFeBP3CysteineScans teFeBP3_A8C MVINVYSCRHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_H10C MVINVYSARCYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_D12C MVINVYSARHYCTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_T13C MVINVYSARHYDCDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_A36C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAECDALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_V58C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITCDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_R135C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTCSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FEEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_N139C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSCIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_I140C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNCYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHVYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVRQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_N176C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGCDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_N195C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIACHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_N268C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMACFEYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** teFeBP3_E270C MVINVYSARHYDTDKALYNTFTQQTGIRVNIIEAEADALIERIRSEGSRT PADVLITVDAGRLWRAQEAGILQPIQSRVLNSVVPANLREPQGHWFGLSR RVRVLIYNKSRVNPSQLSTYEDLANPKWRRQILTRSSSNIYNQSLTGSLL AIHGAQKTEQWARGLVQNFARPPEGNDTAQIRASAEGVGSVAIANHYYLA RLIASDKEQDRAVAAKVGLFFPNQRDRGAHVNISGAGVVAGAPNRQGAIR FLEYLVSPKAQEMFAMANFCYPVRAGVPVHPIVKQFGNFRGQNVNAAVFG RNNAEALRIMDRAGWRGGSHHHHHH** bZifsofCysScansinavBicarbP5 avBicarbBP5_16C_bZif MAEQAPEVTTVKLGYCPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_17C_bZif MAEQAPEVTTVKLGYICIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADVWDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_190C_bZif MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSCGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_194C_bZif MAEQAPEVTTVKLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPCPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV MIEDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** AffinityVariantsofavBicarbP5_16C-bZif avBicarbBP5_16C_71D_bZif MAEQAPEVTTVKLGYCPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWDMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_116C_71N_bZif MAEQAPEVTTVKLGYCPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWNMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_16C_71E_bZif MAEQAPEVTTVKLGYCPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWEMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_16C_71M_bZif MAEQAPEVTTVKLGYCPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWMMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** AffinityVariantsofavBicarbP5_18C-bZif avBicarbBP5_18C_16M_bZif MAEQAPEVTTVKLGYMPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGOWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPMVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_16F_bZif MAEQAPEVTTVKLGYFPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_16Y_bZif MAEQAPEVTTVkLGYYPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_16W_bZif MAEQAPEVTTVKLGYWPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWOMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_16E_bZif MAEQAPEVTTVKLGYEPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_49F_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASFG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSNHHHHFI** avBicarbBP5_18C_49Y_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASYG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFTFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_141V_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGRGISLKLEGAKSLFSQLKSSTPFTAAFVFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_141F_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFFFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_141Y_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFYFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_141W_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFWFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAREAGIAAADIPTSISRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH** avBicarbBP5_18C_141Q_bZif MAEQAPEVTTVKLGYIPCVESAPLIIAKEKGFFAKYGLTNVELSKQASWG SARDNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLAQLIT HGNGIAIANKHQGKGISLKLEGAKSLFSQLKSSTPFTAAFQFPHVNQDLW IRYWLAAGGIDPDADVKLLTVPAAQTVANMKTGTMDAFSTGDPWPFRLVN DKIGYMAALTAEIWKNHPEEYLAMRADWVDKYPKATKALLKGIMEAQQWL DNFDNRKEAAQILAGRNYFNLNNPEILADPYVGKYDMGDGRKIDDKSMAA YYWKDEKGSVSYPYKSHDLWFITENVRWGFLPKDYLANGAAKAKELIDKV NREDIWKEAAKEAGIAAADIPTSTSRGVEEFFDGTKFDPEKPDEYLKSLK IKKVSVGGSTGEKPYKCPECGKSFSRSGGSHHHHHH**

    [0533] Examples are provided below to facilitate a more complete understanding of the invention. The following examples illustrate the exemplary modes of making and practicing the invention. However, the scope of the invention is not limited to specific embodiments disclosed in these Examples, which are for purposes of illustration only, since alternative methods can be utilized to obtain similar results.

    Example 1. Fluorescently Responsive Sensor Engineering Phases

    [0534] The engineering of FRSs can be divided into five phases: [0535] 1. Binding protein discovery. A set of binding protein sequence homologs is identified for the target ligand. Accurate assignment of their ligand-binding function requires application of a prediction method that incorporates information encoded in the experimentally determined three-dimensional structure of known periplasmic binding proteins for the target ligand. [0536] 2. Experimental lead validation. Synthetic genes are constructed, which are optimized for heterologous expression in Escherichia coli of one or more predicted binding protein sequences for the target ligand. The ligand binding properties and thermostabilities of the corresponding expressed, purified proteins are evaluated. [0537] 3. Engineering of fluorescent responses. Semisynthetic fluorescent conjugates of the experimentally validated leads are constructed by first attaching single fluorophores to single cysteine mutants. The effect of ligand binding on the fluorescence emission properties of those conjugates is evaluated. The spectral properties of a subset of responsive fluorophores is improved using a double-labeling strategy in which a second fluorophore is site-specifically attached to a small domain fused to the N- or C-terminus to establish ligand-modulated fluorescence resonance energy transfer. Those singly or doubly labeled conjugates that evince strong, ratiometric responses are selected as FRSs for use in sensing applications. [0538] 4. Affinity tuning. Single or multiple mutations are introduced by site-directed mutagenesis to alter the ligand-binding affinities of ligand-responsive FRSs. A set of FRS variants is selected that together cover the clinical ligand concentration range with high accuracy.

    Example 2. Sensor Engineering Phase 1: Identification of a Family of Periplasmic Binding Proteins Homologs for the Target Ligand Using Structurally Assisted Function Evaluation

    [0539] As a first step in constructing robust sensor candidates for the target ligand, we examined bacterial genomic sequences to identify periplasmic binding protein sequences for bicarbonate and calcium in known thermophiles. Homologs from such organisms are likely to encode thermostable proteins (Urbieta et al. 2015). Analysis of enzyme families has shown that overall sequence identity below 60% is a weak predictor of function conservation (Todd 2001, Tian 2003). Furthermore, functional assignments based on sequence homology alone are known to be particularly problematic in the PBP superfamily. For instance. PBPs that by overall sequence identity are predicted to bind oligopeptides were found to bind oligosaccharides (Cuneo, Beese and Hellinga 2009, Nanavati 2006). Enzyme functional assignments are improved greatly if a sequence selection filter based on conservation of catalytic residues identified from protein structures is included (George 2005). Such catalytic residues comprise a subset of all the residues that contact an enzyme substrate or inhibitor (George 2005). In the case of the PBPs, functional selection filters need to take into account all the protein-ligand contacts that encode the ligand-binding function. Accordingly, we have developed a structurally assisted functional evaluation (SAFE) method to identify PBP sequence homologs with accurately predicted function. The SAFE homolog search method consists of five steps: [0540] 1. Sequence homolog set is collected using the BLAST sequence alignment tool (Altschul et al. 1990), starting with a seed sequence. The following BLAST parameters: (1) Expect threshold is 10.0; (2) Gap cost is Existence: 11 and Extension: 1: (3) The Matrix employed is BLOSUM62; (4) The filter for low complexity regions is on. Permissive settings are used, such that pairwise hits are required to have a minimum of only 20% sequence identity with the seed sequence. The lengths of the hit and seed are mutually constrained such that the alignment covers at least 70% within each partner. This set of sequences defines a universe of possible ligand-binding proteins for the target ligand without accurately assigning function. [0541] 2. Structure-based encoding of biological function. A primary complementary surface comprising the protein residues that form hydrogen bonds and van der Waals contacts with the bound complex is defined using computer-assisted, visual inspection of the three-dimensional structure of the ligand bound complex. This definition specifies residue positions and their permitted amino acid identity. Multiple amino acid identities are permitted at each position to encode functionally equivalent residues. This definition establishes a search filter for the accurate prediction of binding proteins for the target ligand within the universe of sequence homologs collected in (1). [0542] 3. Accurate sequence alignment Tools such as ClustalW (Chenna et al. 2003) are used to construct an accurate alignment of all the sequence homologs. The seed sequence is included in this alignment. This multiple sequence alignment establishes the equivalent positions of the PCS in each sequence homolog. [0543] 4. Function evaluation. The ligand binding properties of each of the aligned sequence homologs is determined by measuring their compliance with the PCS sequence filter. A Hamming distance, H, is assigned for each homolog, which specifies the degree of sequence identity of all the residues at the aligned PCS positions. A value of H=0 indicates that the identities of all the residues at the aligned PCS positions match the amino acid(s) allowed in the PCS search filter; H>0, indicates that one or more aligned positions have disallowed residues. Sequences for which H=0 are predicted to encode binding proteins of the target ligand. [0544] 5. Selection of representative SAFE homologs. The sequence homologs are ordered by (a) identity with the seed PCS, as measured by the Hamming distance, (b) fractional overall sequence identity with the seed sequence. A subset for sequences with H=0, sampling the fractional overall sequence identity is selected for experimental verification.
    These steps are encoded in the ProteinHunter software tool, which encodes the flow of execution, applies the PCS search filter, and visualizes the results, and handles organism annotations such as thermophilicity, and Gram stain status.

    [0545] The ProteinHunter package always executes BLAST searches, with the following command

    [0546] blastall -p blastp -m 8 -b 50000 -d % s -i<INPUT FILE> -o<OUTPUT FILE>

    [0547] where <INPUT FILE> and <OUTPUT FILE> specify the input and output files, respectively for a given calculation. This command executes the BLAST alignment program for protein sequences with default parameters, intrinsically set by the program. The BLAST program version is 2.2.24.

    [0548] The ProteinHunter package always executes multiple sequence alignments with the following command

    [0549] clustalw -infile=<INPUT FILE> -outfile=<OUTPUTFILE> -align -quiet

    This command executes the CLUSTALW multi-sequence alignment program for protein sequences. There are no user-specified parameter settings that alter the alignment behavior of the program. The CLUSTALW program version is 2.1.

    [0550] Annotated genomic and plasmid sequences of 5062 prokaryotes were obtained from the National Center of Biotechnology Information (ftp://ftp.ncbi.nih.gov/genomes/Bacteriaall.gbk.tar.gz).

    [0551] Identification of Ca.sup.IIHCO.sub.3 Binding Proteins.

    [0552] The cyanobacterium Synechocystis PCC 6803 has a bicarbonate PBP (synBicarbBP1) (Omata 1999) which is a component of an uptake system that builds up high cytoplasmic CO.sub.2 concentrations for photosynthetic carbon fixation (Price 2008). The X-ray structure of this protein revealed that bicarbonate binds as a Ca.sup.2+ complex (Koropatkin 2007) (FIGS. 3A and B). This structure was used to define a PCS encoding recognition of the Ca.sup.IIHCO.sub.3 complex (FIGS. 3B-C). Two of the bicarbonate oxygens participate in Ca.sup.2+ coordination; the other oxygen forms hydrogen bonds with T192 and W99 (FIG. 3B). The Ca.sup.2+ ion coordination sphere is a septa-coordinate pentagonal bipyramid. A PCS filter specifying the amino acid identity at each of these seven positions was used to predict Ca.sup.IIHCO.sub.3 binding proteins. The synBicarbBP1 sequence was used as a seed to identify 742 sequence homologs in 484 replicons, representing 289 different species. Of these 38 were predicted to be Ca.sup.IIHCO.sub.3 binding proteins based on their PCS (Table 1). The overall sequence identities of these homologs relative to the seed varied from 100% to 61%.

    TABLE-US-00009 TABLE 1 synBicarbBP1 homologs. # Name 70 99 121 152 192 198 1 2I4C| E W Q N T Q 2 NC_017052|YP_005410477.1 E W Q N T Q 3 NC_017038|YP_005384601.1 E W Q N T Q 4 NC_017039|YP_005387770.1 E W Q N T Q 5 NC_000911|NP_442732.1 E W Q N T Q 6 NC_010546|YP_001801722.1 E W Q N T Q 7 NC_011729|YP_002379906.1 E W Q N T Q 8 NC_019703|YP_007108955.1 E W Q N T Q 9 NC_014501|YP_003887015.1 E W Q N T Q 10 NC_019748|YP_007133714.1 E W Q N T Q 11 NC_004113|NP_682790.1 E W Q N T Q 12 NC_007776|YP_476857.1 E W Q N T Q 13 NC_007775|YP_474359.1 E W Q N T Q 14 NC_023033|NK55_06690 E W Q N T Q 15 NC_010296|YP_001657013.1 E W Q N T Q 16 NC_019745|YP_007129075.1 E W Q N T Q 17 NC_019689|YP_007080477.1 E W Q N T Q 18 NC_019680|YP_007062720.1 E W Q N T Q 19 NC_019729|YP_007115550.1 E W Q N T Q 20 NC_019676|YP_007049841.1 E W Q N T Q 21 NC_013161|YP_003138293.1 E W Q N T Q 22 NC_019695|YP_007090308.1 E W Q N T Q 23 NC_010628|YP_001865867.1 E W Q N T Q 24 NC_011726|YP_002373642.1 E W Q N T Q 25 NC_007413|YP_321546.1 E W Q N T Q 26 NC_019738|YP_007123904.1 E W Q N T Q 27 NC_019684|YP_007076410.1 E W Q N T Q 28 NC_003272|NP_486917.1 E W Q N T Q 29 NC_019682|YP_007066695.1 E W Q N T Q 30 NC_019757|YP_007149519.1 E W Q N T Q 31 NC_019702|YP_007104545.1 E W Q N T Q 32 NC_007604|YP_400505.1 E W Q N T Q 33 NC_006576|YP_173184.1 E W Q N T Q 34 NC_011884|YP_002485585.1 E W Q N T Q 35 NC_019771|YP_007158727.1 E W Q N T Q 36 NC_019751|YP_007137061.1 E W Q N T Q 37 NC_019675|YP_007045476.1 E W Q N T Q 38 NC_019697|YP_007099445.1 E W Q N T Q 39 NC_019439|YP_007001023.1 E W Q N T Q # 270 271 Identity Gram Temperature Organism 1 E E 2 E E 1 Mesophilic Synechocystis sp. 3 E E 1 Mesophilic Synechocystis sp. 4 E E 1 Mesophilic Synechocystis sp. 5 E E 1 Mesophilic Synechocystis sp. 6 E E 0.84 Mesophilic Cyanothece sp. 7 E E 0.83 Mesophilic Cyanothece sp. 8 E E 0.8 + Mesophilic Geitlerinema sp. 9 E E 0.8 Mesophilic Cyanothece sp. 10 E E 0.73 + Mesophilic Stanieria cyanosphaera 11 E E 0.72 Thermophilic Thermosynechococcus elongatus 12 E E 0.72 Thermophilic Synechococcus sp. 13 E E 0.71 Thermophilic Synechococcus sp. 14 E E 0.71 Mesophilic Thermosynechococcus sp. 15 E E 0.7 Mesophilic Microcystis aeruginosa 16 E E 0.69 + Mesophilic Gloeocapsa sp. 17 E E 0.69 + Mesophilic Pleurocapsa sp. 18 E E 0.69 Thermophilic Synechococcus sp. 19 E E 0.68 + Mesophilic Oscillatoria nigro-viridis 20 E E 0.68 Mesophilic Nostoc sp. 21 E E 0.68 Mesophilic Cyanothece sp. 22 E E 0.67 + Mesophilic Chroococcidiopsis thermalis 23 E E 0.67 Mesophilic Nostoc punctiforme 24 E E 0.66 Mesophilic Cyanothece sp. 25 E E 0.66 + Mesophilic Anabaena variabilis 26 E E 0.66 + Mesophilic Microcoleus sp. 27 E E 0.66 Mesophilic Nostoc sp. 28 E E 0.66 Mesophilic Nostoc sp. 29 E E 0.65 + Mesophilic Calothrix sp. 30 E E 0.64 + Mesophilic Cylindrospermum stagnale 31 E E 0.64 Thermophilic Synechococcus sp. 32 E E 0.64 Mesophilic Synechococcus elongatus 33 E E 0.64 Mesophilic Synechococcus elongatus 34 E E 0.63 Mesophilic Cyanothece sp. 35 E E 0.63 + Mesophilic Anabaena cylindrica 36 E E 0.63 + Mesophilic Calothrix sp. 37 E E 0.62 + Mesophilic Cyanobium gracile 38 E E 0.61 + Mesophilic Chamaesiphon minutus 39 E E 0.61 + Mesophilic Anabaena sp.

    [0553] Identification of Fe.sup.IIHCO.sub.3 Binding Proteins.

    [0554] Structures have been determined for Fe.sup.IIIHCO.sub.3 binding proteins from Mannheimia haemolytica (mhFeBP1) and Thermus thermophilus (ttFeBP5) (FIG. 4). These revealed that two of the bicarbonate oxygens form a bidentate interaction with the bound iron. The other oxygen forms hydrogen bonds with an arginine. A second arginine also interacts with the bound bicarbonate. The Fe.sup.III coordination sphere is complete by the phenolic hydroxyls of three tyrosines. In both proteins two of the three tyrosines are located adjacent to each on a helix (helix A), and the third tyrosine is contributed by a second helix (helix B). The location of this tyrosine within the B helix differs by a -helical turn in the two proteins. Accordingly, the positional information is slightly different for the PCS filters of these proteins, even though the compositional information is identical (FIG. 4C).

    [0555] The mhFeBP1 sequence was used as a seed to identify 1290 sequence homologs in 958 replicons, representing 601 different species. Of these 522 were predicted to be Fe.sup.IIIHCO.sub.3 binding proteins based on their PCS (Table 2). Using the ttFeBP5 seed sequences, 1512 homologs (1172 replicons, 626 species) were identified, of which 70 satisfied the PCS filter (Table 3).

    TABLE-US-00010 TABLE 2 mhFeBP1 homologs. # Name 10 101 142 198 199 Identity Gram Temperature Organism 1 1SI0| R R Y Y Y 2 NC_020834|YP_007669069.1 R R Y Y Y 1 + Mesophilic Mannheimia haemolytica 3 NC_020833|YP_007666187.1 R R Y Y Y 1 + Mesophilic Mannheimia haemolytica 4 NC_021082|YP_007884192.1 R R Y Y Y 1 + Mesophilic Mannheimia haemolytica 5 NC_021743|F382_02715 R R Y Y Y 1 + Mesophilic Mannheimia haemolytica 6 NC_021883|N220_08810 R R Y Y Y 1 + Mesophilic Mannheimia haemolytica 7 NC_021739|J451_03020 R R Y Y Y 1 + Mesophilic Mannheimia haemolytica 8 NC_021738|J450_02175 R R Y Y Y 0.98 + Mesophilic Mannheimia haemolytica 9 NC_011852|YP_002475690.1 R R Y Y Y 0.86 Mesophilic Haemophilus parasuis 10 NC_020515|YP_007547693.1 R R Y Y Y 0.84 + Mesophilic Bibersteinia trehalosi 11 NC_017027|YP_005363665.1 R R Y Y Y 0.8 Mesophilic Pasteurella multocida 12 NC_002663|NP_244988.1 R R Y Y Y 0.8 Mesophilic Pasteurella multocida 13 NC_017764|YP_006240219.1 R R Y Y Y 0.8 Mesophilic Pasteurella multocida 14 NC_016808|YP_005177128.1 R R Y Y Y 0.8 Mesophilic Pasteurella multocida 15 NC_010519|YP_001784574.1 R R Y Y Y 0.78 Mesophilic Haemophilus somnus 16 NC_015460|YP_004419395.1 R R Y Y Y 0.78 Mesophilic Gallibacterium anatis 17 NC_008309|YP_718993.1 R R Y Y Y 0.78 Mesophilic Haemophilus somnus 18 NC_022528|YP_008621989.1 R R Y Y Y 0.64 Mesophilic Vibrio nigripulchritudo 19 NC_022349|YP_008535958.1 R R Y Y Y 0.64 Mesophilic Vibrio alginolyticus 20 NC_013456|YP_003285201.1 R R Y Y Y 0.64 Mesophilic Vibrio sp. 21 NC_006370|YP_131292.1 R R Y Y Y 0.64 Psychrophilic Photobacterium profundum 22 NC_011312|YP_002263934.1 R R Y Y Y 0.63 Psychrophilic Aliivibrio salmonicida 23 NC_009783|YP_001446607.1 R R Y Y Y 0.63 Mesophilic Vibrio campbellii 24 NC_022223|N175_12595 R R Y Y Y 0.63 + Mesophilic Listonella anguillarum 25 NC_019955|YP_007275951.1 R R Y Y Y 0.63 Mesophilic Vibrio parahaemolyticus 26 NC_020802|YP_007640830.1 R R Y Y Y 0.63 + Mesophilic Psychromonas sp. 27 NC_015633|YP_004567100.1 R R Y Y Y 0.63 Mesophilic Vibrio anguillarum 28 NC_021848|M636_09480 R R Y Y Y 0.63 Mesophilic Vibrio parahaemolyticus 29 NC_021847|M634_4850 R R Y Y Y 0.63 Mesophilic Vibrio parahaemolyticus 30 NC_004603|NP_798870.1 R R Y Y Y 0.63 Mesophilic Vibrio parahaemolyticus 31 NC_011753|YP_002418100.1 R R Y Y Y 0.63 Mesophilic Vibrio splendidus 32 NC_011184|YP_002156950.1 R R Y Y Y 0.62 Mesophilic Vibrio fischeri 33 NC_006840|VF2151 R R Y Y Y 0.62 Mesophilic Vibrio fischeri 34 NC_016613|YP_005024030.1 R R Y Y Y 0.62 Mesophilic Vibrio sp. 35 NC_017270|YP_005633217.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 36 NC_012578|YP_002809340.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 37 NC_012668|YP_002879527.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 38 NC_016445|YP_004936187.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 39 NC_016944|YP_005332437.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 40 NC_002505|NP_230257.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 41 NC_009457|YP_001216102.1 R R Y Y Y 0.62 Mesophilic Vibrio cholerae 42 NC_014965|YP_004187783.1 R R Y Y Y 0.61 Mesophilic Vibrio vulnificus 43 NC_005139|NP_935539.1 R R Y Y Y 0.61 Mesophilic Vibrio vulnificus 44 NC_004459|NP_760550.2 R R Y Y Y 0.61 Mesophilic Vibrio vulnificus 45 NC_016602|YP_004992111.1 R R Y Y Y 0.6 Mesophilic Vibrio furnissii 46 NC_008709|YP_944308.1 R R Y Y Y 0.6 + Psychrophilic Psychromonas ingrahamii 47 NC_015424|YP_004394158.1 R R Y Y Y 0.6 Mesophilic Aeromonas veronii 48 NC_012691|YP_002893739.1 R R Y Y Y 0.59 Mesophilic Tolumonas auensis 49 NC_021290|YP_008041799.1 R R Y Y Y 0.59 Mesophilic Aeromonas hydrophila 50 NC_008570|YP_855192.1 R R Y Y Y 0.59 Mesophilic Aeromonas hydrophila 51 NC_016745|YP_005093558.1 R R Y Y Y 0.59 + Mesophilic Oceanimonas sp. 52 NC_009348|YP_001140561.1 R R Y Y Y 0.59 Mesophilic. Aeromonas salmonicida 53 NC_014541|YP_003914651.1 R R Y Y Y 0.57 Mesophilic Ferrimonas balearica 54 NC_010334|YP_001673131.1 R R Y Y Y 0.57 Psychrophilic Shewanella halifaxensis 55 NC_008345|YP_749334.1 R R Y Y Y 0.57 Mesophilic Shewanella frigidimarina 56 NC_010506|YP_001759384.1 R R Y Y Y 0.56 Mesophilic Shewanelia woodyi 57 NC_009901|YP_001500706.1 R R Y Y Y 0.56 Mesophilic Shewanella pealeana 58 NC_008700|YP_926544.1 R R Y Y Y 0.56 Mesophilic Shewaneiia amazonensis 59 NC_014012|YP_003555527.1 R R Y Y Y 0.55 Psychrophilic Shewanella violacea 60 NC_009092|YP_001092992.1 R R Y Y Y 0.55 Mesophilic Shewaneiia loihica 61 NC_009831|YP_001472684.1 R R Y Y Y 0.55 Psychrophilic Shewanella sediminis 62 NC_007645|YP_435624.1 R R Y Y Y 0.55 Mesophilic Hahella chejuensis 63 NC_007481|YP_341153.1 R R Y Y Y 0.55 Psychrophilic Pseudoalteromonas haloplanktis 64 NC_008321|YP_735470.1 R R Y Y Y 0.55 Mesophilic Shewanella sp. 65 NC_007643|Rru_A0769 R R Y Y Y 0.55 Mesophilic Rhodospirillum rubrum 66 NC_008322|YP_736666.1 R R Y Y Y 0.55 Mesophilic Shewanella sp. 67 NC_017584|YP_006047056.1 R R Y Y Y 0.55 Mesophilic Rhodospirillum rubrum 68 NC_004347|SO_0744 R R Y Y Y 0.54 Mesophilic Shewanella oneidensis 69 NC_008577|YP_871146.1 R R Y Y Y 0.54 Mesophilic Shewanella sp. 70 NC_014803|YP_004069765.1 R R Y Y Y 0.54 Psychrophilic Pseudoalteromonas sp. 71 NC_009997|YP_001556237.1 R R Y Y Y 0.54 Mesophilic Shewanella baltica 72 NC_016901|YP_005275030.1 R R Y Y Y 0.54 Mesophilic Shewanella baltica 73 NC_003910|YP_267761.1 R R Y Y Y 0.53 Psychrophilic Colwellia psychrerythraea 74 NC_017571|YP_006022146.1 R R Y Y Y 0.53 Mesophilic Shewanella baltica 75 NC_011663|YP_002359536.1 R R Y Y Y 0.53 Mesophilic Shewanella baltica 76 NC_012587|YP_002824894.1 R R Y Y Y 0.53 Mesophilic Sinorhizobium fredii 77 NC_016812|YP_005187712.1 R R Y Y Y 0.53 Mesophilic Sinorhizobium fredii 78 NC_009665|YP_001367881.1 R R Y Y Y 0.53 Mesophilic Shewanella baltica 79 NC_009636|YP_001326020.1 R R Y Y Y 0.53 Mesophilic Sinorhizobium medicae 80 NC_017506|YP_005885148.1 R R Y Y Y 0.53 ? Marinobacter adhaerens 81 NC_017322|YP_005712524.1 R R Y Y Y 0.53 Mesophilic Sinorhizobium meliloti 82 NC_020528|SM2011_c00784 R R Y Y Y 0.53 Mesophilic Sinorhizobium meliloti 83 NC_018000|YP_006395735.1 R R Y Y Y 0.53 Mesophilic Sinorhizobium fredii 84 NC_018700|YP_006839225.1 R R Y Y Y 0.53 Mesophilic Sinorhizobium meliloti 85 NC_018268|YP_006557993.1 R R Y Y Y 0.53 Mesophilic Marinobacter sp. 86 NC_011566|VP_002313357.1 R R Y Y Y 0.52 Mesophilic Shewanella piezotolerans 87 NC_017325|YP_005718919.1 R R Y Y Y 0.52 Mesophilic Sinorhizobium meliloti 88 NC_015590|YP_004547809.1 R R Y Y Y 0.52 Mesophilic Sinorhizobium meliloti 89 NC_019845|C770_GR4Chr0719 R R Y Y Y 0.52 Mesophilic Sinorhizobium meliloti 90 NC_017964|YP_006379465.1 R R Y Y Y 0.52 + Mesophilic Advenella kashmirensis 91 NC_003047|NP_384835.1 R R Y Y Y 0.52 Mesophilic Sinorhizobium meliloti 92 NC_008750|YP_962119.1 R R Y Y Y 0.52 Mesophilic Shewanella sp. 93 NC_017566|YP_006011216.1 R R Y Y Y 0.52 Mesophilic Shewanella putrefaciens 94 NC_009438|YP_001184738.1 R R Y Y Y 0.52 Mesophilic Shewanella putrefaciens 95 NC_015259|YP_004305240.1 R R Y Y Y 0.52 Mesophilic Polymorphum gilvum 96 NC_008740|YP_958371.1 R R Y Y Y 0.52 Mesophilic Marinobacter aquaeolei 97 NC_016642|YP_005079787.1 R R Y Y Y 0.52 + Mesophilic Pseudovibrio sp. 98 NC_017067|YP_005430089.1 R R Y Y Y 0.52 Mesophilic Marinobacter hydrocarbonoclast 99 NC_008254|YP_672740.1 R R Y Y Y 0.52 Mesophilic Chelativorans sp. 100 NC_005296|NP_949488.1 R R Y Y Y 0.52 Mesophilic Rhodopseudomonas palustris 101 NC_022535|YP_008631147.1 R R Y Y Y 0.51 + Mesophilic Rhizobium sp. 102 NC_011004|YP_001993597.1 R R Y Y Y 0.51 Mesophilic Rhodopseudomonas palustris 103 NC_015183|YP_004277506.1 R R Y Y Y 0.51 + Mesophilic Agrobacterium sp. 104 NC_007493|RSP_2913 R R Y Y Y 0.51 Mesophilic Rhodobacter sphaeroides 105 NC_003062|NP_353236.2 R R Y Y Y 0.51 + Mesophilic Agrobacterium fabrum 106 NC_009049|YP_001043439.1 R R Y Y Y 0.51 Mesophilic Rhodobacter sphaeroides 107 NC_011963|YP_002525591.1 R R Y Y Y 0.51 Mesophilic Rhodobacter sphaeroides 108 NC_021033|YP_007821259.1 R R Y Y Y 0.51 Mesophilic Taylorella asinigenitalis 109 NC_021036|YP_007825629.1 R R Y Y Y 0.51 Mesophilic Taylorella equigenitalis 110 NC_014914|YP_004129165.1 R R Y Y Y 0.51 Mesophilic Taylorella equigenitalis 111 NC_018108|YP_006502736.1 R R Y Y Y 0.51 Mesophilic Taylorella equigenitalis 112 NC_009428|YP_001167314.1 R R Y Y Y 0.51 Mesophilic Rhodobacter sphaeroides 113 NC_011386|YP_002288119.1 R R Y Y Y 0.5 Mesophilic Oligotropha carboxidovorans 114 NC_017538|YP_005951842.1 R R Y Y Y 0.5 Mesophilic Oligotropha carboxidovorans 115 NC_016043|YP_004874880.1 R R Y Y Y 0.5 Mesophilic Taylorella asinigenitalis 116 NC_010511|YP_001772582.1 R R Y Y Y 0.49 Mesophilic Methylobacterium sp. 117 NC_007778|YP_485084.1 R R Y Y Y 0.49 Mesophilic Rhodopseudomonas palustris 118 NC_014834|YP_004110640.1 R R Y Y Y 0.49 Mesophilic Rhodopseudomonas palustris 119 NC_002927|NP_889482.1 R R Y Y Y 0.49 Mesophilic Bordetella bronchiseptica 120 NC_018828|YP_006896532.1 R R Y Y Y 0.49 Mesophilic Bordetella parapertussis 121 NC_017223|YP_005589733.1 R R Y Y Y 0.48 Mesophilic Bordetella pertussis 122 NC_007958|YP_568577.1 R R Y Y Y 0.48 Mesophilic Rhodopseudomonas palustris 123 NC_018518|YP_006626426.1 R R Y Y Y 0.48 Mesophilic Bordetella pertussis 124 NC_002929|NP_880337.1 R R Y Y Y 0.48 Mesophilic Bordetella pertussis 125 NC_002928|NP_885167.1 R R Y Y Y 0.48 Mesophilic Bordetella parapertussis 126 NC_019382|YP_006966829.1 R R Y Y Y 0.48 Mesophilic Bordetella bronchiseptica 127 NC_018829|YP_006900438.1 R R Y Y Y 0.48 Mesophilic Bordetella bronchiseptica 128 NC_007925|YP_533792.1 R R Y Y Y 0.48 Mesophilic Rhodopseudomonas palustris 129 NC_008435|YP_782979.1 R R Y Y Y 0.48 Mesophilic Rhodopseudomonas palustris 130 NC_011894|YP_002501458.1 R R Y Y Y 0.48 Mesophilic Methylobacterium nodulans 131 NC_017283|YP_005661039.1 R R Y Y Y 0.48 Mesophilic Brucella melitensis 132 NC_010551|YP_001807800.1 R R Y Y Y 0.48 Mesophilic Burkholderia ambifaria 133 NC_015858|YP_004757945.1 R R Y Y Y 0.48 Mesophilic Brucella pinnipedialis 134 NC_014034|YP_003578715.1 R R Y Y Y 0.48 Mesophilic Rhodobacter capsulatus 135 NC_018513|YP_006616387.1 R R Y Y Y 0.48 Mesophilic Burkholderia cepacia 136 NC_009504|YP_001257663.1 R R Y Y Y 0.48 Mesophilic Brucella ovis 137 NC_008390|YP_772986.1 R R Y Y Y 0.48 Mesophilic Burkholderia ambifaria 138 NC_009668|YP_001372359.1 R R Y Y Y 0.48 Mesophilic Ochrobactrum anthropi 139 NC_012442|YP_002734445.1 R R Y Y Y 0.47 Mesophilic Brucella melitensis 140 NC_022535|YP_008631357.1 R R Y Y Y 0.47 + Mesophilic Rhizobium sp. 141 NC_017247|YP_005602286.1 R R Y Y Y 0.47 Mesophilic Brucella melitensis 142 NC_013118|YP_003105477.1 R R Y Y Y 0.47 Mesophilic Brucella microti 143 NC_017245|YP_005598924.1 R R Y Y Y 0.47 Mesophilic Brucella melitensis 144 NC_010104|YP_001594643.1 R R Y Y Y 0.47 Mesophilic Brucella canis 145 NC_010167|YP_001622484.1 R R Y Y Y 0.47 Mesophilic Brucella suis 146 NC_010740|YP_001932452.1 R R Y Y Y 0.47 Mesophilic Brucella abortus 147 NC_022906|V910_200569 R R Y Y Y 0.47 Mesophilic Brucella ceti 148 NC_016777|YP_005114137.1 R R Y Y Y 0.47 Mesophilic Brucella abortus 149 NC_016796|YP_005152703.1 R R Y Y Y 0.47 Mesophilic Brucella canis 150 NC_007624|YP_418727.1 R R Y Y Y 0.47 Mesophilic Brucella abortus 151 NC_006933|YP_223309.1 R R Y Y Y 0.47 Mesophilic Brucella abortus 152 NC_003318|NP_541562.1 R R Y Y Y 0.47 Mesophilic Brucella melitensis 153 NC_008687|YP_918207.1 R R Y Y Y 0.47 + Mesophilic Paracoccus denitrificans 154 NC_010084|YP_001580275.1 R R Y Y Y 0.47 Mesophilic Burkholderia multivorans 155 NC_009937|YP_001525161.1 R R Y Y Y 0.47 Mesophilic Azorhizobium caulinodans 156 NC_010508|YP_001764480.1 R R Y Y Y 0.47 Mesophilic Burkholderia cenocepacia 157 NC_015458|YP_004416353.1 R R Y Y Y 0.47 ? Pusillimonas sp. 158 NC_016775|YP_005108693.1 R R Y Y Y 0.47 Mesophilic Brucella suis 159 NC_014217|YP_003692549.1 R R Y Y Y 0.47 Mesophilic Starkeya novella 160 NC_007510|YP_368558.1 R R Y Y Y 0.47 Mesophilic Burkholderia lata 161 NC_004311|NP_699880.1 R R Y Y Y 0.47 Mesophilic Brucella suis 162 NC_011000|YP_002230239.1 R R Y Y Y 0.47 Mesophilic Burkholderia cenocepacia 163 NC_022043|YP_008406497.1 R R Y Y Y 0.47 + Mesophilic Paracoccus aminophilus 164 NC_008060|YP_620613.1 R R Y Y Y 0.47 Mesophilic Burkholderia cenocepacia 165 NC_003062|NP_353437.2 R R Y Y Y 0.47 + Mesophilic Agrobacterium fabrum 166 NC_008542|YP_834855.1 R R Y Y Y 0.47 Mesophilic Burkholderia cenocepacia 167 NC_015183|YP_004277705.1 R R Y Y Y 0.47 + Mesophilic Agrobacterium sp. 168 NC_014640|YP_003979373.1 R R Y Y Y 0.47 Mesophilic Achromobacter xylosoxidans 169 NC_023061|AX27061_2729 R R Y Y Y 0.46 Mesophilic Achromobacter xylosoxidans 170 NC_021285|YP_008031617.1 R R Y Y Y 0.46 Mesophilic Achromobacter xylosoxidans 171 NC_022659|BBK_250 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 172 NC_014931|YP_004156555.1 R R Y Y Y 0.46 Mesophilic Variovorax paradoxus 173 NC_014010|YP_003552419.1 R R Y Y Y 0.46 Mesophilic Candidatus Puniceispirillum 174 NC_013446|CtCNB1_0418 R R Y Y Y 0.46 Mesophilic Comamonas testosteroni 175 NC_021884|BDL_744 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 176 NC_018527|YP_006652216.1 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 177 NC_006348|YP_103391.1 R R Y Y Y 0.46 Mesophilic Burkholderia mallei 178 NC_008785|YP_992517.1 R R Y Y Y 0.46 Mesophilic Burkholderia mallei 179 NC_008836|YP_001026683.1 R R Y Y Y 0.46 Mesophilic Burkholderia mallei 180 NC_009080|YP_001080034.1 R R Y Y Y 0.46 Mesophilic Burkholderia mallei 181 NC_009076|YP_001065655.1 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 182 NC_012695|YP_002896116.1 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 183 NC_010170|YP_001630893.1 R R Y Y Y 0.46 Mesophilic Bordetella petrii 184 NC_010645|YP_786440.1 R R Y Y Y 0.46 Mesophilic Bordetella avium 185 NC_021173|YP_007919037.1 R R Y Y Y 0.46 Mesophilic Burkholderia thailandensis 186 NC_016078|YP_004898234.1 R R Y Y Y 0.46 + Mesophilic Pelagibacterium halotolerans 187 NC_007651|YP_443368.1 R R Y Y Y 0.46 Mesophilic Burkholderia thailandensis 188 NC_007434|YP_332916.1 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 189 NC_009074|YP_001058421.1 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 190 NC_017831|YP_006275273.1 R R Y Y Y 0.46 Mesophilic Burkholderia pseudomallei 191 NC_022247|VAPA_1c38240 R R Y Y Y 0.45 Mesophilic Variovorax paradoxus 192 NC_012791|YP_002945581.1 R R Y Y Y 0.45 Mesophilic Variovorax paradoxus 193 NC_010510|YP_001767013.1 R R Y Y Y 0.45 Mesophilic Methylobacterium radiotolerans 194 NC_009720|YP_001418646.1 R R Y Y Y 0.45 Mesophilic Xanthobacter autotrophicus 195 NC_017956|YP_006370956.1 R R Y Y Y 0.45 + Mesophilic Tistrella mobilis 196 NC_006350|YP_107899.1 R R Y Y Y 0.45 Mesophilic Burkholderia pseudomallei 197 NC_010725|YP_001923256.1 R R Y Y Y 0.45 Mesophilic Methylobacterium populi 198 NC_018525|YP_006646037.1 R R Y Y Y 0.45 Mesophilic Pectobacterium carotovorum 199 NC_012917|YP_003016929.1 R R Y Y Y 0.45 Mesophilic Pectobacterium carotovorum 200 NC_004547|YP_049576.1 R R Y Y Y 0.45 Mesophilic Pectobacterium atrosepticum 201 NC_012988|YP_003066252.1 R R Y Y Y 0.44 Mesophilic Methylobacterium extorquens 202 NC_012808|YP_002961615.1 R R Y Y Y 0.44 Mesophilic Methylobacterium extorquens 203 NC_010172|YP_001638056.1 R R Y Y Y 0.44 Mesophilic Methylobacterium extorquens 204 NC_010995|YP_001984073.1 R R Y Y Y 0.44 Mesophilic Cellvibrio japonicus 205 NC_014166|YP_003656801.1 R R Y Y Y 0.44 Mesophilic Arcobacter nitrofigilis 206 NC_011757|YP_002419429.1 R R Y Y Y 0.44 Mesophilic Methylobacterium extorquens 207 NC_015061|YP_004212396.1 R R Y Y Y 0.44 + Mesophilic Rahnella sp. 208 NC_017047|YP_005401406.1 R R Y Y Y 0.44 + Mesophilic Rahnella aquatilis 209 NC_017845|YP_006283928.1 R R Y Y Y 0.44 Mesophilic Pectobacterium sp. 210 NC_020418|YP_007504644.1 R R Y Y Y 0.43 + Mesophilic Morganella morganii 211 NC_022997|W911_04275 R R Y Y Y 0.43 + Mesophilic Hyphomicrobium nitrativorans 212 NC_017309|YP_005700102.1 R R Y Y Y 0.43 Mesophilic Edwardsiella tarda 213 NC_020796|ETAC_3335 R R Y Y Y 0.43 Mesophilic Edwardsiella piscicida 214 NC_013889|YP_003459550.1 R R Y Y Y 0.43 + Mesophilic Thioalkalivibrio sp. 215 NC_013421|YP_003260342.1 R R Y Y Y 0.43 Mesophilic Pectobacterium wasabiae 216 NC_018002|YP_006405228.1 R R Y Y Y 0.43 + Mesophilic Sulfurospirillum barnesii 217 NC_012779|YP_002934481.1 R R Y Y Y 0.43 Mesophilic Edwardsiella ictaluri 218 NC_013508|YP_003296812.1 R R Y Y Y 0.43 Mesophilic Edwardsiella tarda 219 NC_018644|YP_006757561.1 R R Y Y Y 0.43 + Mesophilic alpha proteobacterium 220 NC_017192|YP_005554689.1 R R Y Y Y 0.42 Mesophilic Arcobacter sp. 221 NC_003911|SPO3287 R R Y Y Y 0.42 Mesophilic Ruegeria pomeroyi 222 NC_015726|YP_004684614.1 R R Y Y Y 0.42 Mesophilic Cupriavidus necator 223 NC_008044|YP_612119.1 R R Y Y Y 0.42 Mesophilic Ruegeria sp. 224 NC_006513|YP_159824.1 R R Y Y Y 0.42 Mesophilic Aromatoleum aromaticum 225 NC_022513|N234_0870 R R Y Y Y 0.42 Mesophilic Ralstonia pickettii 226 NC_012673|YP_002886303.1 R R Y Y Y 0.42 + Thermophilic Exiguobacterium sp. 227 NC_014759|YP_004053760.1 R R Y Y Y 0.42 Mesophilic Marivirga tractuosa 228 NC_019902|YP_007215684.1 R R Y Y Y 0.42 + Mesophilic Thioalkalivibrio nitratireduce 229 NC_014216|YP_003691508.1 R R Y Y Y 0.42 Mesophilic Desulfurivibrio alkaliphilus 230 NC_018018|YP_006433889.1 R R Y Y Y 0.42 + Mesophilic Flexibacter litoralis 231 NC_017668|YP_006182380.1 R R Y Y Y 0.42 + Mesophilic Halobacillus halophilus 232 NC_013854|YP_003448425.1 R R Y Y Y 0.41 + Mesophilic Azospirillum sp. 233 NC_007908|Rfer_2758 R R Y Y Y 0.41 + Mesophilic Albidiferax ferrireducens 234 NC_006512|YP_155448.1 R R Y Y Y 0.41 Mesophilic Idiomarina loihiensis 235 NC_008781|YP_981845.1 R R Y Y Y 0.41 Mesophilic Polaromonas naphthalenivorans 236 NC_009253|YP_001112883.1 R R Y Y Y 0.41 + Mesophilic Desulfotomaculum reducens 237 NC_016622|YP _005038613.1 R R Y Y Y 0.41 + Mesophilic Azospirillum lipoferum 238 NC_021286|YP_008034563.1 R R Y Y Y 0.41 Mesophilic Idiomarina loihiensis 239 NC_018010|YP_006406798.1 R R Y Y Y 0.41 + Mesophilic Belliella baltica 240 NC_008313|YP_725275.1 R R Y Y Y 0.41 Mesophilic Ralstonia eutropha 241 NC_008702|YP_933709.1 R R Y Y Y 0.41 Mesophilic Azoarcus sp. 242 NC_019738|YP_007124478.1 R R Y Y Y 0.41 + Mesophilic Microcoleus sp. 243 NC_010528|YP_002004788.1 R R Y Y Y 0.41 Mesophilic Cupriavidus taiwanensis 244 NC_015276|YP_004311821.1 R R Y Y Y 0.41 Mesophilic Marinomonas mediterranea 245 NC_320908|YP_007698507.1 R R Y Y Y 0.41 + Mesophilic Octadecabacter arcticus 246 NC_007953|YP_556393.1 R R Y Y Y 0.41 Mesophilic Burkholderia xenovorans 247 NC_023135|METH_00275 R R Y Y Y 0.41 + Mesophilic Leisingera methylohalidivorans 248 NC_017187|YP_005539339.1 R R Y Y Y 0.41 Mesophilic Arcobacter butzleri 249 NC_009850|YP_001490892.1 R R Y Y Y 0.41 Mesophilic Arcobacter butzleri 250 NC_022759|CFT03427_0122 R R Y Y Y 0.41 Mesophilic Campylobacter fetus 251 NC_020514|YP_007544802.1 R R Y Y Y 0.41 + Mesophilic Glaciecola psychrophila 252 NC_021878|YP_00833.1820.1 R R Y Y Y 0.41 Mesophilic Arcobacter butzleri 253 NC_014366|YP_003811659.1 R R Y Y Y 0.41 + Mesophilic gamma proteobacterium 254 NC_007775|YP_475512.1 R R Y Y Y 0.41 Thermophilic Synechococcus sp. 255 NC_007776|YP_478858.1 R R Y Y Y 0.41 Thermophilic Synechococcus sp. 256 NC_018708|YP_006855088.1 R R Y Y Y 0.41 Mesophilic Acidovorax sp. 257 NC_005295|YP_179998.1 R R Y Y Y 0.41 Mesophilic Ehrlichia ruminantium 258 NC_004842|YP_153489.1 R R Y Y Y 0.41 Mesophilic Anaplasma marginale 259 NC_008752|YP_971208.1 R R Y Y Y 0.41 Mesophilic Acidovorax citrulli 260 NC_023065|YP_008937446.1 R R Y Y Y 0.41 + Mesophilic Magnetospirillum gryphiswalden 261 NC_011992|YP_002553562.1 R R Y Y Y 0.4 Mesophilic Acidovorax ebreus 262 NC_012026|YP_002563199.1 R R Y Y Y 0.4 Mesophilic Anaplasma marginale 263 NC_022760|U370_00265 R R Y Y Y 0.4 Mesophilic Anaplasma marginale 264 NC_015422|YP_004389134.1 R R Y Y Y 0.4 Mesophilic Alicycliphilus denitrificans 265 NC_016041|YP_004871348.1 R R Y Y Y 0.4 + Mesophilic Glaciecola nitratireducens 266 NC_014910|YP_004126179.1 R R Y Y Y 0.4 Mesophilic Alicycliphilus denitrificans 267 NC_018012|YP_006413475.1 R R Y Y Y 0.4 + Mesophilic Thiocystis violascens 268 NC_017856|YP_006293166.1 R R Y Y Y 0.4 + Mesophilic Methylophaga frappieri 269 NC_007799|YP_507013.1 R R Y Y Y 0.4 Mesophilic Ehrlichia chaffeensis 270 NC_002978|NP_966643.1 R R Y Y Y 0.4 Mesophilic Wolbachia endosymbiont 271 NC_006831|YP_196049.1 R R Y Y Y 0.4 Mesophilic Ehrlichia ruminantium 272 NC_008825|YP_001020568.1 R R Y Y Y 0.4 Mesophilic Methylibium petroleiphilum 273 NC_008786|YP_997316.1 R R Y Y Y 0.4 Mesophilic Verminephrobacter eiseniae 274 NC_008782|YP_985876.1 R R Y Y Y 0.4 Mesophilic Acidovorax sp. 275 NC_009654|YP_001342590.1 R R Y Y Y 0.4 Mesophilic Martnomonas sp. 276 NC_012039|Cla_1526 R R Y Y Y 0.4 Mesophilic Campylobacter lari 277 NC_011901|YP_002512540.1 R R Y Y Y 0.4 + Mesophilic Thioalkalivibrio sulfidiphilus 278 NC_010002|YP_001565757.1 R R Y Y Y 0.4 Mesophilic Delftia acidovorans 279 NC_022784|U128_00245 R R Y Y Y 0.4 Mesophilic Anaplasma marginale 280 NC_015138|YP_004234852.1 R R Y Y Y 0.4 Mesophilic Acidovorax avenae 281 NC_015677|YP_004619583.1 R R Y Y Y 0.4 Mesophilic Ramlibacter tataouinensis 282 NC_015563|YP_004487487.1 R R Y Y Y 0.4 Mesophilic Delftia sp. 283 NC_016616|YP_005029105.1 R R Y Y Y 0.4 + Mesophilic Dechlorosoma suillim 284 NC_017857|YP_006297460.1 R R Y Y Y 0.4 + Mesophilic. Methylophaga nitratireducentic 285 NC_018721|YP_006868342.1 R R Y Y Y 0.4 + Mesophilic Psychroflexus torquis 286 NC_023137|Gal_03312 R R Y Y Y 0.4 + Mesophilic Phaeobacter gallaeciensis 287 NC_012416|YP_002727371.1 R R Y Y Y 0.4 Mesophilic Wolbachia sp. 288 NC_019748|YP_007133065.1 R R Y Y Y 0.4 + Mesophilic Stanieria cyanosphaera 289 NC_023035|L21SP2_0743 R R Y Y Y 0.4 Hyperthermophilic Spirochaeta sp. 290 NC_020911|YP_007702830.1 R R Y Y Y 0.4 + Mesophilic Octadecabacter antarcticus 291 NC_021089|YP_007889339.1 R R Y Y Y 0.4 Mesophilic Wolbachia endosymbiont 292 NC_017039|YP_005385198.1 R R Y Y Y 0.4 Mesophilic Synechocystis sp. 293 NC_017075|YP_005437539.1 R R Y Y Y 0.4 + Mesophilic Rubrivivax gelatinosus 294 NC_014836|YP_004113366.1 R R Y Y Y 0.4 Mesophilic Desulfurispirillum indicum 295 NC_014323|YP_003775309.1 R R Y Y Y 0.4 Mesophilic Herbaspirillum seropedicae 296 NC_007354|YP_302777.1 R R Y Y Y 0.4 Mesophilic Ehrlichia canis 297 NC_007204|YP_264829.1 R R Y Y Y 0.4 Psychrophilic Psychrobacter arcticus 298 NC_018286|YP_006564286.1 R R Y Y Y 0.4 + Mesophilic Phaeobacter gallaeciensis 299 NC_018290|YP_006574608.1 R R Y Y Y 0.4 + Mesophilic Phaeobacter inhibens 300 NC_000911|NP_440162.1 R R Y Y Y 0.4 Mesophilic Synechocystis sp. 301 NC_009138|YP_001099462.1 R R Y Y Y 0.4 Mesophilic Herminiimonas arsenicoxydans 302 NC_012491|YP_002770441.1 R R Y Y Y 0.39 + Mesophilic Brevibacillus brevis 303 NC_010981|YP_001975438.1 R R Y Y Y 0.39 Mesophilic Wolbachia endosymbiont 304 NC_020908|YP_007697819.1 R R Y Y Y 0.39 + Mesophilic Octadecabacter arcticus 305 NC_017052|YP_005407905.1 R R Y Y Y 0.39 Mesophilic Synechocystis sp. 306 NC_013532|YP_003328084.1 R R Y Y Y 0.39 Mesophilic Anaplasma centrale 307 NC_008599|YP_891325.1 R R Y Y Y 0.39 Mesophilic Campylobacter fetus 308 NC_023063|EMUR_00615 R R Y Y Y 0.39 Mesophilic Ehrlichia muris 309 NC_009952|YP_001533361.1 R R Y Y Y 0.39 Mesophilic Dinoroseobacter shibae 310 NC_011726|YP_002371657.1 R R Y Y Y 0.39 Mesophilic Cyanothece sp. 311 NC_017038|YP_005382028.1 R R Y Y Y 0.39 Mesophilic Synechocystis sp. 312 NC_021661|PSYCG_08920 R R Y Y Y 0.39 Mesophilic Psychrobacter sp. 313 NC_014414|YP_003855886.1 R R Y Y Y 0.39 Mesophilic Parvularcula bermudensis 314 NC_008209|RD1_0916 R R Y Y Y 0.39 Mesophilic Roseobacter denitrificans 315 NC_007948|YP_549904.1 R R Y Y Y 0.39 Mesophilic Polaromonas sp. 316 NC_007969|YP_580989.1 R R Y Y Y 0.39 Psychrophilic Psychrobacter cryohalolentis 317 NC_009659|YP_001353939.1 R R Y Y Y 0.39 Mesophilic Janthinobacterium sp. 318 NC_013161|YP_003137220.1 R R Y Y Y 0.39 Mesophilic Cyanothece sp. 319 NC_019729|YP_007113899.1 R R Y Y Y 0.39 + Mesophilic Oscillatoria nigro-viridis 320 NC_022132|YP_008472938.1 R R Y Y Y 0.39 Mesophilic Campylobacter coli 321 NC_023018|X636_20130 R R Y Y Y 0.39 + Mesophilic Pandoraea sp. 322 NC_011726|YP_002371656.1 R R Y Y Y 0.39 Mesophilic Cyanothece sp. 323 NC_022904|U875_14655 R R Y Y Y 0.39 + Mesophilic Pandoraea pnomenusa 324 NC_015497|YP_004434941.1 R R Y Y Y 0.39 + Mesophilic Glaciecola sp. 325 NC_015559|YP_004480592.1 R R Y Y Y 0.39 Mesophilic Marinomonas posidonica 326 NC_020516|YP_007551100.1 R R Y Y Y 0.39 Mesophilic Azoarcus sp. 327 NC_020417|YP_007501864.1 R R Y Y Y 0.39 + Mesophilic beta proteobacterium 328 NC_021881|YYY_00245 R R Y Y Y 0.39 Mesophilic Anaplasma phagocytophilum 329 NC_022529|YP_008623108.1 R R Y Y Y 0.38 Mesophilic Campylobacter jejuni 330 NC_022362|YP_008561568.1 R R Y Y Y 0.38 Mesophilic Campylobacter jejuni 331 NC_013161|YP_003137221.1 R R Y Y Y 0.38 Mesophilic Cyanothece sp. 332 NC_019738|YP_007124477.1 R R Y Y Y 0.38 + Mesophilic Microcoleus sp. 333 NC_009839|YP_001481745.1 R R Y Y Y 0.38 Mesophilic Campylobacter jejuni 334 NC_020911|YP_007706474.1 R R Y Y Y 0.38 + Mesophilic Octadecabacter antarcticus 335 NC_019936|YP_007238420.1 R R Y Y Y 0.38 Mesophilic Pseudomonas stutzeri 336 NC_016617|YP_005030415.1 R R Y Y Y 0.38 + Mesophilic Azospirillum brasilense 337 NC_021879|YYU_00250 R R Y Y Y 0.38 Mesophilic Anaplasma phagocytophilum 338 NC_021880|WSQ_00245 R R Y Y Y 0.38 Mesophilic Anaplasma phagocytophilum 339 NC_014634|YP_003968941.1 R R Y Y Y 0.38 Mesophilic Ilyobacter polytropus 340 NC_007298|YP_284282.1 R R Y Y Y 0.38 Mesophilic Dechloromonas aromatica 341 NC_007797|YP_504684.1 R R Y Y Y 0.38 Mesophilic Anaplasma phagocytophilum 342 NC_018709|YP_006857279.1 R R Y Y Y 0.38 Mesophilic Campylobacter jejuni 343 NC_007798|YP_505908.1 R R Y Y Y 0.38 Mesophilic Neorickettsia sennetsu 344 NC_002163|YP_002343633.1 R R Y Y Y 0.38 Mesophilic Campylobacter jejuni 345 NC_013166|YP_003147637.1 R R Y Y Y 0.38 Mesophilic Kangiella koreensis 346 NC_009925|YP_001514473.1 R R Y Y Y 0.38 Mesophilic Acaryochloris marina 347 NC_011662|YP_002889566.1 R R Y Y Y 0.38 Mesophilic Thauera sp. 348 NC_019683|YP_007069953.1 R R Y Y Y 0.38 + Mesophilic Leptolyngbya sp. 349 NC_021084|YP_007885545.1 R R Y Y Y 0.38 Mesophilic Wolbachia endosymbiont 350 NC_015730|YP_004692622.1 R R Y Y Y 0.38 Mesophilic Roseobacter litoralis 351 NC_015672|YP_004603167.1 R R Y Y Y 0.38 Thermophilic Flexistipes sinusarabici 352 NC_018267|YP_006555929.1 R R Y Y Y 0.38 Mesophilic Wolbachia endosymbiont 353 NC_008340|YP_743404.1 R R Y Y Y 0.38 Mesophilic Alkalilimnicola ehrlichii 354 NC_009524|YP_001279771.1 R R Y Y Y 0.38 Mesophilic Psychrobacter sp. 355 NC_019567|YP_007024115.1 R R Y Y Y 0.38 + Mesophilic Bdellovibrio bacteriovorus 356 NC_017506|YP_005887535.1 R R Y Y Y 0.38 ? Marinobacter adhaerens 357 NC_019776|YP_007162494.1 R R Y Y Y 0.38 + Mesophilic Cyanobacterium aponinum 358 NC_015740|YP_004716401.1 R R Y Y Y 0.38 Mesophilic Pseudomonas stutzeri 359 NC_007802|YP_508060.1 R R Y Y Y 0.38 Mesophilic Jannaschia sp. 360 NC_006576|YP_172630.1 R R Y Y Y 0.38 Mesophilic Synechococcus elongatus 361 NC_006833|YP_198228.1 R R Y Y Y 0.38 Mesophilic Wolbachia endosymbiont 362 NC_008789|YP_001002765.1 R R Y Y Y 0.38 Mesophilic Halorhodospira halophila 363 NC_010475|YP_001735740.1 R R Y Y Y 0.37 Thermophilic Synechococcus sp. 364 NC_009719|YP_001411459.1 R R Y Y Y 0.37 Mesophilic Parvibaculum lavamentivorans 365 NC_013515|YP_003306318.1 R R Y Y Y 0.37 Mesophilic Streptobacillus moniliformis 366 NC_014532|YP_003899070.1 R R Y Y Y 0.37 Mesophilic Halomonas elongata 367 NC_007404|YP_314748.1 R R Y Y Y 0.37 Mesophilic Thiobacillus denitrificans 368 NC_008228|YP_661172.1 R R Y Y Y 0.37 Mesophilic Pseudoalteromonas atlantica 369 NC_009434|PST_4066 R R Y Y Y 0.37 Mesophilic Pseudomonas stutzeri 370 NC_009654|YP_001342678.1 R R Y Y Y 0.37 Mesophilic Marinomonas sp. 371 NC_022660|N149_1535 R R Y Y Y 0.37 Mesophilic Campylobacter coli 372 NC_017280|YP_005657152.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 373 NC_017279|YP_005655535.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 374 NC_019695|YP_007092604.1 R R Y Y Y 0.37 + Mesophilic Chroococcidiopsis thermalis 375 NC_022351|YP_008538079.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 376 NC_022352|YP_008539796.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 377 NC_019978|YP_007314869.1 R R Y Y Y 0.37 + Mesophilic Halobacteroides halobius 378 NC_007614|YP_4U431.1 R R Y Y Y 0.37 Mesophilic Nitrosospira multiformis 379 NC_008312|YP_722952.1 R R Y Y Y 0.37 Mesophilic Trichodesmium erythraeum 380 NC_003912|YP_178192.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 381 NC_018028|YP_006455879.1 R R Y Y Y 0.37 Mesophilic Pseudomonas stutzeri 382 NC_017281|YP_005658777.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 383 NC_022347|YP_008534235.1 R R Y Y Y 0.37 Mesophilic Campylobacter coli 384 NC_013009|YP_003081241.1 R R Y Y Y 0.37 Mesophilic Neorickettsia risticii 385 NC_022353|YP_008541533.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 386 NC_019566|YP_007020209.1 R R Y Y Y 0.37 Mesophilic Candidatus Endolissoclinum 387 NC_010524|YP_001791320.1 R R Y Y Y 0.37 Mesophilic Leptothrix cholodnii 388 NC_015380|YP_004358590.1 R R Y Y Y 0.37 Mesophilic Candidatus Pelagibacter 389 NC_021834|M635_05205 R R Y Y Y 0.37 Mesophilic Vibrio parahaemolyticus 390 NC_019779|YP_007169582.1 R R Y Y Y 0.37 + Mesophilic Halothece sp. 391 NC_007604|YP_401192.1 R R Y Y Y 0.37 Mesophilic Synechococcus elongatus 392 NC_009707|YP_001397430.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 393 NC_008261|YP_694897.1 R R Y Y Y 0.37 + Mesophilic Clostridium perfringens 394 NC_013177|YP_006526031.1 R R Y Y Y 0.37 Mesophilic Pseudomonas stutzeri 395 NC_018521|YP_006632382.1 R R Y Y Y 0.37 Mesophilic Campylobacter jejuni 396 NC_017532|YP_005940813.1 R R Y Y Y 0.37 Mesophilic Pseudomonas stutzeri 397 NC_014147|YP_003626460.1 R R Y Y Y 0.36 Mesophilic Moraxella catarrhalis 398 NC_007298|YP_284426.1 R R Y Y Y 0.36 Mesophilic Dechloromonas aromatica 399 NC_003366|NP_561354.1 R R Y Y Y 0.36 + Mesophilic Clostridium perfringens 400 NC_015410|YP_004378171.1 R R Y Y Y 0.36 Mesophilic Pseudomonas mendocina 401 NC_015581|YP_004537902.1 R R Y Y Y 0.36 Mesophilic Thioalkalimicrobium cyclicum 402 NC_007205|YP_266646.1 R R Y Y Y 0.36 Mesophilic Candidatus Pelagibacter 403 NC_007963|YP_572610.1 R R Y Y Y 0.36 Mesophilic Chromohalobacter salexigens 404 NC_008787|YP_999899.1 R R Y Y Y 0.36 Mesophilic Campylobacter jejuni 405 NC_008347|YP_756198.1 R R Y Y Y 0.36 Mesophilic Maricaulis maris 406 NC_012559|LHK_02634 R R Y Y Y 0.36 Mesophilic Laribacter hongkongensis 407 NC_022360|M802.5393 R R Y Y Y 0.36 Mesophilic Pseudomonas aeruginosa 408 NC_019701|YP_007102660.1 R R Y Y Y 0.36 + Mesophilic Pseudanabaena sp. 409 NC_019702|YP_007105817.1 R R Y Y Y 0.36 Thermophilic Synechococcus sp. 410 NC_010546|YP_001804046.1 R R Y Y Y 0.36 Mesophilic Cyanothece sp. 411 NC_022806|PA1R_gp3150 R R Y Y Y 0.36 Mesophilic Pseudomonas aeruginosa 412 NC_015379|YP_004356944.1 R R Y Y Y 0.36 Mesophilic Pseudomonas brassicacearum 413 NC_019905|YP_007231935.1 R R Y Y Y 0.36 Mesophilic Pseudomonas putida 414 NC_020829|YP_007655716.1 R R Y Y Y 0.36 Mesophilic Pseudomonas denitrificans 415 NC_013771|UCYN_05550 R R Y Y Y 0.36 Mesophilic Candidatas Atelocyanobacterium 416 NC_018691|YP_006818918.1 R R Y Y Y 0.36 + Mesophilic Alcanivorax dieselolei 417 NC_007604|YP_400426.1 R R Y Y Y 0.36 Mesophilic Synechococcus elongatus 418 NC_018220|YP_006535054.1 R R Y Y Y 0.36 Mesophilic Pseudomonas putida 419 NC_002516|PA5217 R R Y Y Y 0.36 Mesophilic Pseudomonas aeruginosa 420 NC_006138|YP_065132.1 R R Y Y Y 0.36 Psychrophilic Desulfotalea psychrophila 421 NC_005085|CV1902 R R Y Y Y 0.36 Mesophilic Chromobacterium violaceum 422 NC_006576|YP_170856.1 R R Y Y Y 0.36 Mesophilic Synechococcus elongatus 423 NC_018080|YP_006485484.1 R R Y Y Y 0.36 Mesophilic Pseudomonas aeruginosa 424 NC_009512|YP_001270405.1 R R Y Y Y 0.36 Mesophilic Pseudomonas putida 425 NC_023076|X970_24575 R R Y Y Y 0.36 Mesophilic Pseudomonas monteilii 426 NC_008463|YP_793689.1 R R Y Y Y 0.36 Mesophilic Pseudomonas aeruginosa 427 NC_023066|T223_28685 R R Y Y Y 0.36 Mesophilic Pseudomonas aeruginosa 428 NC_011770|YP_002443189.1 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 429 NC_022594|N297_5395 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 430 NC_017080|YP_005446529.1 R R Y Y Y 0.35 + Mesophilic Phycisphaera mikurensis 431 NC_013194|YP_003167150.1 R R Y Y Y 0.35 Mesophilic Candidatas Accumulibacter 432 NC_023019|U769_28730 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 433 NC_010501|YP_001751866.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 434 NC_020813|YP_007644977.1 R R Y Y Y 0.35 + Mesophilic Bdellovibrio exovorus 435 NC_021577|M062_27505 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 436 NC_007577|YP_397756.1 R R Y Y Y 0.35 Mesophilic Prochlorococcus marinus 437 NC_008260|YP_694317.1 R R Y Y Y 0.35 + Mesophilic Alcanivorax borkumensis 438 NC_017548|YP_005977914.1 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 439 NC_017530|YP_005932744.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 440 NC_012560|YP_002801810.1 R R Y Y Y 0.35 Mesophilic Azotobacter vinelandii 441 NC_011884|YP_002484191.1 R R Y Y Y 0.35 Mesophilic Cyanothece sp. 442 NC_012660|YP_002875363.1 R R Y Y Y 0.35 Mesophilic Pseudomonas fluorescens 443 NC_022738|PVLB_24670 R R Y Y Y 0.35 Mesophilic Pseudomonas sp. 444 NC_019670|YP_007032226.1 R R Y Y Y 0.35 Mesophilic Pseudomonas sp. 445 NC_019680|YP_007060009.1 R R Y Y Y 0.35 Thermophilic Synechococcus sp. 446 NC_015222|YP_004294728.1 R R Y Y Y 0.35 Mesophilic Nitrosomonas sp. 447 NC_021150|YP_007900667.1 R R Y Y Y 0.35 Mesophilic Azotobacter vinelandii 448 NC_015733|YP_004704456.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 449 NC_017038|YP_005384390.1 R R Y Y Y 0.35 Mesophilic Synechocystis sp. 450 NC_017039|YP_005387559.1 R R Y Y Y 0.35 Mesophilic Synechocystis sp. 451 NC_021237|YP_008003151.1 R R Y Y Y 0.35 Mesophilic Pseudomonas protegens 452 NC_021499|YP_008105776.1 R R Y Y Y 0.35 Mesophilic Pseudomonas resinovorans 453 NC_016002|YP_004846419.1 R R Y Y Y 0.35 + Mesophilic Pseudogulbenkiania sp. 454 NC_017986|YP_006386336.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 455 NC_002947|NP_747297.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 456 NC_005773|YP_272537.1 R R Y Y Y 0.35 Mesophilic Pseudomonas syringae 457 NC_004129|YP_263022.1 R R Y Y Y 0.35 Mesophilic Pseudomonas protegens 458 NC_009656|YP_001351278.1 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 459 NC_009465|YP_001219493.1 R R Y Y Y 0.35 Mesophilic Candidatus Vesicomyosocius 460 NC_023075|969_24940 R R Y Y Y 0.35 Mesophilic Pseudomonas monteilii 461 NC_022591|N296_5395 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 462 NC_022361|M801_5260 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 463 NC_010322|YP_001671474.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 464 NC_022808|PA1S_gp3150 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 465 NC_020912|YP_007712322.1 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 466 NC_017052|YP_005410266.1 R R Y Y Y 0.35 Mesophilic Synechocystis sp. 467 NC_021291|YP_008046709.1 R R Y Y Y 0.35 + Mesophilic Spiribacter salinus 468 NC_021491|L483_31150 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 469 NC_016830|YP_005211024.1 R R Y Y Y 0.35 Mesophilic Pseudomonas fluorescens 470 NC_014501|YP_003887996.1 R R Y Y Y 0.35 Mesophilic Cyanothece sp. 471 NC_021505|YP_008116305.1 R R Y Y Y 0.35 Mesophilic Pseudomonas putida 472 NC_008027|YP_610714.1 R R Y Y Y 0.35 Mesophilic Pseudomonas entomophila 473 NC_000911|NP_442521.1 R R Y Y Y 0.35 Mesophilic Synechocystis sp. 474 NC_004757|NP_841102.1 R R Y Y Y 0.35 Mesophilic Nitrosomonas europaea 475 NC_017549|YP_005984172.1 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 476 NC_023149|SCV20265_5937 R R Y Y Y 0.35 Mesophilic Pseudomonas aeruginosa 477 NC_010296|YP_001660682.1 R R Y Y Y 0.34 Mesophilic Microcystis aeruginosa 478 NC_021149|YP_007895619.1 R R Y Y Y 0.34 Mesophilic Azotobacter vinelandii 479 NC_015731|YP_004694426.1 R R Y Y Y 0.34 Mesophilic Nitrosomonas sp. 480 NC_015556|YP_004472575.1 R R Y Y Y 0.34 Mesophilic Pseudomonas fulva 481 NC_004578|NP_790164.1 R R Y Y Y 0.34 Mesophilic Pseudomonas syringae 482 NC_008816|YP_001009743.1 R R Y Y Y 0.34 Mesophilic Prochlorococcus marinus 483 NC_008817|YP_001011645.1 R R Y Y Y 0.34 Mesophilic Prochlorococcus marinus 484 NC_022664|SPICUR_06490 R R Y Y Y 0.34 + Mesophilic Spiribacter sp. 485 NC_007492|YP_351158.1 R R Y Y Y 0.34 Mesophilic Pseudomonas fluorescens 486 NC_017911|YP_006326554.1 R R Y Y Y 0.34 Mesophilic Pseudomonas fluorescens 487 NC_018643|YP_006756812.1 R R Y Y Y 0.34 + Mesophilic alpha proteobacterium 488 NC_009482|YP_001227890.1 R R Y Y Y 0.34 Thermophilic Synechococcus sp. 489 NC_012032|Chy400_0349 R R Y Y Y 0.34 Mesophilic Chloroflexus sp. 490 NC_007005|YP_233355.1 R R Y Y Y 0.34 Mesophilic Pseudomonas syringae 491 NC_004113|NP_681303.1 R R Y Y Y 0.34 + Thermophilic Thermosynechococcus elongatus 492 NC_008319|YP_730750.1 R R Y Y Y 0.34 Thermophilic Synechococcus sp. 493 NC_023064|U771_3037S R R Y Y Y 0.34 Mesophilic Pseudomonas sp. 494 NC_012881|YP_002993137.1 R R Y Y Y 0.34 + Mesophilic Desulfovibrio salexigens 495 NC_023033|NK55_11575 R R Y Y Y 0.34 + Mesophilic Thermosynechococcus sp. 496 NC_019780|YP_007173026.1 R R Y Y Y 0.34 + Mesophilic Dactylococcopsis salina 497 NC_005072|NP_893281.1 R R Y Y Y 0.34 Mesophilic Prochlorococcus marinus 498 NC_009482|YP_001227889.1 R R Y Y Y 0.34 Thermophilic Synechococcus sp. 499 NC_008610|YP_903912.1 R R Y Y Y 0.34 Mesophilic Candidatus Ruthia 500 NC_011729|YP_002376116.1 R R Y Y Y 0.33 Mesophilic Cyanothece sp. 501 NC_010175|Caur_0325 R R Y Y Y 0.33 Thermophilic Chloroflexus aurantiacus 502 NC_019689|YP_007080757.1 R R Y Y Y 0.33 + Mesophilic Pleurocapsa sp. 503 NC_020209|YP_007399509.1 R R Y Y Y 0.33 Mesophilic Pseudomonas poae 504 NC_019778|YP_007165071.1 R R Y Y Y 0.33 + Mesophilic Cyanobacterium stanieri 505 NC_009840|YP_001484574.1 R R Y Y Y 0.33 Mesophilic Prochlorococcus marinus 506 NC_009976|YP_001551140.1 R R Y Y Y 0.33 Mesophilic Prochlorococcus marinus 507 NC_005070|NP_897888.1 R R Y Y Y 0.33 Thermophilic Synechococcus sp. 508 NC_013173|YP_003157279.1 R R Y Y Y 0.33 Mesophilic Desulfomicrobium baculatum 509 NC_007516|YP_381882.1 R R Y Y Y 0.33 Thermophilic Synechococcus sp. 510 NC_022579|YP_008685335.1 R R Y Y Y 0.32 + Mesophilic Desulfovibrio hydrothermalis 511 NC_020055|YP_007326536.1 R R Y Y Y 0.32 + Mesophilic Desulfovibrio hydrothermalis 512 NC_007498|YP_006716608.1 R R Y Y Y 0.32 Mesophilic Pelobacter carbinolicus 513 NC_008819|YP_001015440.1 R R Y Y Y 0.32 Mesophilic Prochlorococcus marinus 514 NC_009091|YP_001091585.1 R R Y Y Y 0.32 Mesophilic Prochlorococcus marinus 515 NC_007513|YP_378003.1 R R Y Y Y 0.32 Thermophilic Synechococcus sp. 516 NC_007335|YP_291968.1 R R Y Y Y 0.32 Mesophilic Prochlorococcus marinus 517 NC_008820|YP_001018048.1 R R Y Y Y 0.32 Mesophilic Prochlorococcus marinus 518 NC_008358|YP_761373.1 R R Y Y Y 0.32 Mesophilic Hyphomonas neptunium 519 NC_019675|YP_007047725.1 R R Y Y Y 0.32 + Mesophilic Cyanobium gracile 520 NC_005071|NP_894120.1 R R Y Y Y 0.31 Mesophilic Prochlorococcus marinus 521 NC_009481|YP_001225531.1 R R Y Y Y 0.3 Thermophilic Synechococcus sp. 522 NC_005042|Pro1272 R R Y Y Y 0.3 Mesophilic Prochlorococcus marinus 523 NC_014355|YP_003796723.1 R R Y Y Y 0.27 Mesophilic Candidatus Nitrospira

    [0556] The ttFeBP5 sequence homologs contained 626 hits for which the PCS was off by one residue (H=1). Of these, 522 corresponded to all the hits predicted to be Fe.sup.IIIHCO.sub.3 binding proteins in the mhFeBP1 homolog family (i.e. H=0). Similarly, of the 142 hits identified in hmFeBP1 sequence homologs with one PCS residue missing (H=1), 70 were identified as H=0 sequences in the ttFeBP5 homolog family. These observations clearly supports that there are two subtly different schemes for coordinating Fe.sup.III, which can both be identified using a PCS filter with the appropriate positional information.

    TABLE-US-00011 TABLE 3 ttFeBP5 homologs. # Name 30 120 162 219 220 Identity Gram Temperature Organism 1 4ELR| R R Y Y Y 2 NC_006461|YP_144894.1 R R Y Y Y 1 Thermophilic Thermus thermophilus 3 NC_005835|YP_005233.1 R R Y Y Y 0.99 Thermophilic Thermus thermophilus 4 NC_017587|YP_006058112.1 R R Y Y Y 0.95 Thermophilic Thermus thermophilus 5 NC_017272|YP_005641170.1 R R Y Y Y 0.93 Thermophilic Thermus thermophilus 6 NC_014974|YP_004203468.1 R R Y Y Y 0.84 Thermophilic Thermus scotoductus 7 NC_017278|YP_005653498.1 R R Y Y Y 0.83 Mesophilic Thermus sp. 8 NC_019386|YP_006971576.1 R R Y Y Y 0.82 Mesophilic Thermus oshimai 9 NC_013946|YP_003507791.1 R R Y Y Y 0.67 + Thermophilic Meiothermus ruber 10 NC_015387|YP_004366938.1 R R Y Y Y 0.57 Thermophilic Marinithermus hydrothermalis 11 NC_019793|YP_007180090.1 R R Y Y Y 0.55 + Mesophilic Deinococcus peraridilitoris 12 NC_014212|YP_003686074.1 R R Y Y Y 0.54 + Thermophilic Meiothermus silvanus 13 NC_014032|YP_003572493.1 R R Y Y Y 0.52 Mesophilic Salinibacter ruber 14 NC_007677|YP_446499.1 R R Y Y Y 0.52 Mesophilic Salinibacter ruber 15 NC_015161|YP_004256093.1 R R Y Y Y 0.5 + Mesophilic Deinococcus proteolyticus 16 NC_012526|YP_002786654.1 R R Y Y Y 0.49 + Mesophilic Deinococcus deserti 17 NZ_AOLM00000000|WP_007274470.1 R R Y Y Y 0.34 + Mesophilic Haloferax sulfurifontis 18 NZ_AOLP00000000|WP_004970546.1 R R Y Y Y 0.34 + Mesophilic Haloferax denitrificans 19 NC_014729|YP_004036524.1 R R Y Y Y 0.34 Mesophilic Halogeometricum borinquense 20 NC_013967|YP_003535749.1 R R Y Y Y 0.33 + Mesophilic Haloferax volcanii 21 NZ_AOLL00000000|WP_006600212.1 R R Y Y Y 0.33 + Mesophilic Haloferax alexandrinus 22 NZ_AOLI00000000|WP_004976562.1 R R Y Y Y 0.33 + Mesophilic Haloferax gibbonsii 23 NZ_AOLH00000000|WP_004063130.1 R R Y Y Y 0.33 + Mesophilic Haloferax lucentense 24 NZ_AOLE00000000|WP_008574569.1 R R Y Y Y 0.33 + Mesophilic Haloferax sp. 25 NC_017941|HFX_1795 R R Y Y Y 0.33 + Mesophilic Haloferax mediterranei 26 NZ_AOLF00000000|WP_008574569.1 R R Y Y Y 0.33 + Mesophilic Haloferax sp. 27 NZ_AOLD00000000|WP_008574569.1 R R Y Y Y 0.33 + Mesophilic Haloferax sp. 28 NZ_ARPY01000000|WP_021054224.1 R R Y Y Y 0.33 Mesophilic Haloquadratum walsbyi 29 NZ_AOLG00000000|WP_008093701.1 R R Y Y Y 0.33 + Mesophilic Haloferax prahovense 30 NZ_AOLI00000000|WP_007540595.1 R R Y Y Y 0.32 + Mesophilic Haloferax larsenii 31 NZ_AOLK00000000|WP_008324506.1 R R Y Y Y 0.32 + Mesophilic Haloferax elongans 32 NZ_AOLN00000000|WP_008317080.1 R R Y Y Y 0.32 + Mesophilic Haloferax mucosum 33 NC_021716|YP_008191219.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 34 NC_021710|YP_008170211.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 35 NC_021712|YP_008174294.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 36 NC_021717|YP_008194574.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 37 NC_023045|I533_00730 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 38 NC_021713|YP_008178099.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 39 NC_021714|YP_008182148.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 40 NC_019393|YP_006975038.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 41 NC_011138|MADE_1000805 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 42 NC_008212|YP_658265.1 R R Y Y Y 0.32 Mesophilic Haloquadratum walsbyi 43 NC_018679|YP_006801087.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 44 NC_018692|YP_006823164.1 R R Y Y Y 0.32 Mesophilic Alteromonas macleodii 45 NC_018632|YP_006746238.1 R R Y Y Y 0.31 Mesophilic Alteromonas macleodii 46 NC_018678|YP_006797203.1 R R Y Y Y 0.31 Mesophilic Alteromonas macleodii 47 NZ_AOLZ00000000|WP_007140174.1 R R Y Y Y 0.31 + Mesophilic Halobiforma lacisaisi 48 NC_017857|YP_006294772.1 R R Y Y Y 0.31 + Mesophilic Methylophaga nitratireducentic 49 NC_015554|YP_004468950.1 R R Y Y Y 0.31 Mesophilic Alteromonas sp. 50 NZ_AOID00000000|WP_006430814.1 R R Y Y Y 0.31 + Mesophilic Natrinema versiforme 51 NC_020388|YP_007488351.1 R R Y Y Y 0.31 + Mesophilic Natronomonas moolapensis 52 NC_014297|YP_003737103.1 R R Y Y Y 0.3 N/a Mesophilic Halalkalicoccus jeotgali 53 NZ_AOJH00000000|WP_008848743.1 R R Y Y Y 0.3 + Mesophilic Halorubrum kocurii 54 NZ_AOJK00000000|WP_008444444.1 R R Y Y Y 0.3 + Mesophilic Halorubrum californiensis 55 NZ_AOJ100000000|WP_006111552.1 R R Y Y Y 0.3 + Mesophilic Halorubrum coriense 56 NC_021313|YP_008054586.1 R R Y Y Y 0.3 + Mesophilic Salinarchaeum sp. 57 NC_007481|P_340128.1 R R Y Y Y 0.3 Psychrophilic Pseudoalteromonas haloplanktis 58 NZ_AOJF00000000|WP_004598669.1 R R Y Y Y 0.3 + Mesophilic Halorubrum litoreum 59 NZ_AOIW00000000|WP_004598669.1 R R Y Y Y 0.3 + Mesophilic Halorubrum terrestre 60 NZ_AOJN00000000|WP_004598669.1 R R Y Y Y 0.3 + Mesophilic Halorubrum distributum 61 NZ_AOJJ00000000|WP_004598669.1 R R Y Y Y 0.3 + Mesophilic Halorubrum arcis 62 NC_014803|YP_004068662.1 R R Y Y Y 0.3 Psychrophilic Pseudoalteromonas sp. 63 NZ_AOJI00000000|WP_008002218.1 R R Y Y Y 0.29 + Mesophilic Halorubrum aidingense 64 NZ_AGCY01000000|WP_021043411.1 R R Y Y Y 0.29 + Mesophilic halophilic archaeon 65 NC_012029|YP_002564837.1 R R Y Y Y 0.29 + Mesophilic Halorubrum lacusprofundi 66 NZ_AOJD00000000|WP_006629340.1 R R Y Y Y 0.29 + Mesophilic Halorubrum tebenquichense 67 NZ_AOIQ00000000|WP_007702269.1 R R Y Y Y 0.29 + Mesophilic Halovivax asiaticus 68 NC_019964|YP_007285378.1 R R Y Y Y 0.29 + Mesophilic Halovivax ruber 69 NZ_AOJG00000000|WP_008005399.1 R R Y Y Y 0.29 + Mesophilic Halorubrum lipolyticum 70 NZ_AOJO00000000|WP_008582685.1 R R Y Y Y 0.29 + Mesophilic Halorubrum hochstenium 71 NZ_AOIA00000000|WP_008420339.1 R R Y Y Y 0.29 + Mesophilic Natronococcus jeotgali

    Example 3. Sensor Engineering Phase 2: Lead Protein Validation Using Ligand-Mediated Thermostability Shifts

    [0557] The ligand-binding properties of the proteins selected were determined experimentally. These experiments comprise four successive steps: [0558] 1. Synthetic gene construction. The amino acid sequence of the homology leads are backtranslated into DNA sequences. These are optimized for directing heterologous cytoplasmic expression of the protein homologues in E. coli, using either the OrfOpt or OrfMorph programs. These programs predict mRNA sequences that direct high-level protein expression in E. coli. The predicted gene sequences are assembled de novo from synthetic oligonucleotides. [0559] 2. Heterologous protein expression of the homologues in E. coli. Plasmids carrying the synthetic expression constructs (see above) were transformed into KRX E. coli K12 derivative strain) competent cells (Promega, Technical Bulletin TB352). Protein production was induced in bacterial cultures of these cultures, as described in the Materials and Methods. [0560] 3. Purification of successfully expressed protein using immobilized metal affinity chromatography, as described in Materials and Methods. [0561] 4. Verification of ligand binding. Determination of the ligand-binding properties of the purified proteins using a thermal stability shift assay, as described in Materials and Methods.

    [0562] Lead Verification by Thermal Shift Analysis of Bicarbonate-Calcium Binding Proteins.

    [0563] The lead sequence and five additional homologs with identical PCS sequences (i.e. H=0) were selected, probing different degrees of sequence identity with the seed (FIG. 5). Synthetic genes with open reading frames optimized for heterologous protein over-expression in Escherichia coli using OrfOpt (Allert, Cox and Hellinga 2010) were synthesized for each lead. Three of the six leads produced soluble protein in a T7 expression system in sufficient quantity for functional analysis. The proteins were purified by immobilized metal affinity chromatography via a hexa-histidine tag fused to their carboxy-terminus. Bicarbonate binding was tested in a thermal stability shift assay (Layton and Hellinga 2010). All leads bound bicarbonate, and not nitrate (Table 4). The bicarbonate-binding protein from Anabaena variabilis (avBicarbBP5) was selected for further engineering.

    TABLE-US-00012 TABLE 4 Ligand-binding and thermostability properties of synBicarbBP homologs. Thermo- Ligand NCBI Accession codes Soluble stability.sup.c binding.sup.d Name Organism Genome Protein Identity.sup.a Expression.sup.b .sup.apoT.sub.m (C.) Bicarbonate Nitrate synBicarbBP1 Synechocystis sp. NC_017052 YP_005410477.1 1 n teBicarbBP2 Thermosynechococcus elongatus NC_004113 NP_682790.1 0.83 n ctBicarbBP3 Chroococcidiopsis thermalis NC_019695 YP_007090308.1 0.67 y 86 y n calBicarbBP4 Calothrix sp. NC_019751 YP_007137061.1 0.65 y 89 y n avBicarbBP5 Anabaena variabilis NC_007413 YP_321546.1 0.66 y 82 y n cmBicarbBP6 Chamaesiphon minutus NC_019697 YP_007099445.1 0.63 n .sup.aNumber of identical residues shared with the probe sequence. .sup.bJudged by SDS gel electrophoresis of the soluble fraction of a total lysate. .sup.cDetermined in a Roche LightCycler, using SYPRO Orange to monitor the appearance of unfolded protein. .sup.dDetermined by monitoring an increase in the thermostability of the protein in the presence of ligand.

    [0564] Lead Verification by Thermal Shift Analysis of Ferric-Bicarbonate Binding Proteins.

    [0565] For each of the two leads, the lead and three sequence homologs with identical PCS sequences were selected (FIG. 6). Synthetic genes with open reading frames optimized for heterologous protein over-expression in Escherichia coli using OrfMorph (see Materials and Methods) were synthesized for each lead. Six of the eight leads produced soluble protein in a T7 expression system in sufficient quantity for functional analysis (FIG. 6). The two leads from the ttFeBP5-seeded search precipitated upon storage. The proteins were purified by immobilized metal affinity chromatography via a hexa-histidine tag fused to their carboxy-terminus. Bicarbonate binding was tested in a thermal stability shift assay (Layton and Hellinga 2010). All four soluble leads bound bicarbonate (Table 5). The bicarbonate-binding protein from Thermosynechococcus elongatus (teFeBP3) was selected for further engineering. It is noteworthy that function was predicted accurately for homologs of considerably less than 60% sequence identity (the lowest is 26%), which is considered the lower limit for predicted function conservation on overall homology alone (Todd 2001, Tian 2003). The PCS-based method therefore is a powerful for the prediction of functional conservation in distantly related proteins.

    TABLE-US-00013 TABLE 5 Ligand-binding and thermostability properties of FeBP homologs. Thermo- NCBI Accession codes Soluble stability.sup.d Bicarbonate Probe.sup.a Name Organism Genome Protein Identity.sup.b Expression.sup.c .sup.apoT.sub.m (C) binding.sup.e lsiO mhFeBP1 Mannheimia haemolytica NC_0121082 YP_007884192.1 1 y ~50.sup.f y exiFeBP2 Exiguobacterium sp. NC_012673 YP_002886303.1 0.41 y .sup.37 y teFeBP3 Thermosynechoccus elongatus NC_004113 NP_681303.1 0.34 y .sup.67 y cnFeBP4 Candidatus nitrospira NC_014355 YP_003796723.1 0.26 y ~50.sup.g .sup.y.sup.g 4elr ttFeBP5 Thermus thermophilus NC_006461 YP_144894.1 1 .sup.y.sup.h msFeBP6 Meiothermus silvanus NC_014212 YP_003686074.1 0.54 .sup.y.sup.h srFeBP7 Salinibacter ruber NC_014032 YP_003572493.1 0.52 n hlFeBP8 Halorubrum lacusprofundi NC_012029 YP_002564837.1 0.31 n .sup.aPDB accession of the probe sequence and PCS definition (see Table 2-3). .sup.bNumber of identical residues shared with the probe sequence. .sup.cJudged by SDS gel electrophoresis of the soluble fraction of a total lysate. .sup.dDetermined in a Roche LightCycler, using SYPRO Orange to monitor the appearance of unfolded protein. .sup.eDetermined by monitoring an increase in the thermostability of the protein in the presence of ligand. .sup.fEstimate: multi-state unfolding. .sup.gEstimated from incomplete data .sup.hPrecipitated during dialysis.

    Example 4. Sensor Engineering Phase 3: Cysteine Mutant Scans and Fluorophore Screening to Identify Fluorescently Responsive Sensors for Target Ligand

    [0566] Semi-synthetic FRSs can be engineered by site-specifically attaching thiol-reactive, environmentally sensitive fluorophores that respond to ligand-mediated conformational changes. Identification of FRS candidates that can be used for sensing applications comprises three steps: [0567] 1. Cysteine scan. Mutant ligand-binding proteins containing single cysteines are constructed for site-specific attachment of thiol-reactive fluorophores. General structural principles have been established to identify positions in PBPs where attached single fluorophores are likely to exhibit ligand-dependent responses (de Lorimier et al. 2002). Candidate positions fall into three classes: endosteric, replacing a residue that contacts the ligand directly; peristeric, located at the rim of the binding site; allosteric (Marvin et al. 1997. Marvin 1998), located outside the binding site at sites that undergo local structural changes in concert with the hinge-bending motion. [0568] 2. Fluorophore screening. Thiol-reactive, environmentally sensitive fluorophores are attached to each cysteine mutant prepared in step 1. [0569] 3. Evaluation of the ligand-mediated change of all the fluorescent conjugates prepared in step 2. Responses to ligand binding in which there is both a change in fluorescence emission intensity and spectral shape are essential for chemometric applications, because such changes enable ratiometric measurements. Changes in spectral shape typically are accompanied by a shift in the wavelength of the emission intensity maxima. Three classes of fluorescent responses are possible: [0570] i. No response. [0571] ii. Monochromatic response (emission intensity increases or decreases without a change in spectral shape) [0572] iii. Dichromatic response (both intensity and spectral shape changes) which can be classified into two sub-classes: [0573] i. Hypsochromatic: emission intensity shifts to shorter wavelengths upon binding ligand (blue shift). [0574] ii. Bathochromatic: emission intensity shifts to longer wavelengths upon binding ligand (red shift). [0575] 4. Double labeling strategies to convert monochromatic responses into dichromatic signals, or to improve upon weak dichromatic responses.

    [0576] Of particular interest are ligand-mediated responses that change both the shape and intensity of the emission spectra such that the ratio of the emission intensities at two appropriately chosen wavelengths reports on analyte concentration (dichromatic response).

    [0577] Such ratiometric measurements provide an internally consistent, self-calibrating reference, which removes the necessity for carrying out on-board calibration in conjunction with each measurement, obviating the need for multiple components and fluidic circuitry (Demchenko 2010, Demchenko 2014). The naphthalene derivatives Acrylodan and Badan have been particularly effective in establishing dichromatic responses in singly labeled proteins, because ligand-mediated protein conformational changes can be coupled to an exchange between two different fluorophore conformations (twists) that emit at different wavelengths. Initial screens therefore employ these fluorophores to identify locations where fluorescent conjugates respond to ligand binding. Two dominant electronic transitions give rise to fluorescence emission in these fluorophores with maxima in the blue (<500 nm) and green (>500 nm) regions, respectively.

    [0578] Cysteine Scans to Identify Semisynthetic Fluorescent Bicarbonate Sensors in avBicarbBP5.

    [0579] We tested the bicarbonate responses of Acrylodan conjugates attached to cysteine mutations at peristeric and endosteric positions of avBicarbBP (FIG. 3). With the exception of N146C. all positions exhibited monochromatic or no responses (Table 6). In the case of 146C, there was only a small shift in emission wavelengths, and no significant change in intensity. Several conjugates were predominantly in the green state (18C, 49C, 71C), or blue (141C, 190C) states, whereas others had a mixture of the two forms (16C, 17C, 140C, 143C, 146C, 194C). Acrylodan therefore could adopt both states in avBicarbBP5, but these did not alter in response to bicarbonate binding, with the exception of 146C. These results suggest that ligand binding is not accompanied by a large conformational change that couples to a redistribution of internal conjugate conformations. The structure of the hinge region in avBicarbBP5 clearly is not flexible, but resembles a small protein domain with a significant hydrophobic core (FIG. 3). The observed absence of conformational coupling between bicarbonate binding and Acrylodan twisting therefore is consistent with the avBicarbBP5.

    TABLE-US-00014 TABLE 6 Bicarbonate response of Acrylodan conjugates in a cysteine scan of the avBicarbBPS scaffold. Response Thermo- Position.sup.a Excited stability.sup.f avBicarbBP6 synBicarbBP1 Class.sup.b Shape.sup.c Intensity.sup.d states.sup.e .sup.apoT.sub.m (K) I16C 66 p 0 b/g 334 P17C 67 p m + b/g 326 I18C 68 e 0 g 336 W49C 99 e 0 g 322 Q71C 121 e 0 g 343 F140C H191 p m + b/g 338 T141C 192 e m + b 331 F142C 193 p m + g 331 P143C 194 p 0 b/g 325 N146C 197 p d 0 b/g 333 T190C 241 p m + b 329 W194C 245 p m + b/g 329 .sup.aAligned position in the synBicarbBP1 numbering of the 2i4c PDB file is given. .sup.be, endosteric; p, peristeric. .sup.cm, monochromatic; d, dichromatic (i.e. spectral shape changes); 0, no change. .sup.d+, increases in response to bicarbonate; decreases; 0, no change. .sup.eThe dominant population of the excited states in the absence of bicarbonate is determined from the emission band intensities: b, blue (maxima < 500 nm); g, green (maxima > 500 nm); b/g, mixed population of blue and green. .sup.fDetermined by thermal melts based on Acrylodan fluorescence. The wild-type protein .sup.apoT.sub.m = 355 K.

    [0580] In the absence of conformational coupling between ligand binding and fluorophore twisting as a mechanism to obtain fluorescently responsive sensors, we tested Pacific Blue conjugates. We found that at positions 18C, 190C and 194C, Pacific Blue exhibited monochromatic changes in emission intensity in response to bicarbonate binding. Pacific Blue is a hydroxycoumarin derivative, the phenolate of which corresponds to the excited state (Sun 1998). It is therefore likely that binding of Ca.sup.2+ stabilizes the excited state, with a concomitant increase in quantum yield.

    [0581] Introducing Ratiometric Bicarbonate Responses in avBicarbBP5 Using Non-Geometrically Modulated FRET.

    [0582] We have shown previously that fluorescence resonance energy transfer can be used to report on binding events by pairing an environmentally sensitive, ligand-responsive donor or acceptor with an insensitive partner. Ratiometric measurements are based on changes in donor and acceptor intensities in such non-geometric modulated FRET (ngmFRET) systems. The dichromatic response arises from ligand-mediated effects on the spectral overlap between the partners or the non-radiative decay rates of the sensitive fluorophore, either singly or in combination.

    [0583] To convert the monochromatic Pacific Blue responses of the 18C and 194C conjugates into dichromatic signals, we constructed an ngmFRET system by fusing a C-terminal Zif domain which enables site-specific attachment a second fluorophore using orthogonal thiol chemistries (Smith et al. 2005). This avBicarbBP5 fusion protein was doubly labelled with Pacific Blue ngmFRET donor in the binding site and IANBD or the Fluorescein derivatives 5-IAF and Oregon Green as the ngmFRET acceptor at the C-terminal Zif. These conjugates exhibited strong dichromatic responses to bicarbonate binding (FIG. 7). Both donor and acceptor emissions increased in response to bicarbonate binding, which is the expected ngmFRET pattern for ligand-mediated changes in the non-radiative decay rates of a responsive donor (Allert 2015).

    [0584] Cysteine Scans to Identify Semisynthetic Fluorescent Bicarbonate Sensors in teFeBP3.

    [0585] Several Acrylodan and Badan conjugates exhibited dichromatic responses to bicarbonate binding (Table 7). It is therefore possible to establish coupling between ligand-mediated protein conformational changes and conjugate twisting. The largest response was observed for the teFeBP3 E270C*Badan conjugate (FIG. 8). The apparent affinity for bicarbonate, based on the ratiometric signal, is 48 mM, which is suitable for measurements in the clinical reference concentration range.

    TABLE-US-00015 TABLE 7 Bicarbonate response of Acrylodan conjugates in a cysteine scan of peristeric sites in the teFeBP3 scaffold. Response Acrylodan Badan Position.sup.a Excited Inten- Excited teFeBP3 mhFeBP1 Shape.sup.b Intensity.sup.c states.sup.d Shape.sup.b sity.sup.c states.sup.d A8C Y9 0 b/g m + b/g H10C Q11 0 b/g d b/g D12C Y13 0 b/g 0 g T13C L14 0 b/g d g A36C 36 m b/g d b V58C 58 d + b/g d + b/g R135C 136 m + g 0 g N139C 140 m g 0 b I140C S141 0 g m g N176C G177 0 g m g N195C 196 0 g 0 b N268C 266 0 b m b/g E270C 268 d g d g .sup.aAligned position in the mhFeBP1 numbering of the 1si0 PDB file is given. .sup.bm, monochromatic; d, dichromatic (i.e. spectral shape changes); 0, no change. .sup.c+, increases in response to bicarbonate; decreases; 0, no change. In the presence of FeCl.sub.3 (10 M). .sup.dThe dominant population of the excited states in the absence of bicarbonate is determined from the emission band intensities: b, blue (maxima < 500 nm); g, green (maxima > 500 nm); b/g, mixed population of blue and green.

    [0586] Semisynthetic Fluorescent Calcium Sensors in avBicarbBP5.

    [0587] We tested fluorescent conjugates for response to Ca.sup.2+ in the absence of bicarbonate (Table 8). Pacific Blue conjugates exhibited excellent responses at two sites (16C and 18C) and showed responses at 17C, 49C, 140C and 142C. Badan exhibited dichromatic response to Ca.sup.2+ at 17C, 18C, 140C, 142C and 194C (FIG. 9). The 17C and 18C conjugates bind Ca.sup.2+ with 1-2 mM affinities. Accordingly, these conjugates are well-suited for measuring Ca.sup.2+ concentrations in the clinical reference range.

    [0588] The cysteine scans also demonstrate that Ca.sup.2+ and bicarbonate binding functions can be separated. The Ca.sup.2+ affinities of the five 16C, 17C, 18C, 140C, and 142C conjugates change little, if at all, in the presence of 50 mM bicarbonate (Table 9). The avBicarbBP5 protein therefore can be engineered to function as either a Ca.sup.IIHCO.sub.3 or a Ca.sup.2+ sensor.

    TABLE-US-00016 TABLE 8 Calcium response in a cysteine scan of the avBicarbBP5 scaffold.sup.a. Emission K.sub.d Position.sup.b Class Conjugate Shape wavelength (nm) (mM) avBicarbBP5 synBicarbBP1 .sup.c .sup.d .sup.e .sub.1 .sub.2 .sup.appK.sub.d .sup.trueK.sub.d I16C 66 p A m 481 526 22 22 B 0 PB m/d 445 475 0.30 0.64 A532 m/d 540 582 0.30 0.71 P17C 67 p A d 443 548 1.9 2.5 B d 488 553 2.0 2.4 PB m/d 436 479 3.1 14 A532 nt 555 540 24 68 I18C 68 e A d 461 544 2.0 2.7 B d 441 548 1.1.sup.f 2.2.sup.f PB m/d 444 479 2.7 5.3 A532 m 559 540 2.4 3.2 W49C 99 e A 0 B 0 PB m 442 477 41 33 Q71C 121 e A 0 B 0 PB 0 F140C H191 p A d 483 520 0.35 0.41 B d 440 552 0.19 0.22 PB m 451 481 0.28 0.34 A532 m 549 579 2.0 2.5 T141C 192 e A d 440 531 0.46 0.53 B 0 PB 0 A532 m/d 555 540 0.6 0.7 F142C 193 p A d 487 518 0.23 0.22 B d 483 515 0.2 0.2 PB m 460 435 0.04 0.04 A532 m/d 555 540 0.31 0.68 P143C 194 p A m 462 522 0.43 0.42 B m 488 568 0.92 0.98 PB 0 N146C 197 p A 0 B 0 PB 0 T190C 241 p A d 491 451 0.54 0.64 B 0 PB 0 W194C 245 p A d 483 510 20.sup.f 10.sup.f B m/d 487 515 1.2 0.94 PB 0 .sup.aDetermined by fitting the ratiometric signal of the intensities measured at 1 and 2 to equations 1-5. .sup.bAligned position in the synBicarbBP numbering of the 2i4c PDB file is given. .sup.c e, endosteric; p, peristeric. .sup.d A, Acrylodan; B, Badan; PB, Pacific Blue, A532, Alexa532. .sup.e m, monochromatic; d, dichromatic (i.e. spectral shape changes); 0, no or very small change. .sup.fApproximate value.

    TABLE-US-00017 TABLE 9 Calcium affinities for various avBicarbBP5 conjugates in the presence and absence of NaHCO.sub.3.sup.a. Affinity (mM) Wavelengths Calcium (nm) Calcium (NaHCO.sub.3).sup.c Mutation Conjugate.sup.b .sub.1 .sub.2 .sup.appK.sub.d .sup.trueK.sub.d .sup.appK.sub.d .sup.trueK.sub.d 16C PB 445 475 0.30 0.64 0.27 0.64 17C B 488 553 2.0 2.4 1.9 2.2 18C PB 444 479 2.7 5.3 2.1 4.2 140C B 440 552 0.19 0.22 0.1 0.12 142C B 483 515 0.2 0.2 0.12 0.11 .sup.aDetermined by fitting the ratiometric signal of the intensities measured at 1 and 2 to equations 1-5. .sup.bB, Badan; PB, Pacific Blue. .sup.cCalcium titration in the presence of 50 mM NaHCO.sub.3.

    Example 5. Sensor Engineering Phase 4: Affinity Tuning

    [0589] The response of biosensors based on Langmuir binding isotherms is most sensitive at analyte concentrations that match the apparent K.sub.d value of the protein (de Lorimier et al. 2002. Marvin et al. 1997). Accordingly sensor performance frequently needs to be optimized by tuning ligand affinity. The mutations that alter ligand affinities in PBPs generally fall into two classes: [0590] 1. Alteration of direct interactions in the PCS between the protein and the bound bicarbonate. [0591] 2. Manipulation of the equilibrium between the open and closed states (Marvin and Hellinga 2001). [0592] 3. Indirect interactions that alter the geometry of the binding site.

    [0593] Tuning of Bicarbonate Affinity in avBicarBP5.

    [0594] Physiological blood bicarbonate levels for a healthy individual are typically between 20 mM to 30 mM (Burtis 2012). A series of mutations were introduced at positions 16 and 141, respectively, to obtain variants with K.sub.d values near that concentration range (Table 10). Position 16 is located adjacent to the binding site, but does not interact directly with the bound complex. Mutations at this location therefore fall into the 3.sup.rd category. The threonine at position 141 (T192 in synBicarbBP1) forms a hydrogen bond with the bound bicarbonate (FIG. 3C). Mutations at this position therefore fall into the 1.sup.st category. The effects of these mutations were evaluated using ngmFRET in the doubly labeled C-terminal Zif fusions (Table 10). The I16F mutation in the 18C Pacific Blue background, combined with a Fluorescein acceptor, gives a response with a near-optimally tuned bicarbonate affinity (FIG. 10).

    TABLE-US-00018 TABLE 10 Bicarbonate response of Zif conjugates of the avBicarbBP5 scaffold.sup.a. Emission wavelength K.sub.d.sup.b K.sub.d.sup.c,e Conjugate (nm) (mM) (mM) Mutant avBicarbBP5 Zif 1 2 .sup.appK.sub.d .sup.trueK.sub.d .sup.appK.sub.d .sup.trueK.sub.d 18C, 16M Pacific Blue 5-IAF 455 520 6.sup.d 6.sup.d 160 170 18C, 16M Badan Alexa532 488 555 273 243 18C, 16F Pacific Blue 5-IAF 455 517 15 20 12.sup.d 13.sup.d 18C, 16F Badan Alexa532 488 555 480 700 18C, 16F Pacific Blue Texas Red 455 620 31 25 18C, 16Y Pacific Blue 5-IAF 455 515 10 12 34 46 18C, 16Y Badan Alexa532 488 555 nb nb 18C, 16W Pacific Blue 5-IAF 455 520 61 64 90.sup.d 70.sup.d 18C, 16W Badan Alexa532 488 555 580 780 18C, 16E Pacific Blue 5-IAF 455 520 160 130 18C, 141F Pacific Blue 5-IAF 455 520 58 69 18C, 141F Badan Alexa532 479 555 440 430 18C, 141Y Pacific Blue 5-IAF 455 518 5.4 7.3 nb nb 18C, 141W Balan Alexa532 483 555 nb nb 18C, 141W Pacific Blue 5-IAF 455 520 35 43 2.6 3.0 18C, 141Q Pacific Blue 5-IAF 455 520 76 96 8.2 9.3 18C, 141Q Badan Alexa532 488 555 770 700 18C, 141E Pacific Blue 5-IAF 455 520 196 238 138 216 190C Acrylodan 5-IAF 586 460 3.0 3.4 190C Acrylodan Alexa532 487 460 5.5 6.1 194C Pacific Blue 5-IAF 455 519 24 60 194C Pacific Blue IANBD 455 519 14 61 194C Pacific Blue Oregon 455 519 24 65 Green .sup.aDetermined by fitting the ratiometric signal of the intensities measured at 1 and 2 to equation 1-5. .sup.bIn the presence of 1 mM CaCl.sub.2. .sup.cIn the presence of 1 mM EGTA. .sup.dApproximate value. .sup.enb, no binding.

    [0595] Tuning of Ca.sup.2+ Affinity in avBicarbBP5.

    [0596] The concentration of free Ca.sup.2+ in blood is tightly regulated in the 1.2-1.3 mM range (Burtis 2012). The effect of mutations were studied at two labeled positions: 16C and 18C. Tuning mutations were introduced at positions 16 (in the 18C background), 49, 71, and 141, corresponding to positions 66, 99, 121, and 192, respectively in svnBicarbBP1. Each of affinity tuning positions therefore corresponds to position in the PCS (FIG. 3C). The effects of these mutations were evaluated using ngmFRET in the doubly labeled C-terminal Zif fusions (Table 11). The range of obtained Ca.sup.2+ affinities spanned approximately five orders of magnitude, ranging from 20 M to 360 mM, with each decade represented at least once. Several mutants exhibit K.sub.d values appropriate for clinical sensing of ionized calcium (FIG. 11).

    TABLE-US-00019 TABLE 11 Calcium response of Zif conjugates of the avBicarbBP5 scaffold.sup.a. Emission wavelength K.sub.d Conjugate (nm) (mM) Mutant avBicarbBP5 Zif 1 2 .sup.appK.sub.d .sup.trueK.sub.d 16C Pacific Blue Oregon 455 520 0.22 0.26 Green 16C Pacific Blue 5-IAF 455 517 0.02 0.02 16C Alexa532 5-IAF 555 515 0.5.sup.b 0.5.sup.b 16C Alexa532 Oregon 551 524 13.sup.b 14.sup.b Green 16C, 71D Pacific Blue 5-IAF 455 519 19.sup.b 17.sup.b 16C, 71N Pacific Blue 5-IAF 455 515 0.21 0.18 16C, 71E Pacific Blue 5-IAF 455 520 380 360 16C, 71M Pacific Blue 5-IAF 455 519 20 20 17C Acrylodan 5-IAF 514 465 4.2 1.8 17C Badan 5-IAF 523 465 1.3 0.51 17C Acrylodan Alexa532 483 546 2.6 2.9 17C Badan Alexa532 491 545 0.85 0.96 17C Pacific Blue IANBD 455 483 7.2 18 18C Pacific Blue 5-IAF 455 523 3.0 3.1 18C Pacific Blue Oregon 455 523 3.3 3.3 Green 18C Pacific Blue IANBD 455 480 1.1 1.7 18C Acrylodan 5-IAF 523 484 8.9 12 18C Acrylodan Alexa532 495 470 3.9 4.1 18C Badan Alexa532 555 500 0.15 0.20 18C, 16M Pacific Blue 5-IAF 455 517 1.0 0.91 18C, 16M Badan Alexa532 559 491 0.043 0.076 18C, 16F Pacific Blue 5-IAF 455 520 0.96 1.1 18C, 16F Badan Alexa532 492 555 0.17 0.18 18C, 16F Pacific Blue Texas Red 455 620 3.1 3.0 18C, 16Y Pacific Blue 5-IAF 455 517 0.77 0.96 18C, 16Y Badan Alexa532 555 490 0.01 0.02 18C, 16Y Pacific Blue Texas Red 455 440 16 17 18C, 16W Pacific Blue 5-IAF 455 517 0.76 0.90 18C, 16W Badan Alexa532 487 555 0.02.sup.b 0.02.sup.b 18C, 16E Pacific Blue 5-IAF 455 520 0.20 0.20 18C, 49F Acrylodan Alexa532 491 547 0.69 0.84 18C, 49F Pacific Blue Oregon 455 516 19 26 Green 18C, 49Y Pacific Blue Oregon 455 515 15 19 Green 18C, 49Y Badan Alexa532 486 555 1.2 1.4 18C, 141V Acrylodan Alexa532 487 545 9.7 9.3 18C, 141V Pacific Blue Oreon 455 518 41 40 Green 18C, 141F Pacific Blue 5-IAF 455 522 2.0 2.1 18C, 141F Badan Alexa532 466 555 3.8 4.0 18C, 141Y Badan Alexa532 467 555 2.0 2.1 18C, 141Y Pacific Blue 5-IAF 455 520 4.1 4.5 18C, 141W Badan Alexa532 464 555 1.2 1.3 18C, 141W Pacific Blue 5-IAF 455 522 2.2 2.0 18C, 141Q Pacific Blue 5-IAF 455 517 1.7 2.0 18C, 141Q Badan Alexa532 559 490 0.72 0.57 18C,141E Pacific Blue 5-IAF 455 517 1.4 1.8 .sup.aDetermined by fitting the ratiometric signal of the intensities measured at 1 and 2 to equation 1-5. .sup.bApproximate value.

    Example 6. Materials and Methods

    [0597] Bioinformatic Searches.

    [0598] Annotated genomic and plasmid sequences of 5062 prokaryotes were obtained from the National Center of Biotechnology Information (ftp://ftp.ncbi.nih.gov/genomes/Bacteria/all.gbk.tar.gz), together with annotations recording prokaryotic lifestyles (../ProkaryotesOrganismInfo.txt). The Protein Databank (PDB) was obtained from www.rcsb.org. The downloaded genomic and structural data files were organized into pre-processed two databases (PG, prokaryotic genomes: PDB). The ProteinHunter program provides an interface and methods for organizing, querying, and analyzing these databases. ProteinHunter comprises a graphical user interface, set of computer scripts, and a parallel computing environment. Together these set up the calculations, manage the flow of information and execution in each of the calculation phases, control other programs that carry out specific calculations such as BLAST (Altschul et al. 1990) and ClustalW (Chenna et al. 2003), and visualize the results.

    [0599] To construct homolog sequence sets, single sequence seeds were extracted from either preprocessed PDB or PG databases. Homolog sets were then identified in the PDB or PG by using a seed sequence for a uni-directional BLAST search with the following parameters: expect threshold, 10.0; gap costs for existence, 11, and extension, 1: BLOSUM matrix; low complexity filter is on (the ProteinHunter package always executes BLAST searches with the following command blastall -p blastp -m 8 -b 50000 -d<database file> -i<input file> -o <output file>, where <database file> specifies the name of the prebuilt search sequence file and <input file> and <output file> the seed sequence input and hit output files respectively. A pairwise BLAST alignment was scored in ProteinHunter as a homolog hit if it exceeded a minimum fraction of identical residues and if the alignment covered at least 70% of the probe and target sequences.

    [0600] Function was inferred using the sequence of primary complementary surface (PCS) residues. A non-contiguous sequence comprising the PCS between the protein and the bound bicarbonate was identified using ProteinHunter, PCS residues were selected as members of the PCS if the calculated distance between any of their atoms and any bicarbonate atom was less than 5 , and the distances between their backbone C.sub. and any atom in bicarbonate-metal complex was greater than that of their C.sub. atom and any atom in the ligand complex. Secondary shell residues that do not form hydrogen bonds or van der Waals contacts were removed by inspection from the resulting set. To determine the PCS sequence of members in the homolog set identified in ProteinHunter, their sequences were aligned using ClustalW (Chenna et al. 2003). This alignment identifies the positions of the PCS residues in each homolog, from which the corresponding PCS sequence in that homology is then read. For each homolog, the number of PCS mutations relative to the bicarbonate-binding PCS (Hamming distance, H.sub.PCS) was counted. Homologs with H.sub.PCS=0 were inferred to be bicarbonate-binding proteins. The PCS sequences were displayed sorted by their H.sub.PCS values, and within each H.sub.PCS value sorted by their fraction identical residues, indicating the replicon within which they reside (chromosome or plasmid), whether this replicon contains paralogs, and the temperature tolerance (hyperthermophile, thermophile, mesophile, psychrophile, unknown), their Gram stain classification (if known), and the percentage genomic AT content. Duplicate hits were removed automatically from this list if the organism name (genus and species), fractional identity and paralogs were the same. From this list representative, unique homologs with H.sub.PCS=0 were chosen by inspection.

    [0601] Gene Synthesis and Mutagenesis.

    [0602] The amino acid sequences for the predicted homologs identified in the bioinformatic search (see above) were extracted from the PG database. The putative leader peptide that mediates anchoring of the periplasmic-binding protein on the outside of the membrane (Gram positive bacteria) or directs secretion into the periplasm (Gram negative bacteria) was deleted by examining the multiple sequence alignment and removing the sequences N-terminal to the start of the mature seed protein amino acid sequence. Endogenous cysteines were changed to alanine. A hexahistidine tag was placed behind a GGS linker at the C-terminus of the mature protein to enable metal-mediated affinity purification (Hengen 1995). The final amino acid sequences were back-translated into a DNA sequence encoding the open reading frame (ORF), which was placed in a construct behind an efficient Shine-Dalgarno ribosome-binding site, and flanked by a T7 promoter and terminator at the 5 and 3 ends respectively, using the GeneFab program (Cox et al. 2007). The resulting ORF sequences were optimized in context by OrfOpt or OrfMorph programs designed to predict highly expressed mRNA sequences in E. coli (see below). The resulting DNA sequences were synthesized by oligonucleotide assembly and cloned into pUC57 by GeneWiz, Inc. (South Plainfield, N.J.).

    [0603] Subsequent single and multiple point mutations were designed by preparing mutant sequences of the synthetic ORF sequences using the GfMutagenesis program that introduces point mutations into an ORF using the most prevalent codon in E. coli for an amino acid. Constructs for site-specific double labeling were designed by inserting the Zif domain sequence (Smith et al. 2005) before the hexa-histidine C-terminal purification tag. All variants also were constructed by total gene synthesis.

    [0604] Synthetic Gene Optimization.

    [0605] The OrfOpt program (U.S. Patent Publication No. 2011/0171737, incorporated by reference) uses stochastic optimization algorithms that choose different codons within an ORF without altering the amino acid sequence to optimize a target function designed to identify mRNA sequences that express proteins at high levels in E. coli. The OrfOpt simultaneously imposes AU-rich nucleotide composition at the 5 and 3 ends of the ORF, low RNA secondary structure content and favorable codon usage (Allert et al. 2010). The OrfMorph program reproduces the pattern of codon usage and RNA secondary structure observed in the parent genome of a protein, but using E. coli codon preferences and nucleotide composition.

    [0606] Codon usage is calculated using the codon adaptation index (CAI), as described for OrfOpt, using codon frequency tables calculated for the genome under examination. The mean CAI value for a genome, .sub.c, and its standard deviation, .sub.c, are calculated over all the codons in a genome. A codon usage score, c, is calculated for each codon in an open reading frame (ORF) by averaging the CAI over a 9-codon window, centered on the codon for which this score is calculated. A normalized codon usage score, z.sub.c, is calculated for each codon as Z-score: z.sub.c=(c.sub.c)/.sub.c. A plot of z.sub.c along an ORF establishes the codon usage pattern of that ORF. Rare codons (z.sub.c<0) are hypothesized to slow down the elongation rate of ribosome translation, introducing pause sites at extreme values. Such pause sites are hypothesized to direct kinetics of co-translational folding, allowing a newly synthesized segment to fold before more protein is made. An RNA secondary structure score, s, is determined for each nucleotide by summing its participation in all possible hairpins that can form in its vicinity (settings: minimum duplex length 4 basepairs: maximum loop length, 30 bases: vicinity length, 100 bases), as described for OrfOpt. The average secondary structure energy, .sub.s, and its standard deviations, .sub.s. are calculated over all the nucleotides in a genome. A normalized secondary structure energy score, z.sub.s, is calculated for codon as the Z-score: z.sub.s=(c.sub.s)/.sub.s. A plot of z.sub.s along an ORF establishes the secondary structure pattern of that ORF. Regions of above-average secondary structure (z.sub.s>0) are hypothesized to slow down the elongation rate of ribose translation, introducing pause sites at extremes. As with CAI-mediated pause sites, secondary structure-driven pause sites are hypothesized to direct the kinetics of co-translational folding.

    [0607] To mimic these patterns for heterologous expression of an ORF in E. coli, first the z, and z.sub.s scores are calculated using the parent organism codon table, .sub.c, .sub.c, .sub.s, and .sub.s values. Second, a stochastic search algorithm is used that randomly chooses between degenerate codons to construct trial mRNA nucleotide sequences, calculating z.sub.c and z.sub.s scores for each trial sequence, but using the E. coli codon table, and E. coli .sub.c, .sub.c, .sub.s, and .sub.s values. For each trial, the absolute differences between the E. coli trial scores, and the wild-type scores are summed over the entire ORF. The OrfMorph program searches for a minimum of these differences. The stochastic search algorithm operates by first choosing a codon position, second choosing a degenerate codon within the allowed codons at that position. If the choice results in an improved score, the sequence is kept, otherwise it is rejected. After a position has been selected, it is removed from the pool of allowed positions, and the next is chosen from the remainder. The algorithm terminates when two successive sweeps do not yield further improvements in the score. The resulting RNA nucleotide sequence that has codon usage patterns and secondary structure patterns that closely match those of the wild-type mRNA sequence in its parental genomic context. The hypothesis is that such matching improves production of soluble protein by mimicking co-translational folding contributions that minimize mis-folded protein intermediate aggregation.

    [0608] Protein Expression, Purification, and Fluorescent Conjugate Preparation.

    [0609] Plasmids carrying the expression constructs (see above) were transformed into KRX competent cells (Promega), and grown overnight at 37 C. on LB agar plates (100 mg/mL ampicillin). For expression and purification of homologs of cyanobacterium Synechocystis PCC 6803 CaCl.sub.2 (1 mM) was added. For expression and purification of homologs of Mannheimia haemolytica FeCl.sub.3 (10 M) was added. A single colony was picked and grown overnight at 37 C. in Terrific Broth (TB: Research Products International). The overnight cultures were diluted 1:20 in 500 mL TB (100 mg/mL ampicillin), grown to an optical density of A.sub.600=0.5 at 37 C. in vigorously aerated shaker flasks, induced by the addition of 2.5 mL rhamnose (20% w/v), and grown for a further 3-4 hrs. The cells were harvested by centrifugation (5,000 rpm, 10 min). After decanting the supernatant, the cell pellets were stored 80 C. The cell pellets were thawed, resuspended in 8 mL binding buffer (10 mM imadozole, 20 mM MOPS, 500 mM NaCl, pH 7.8). Following resuspension, 3 mL of BugBuster HT (EMD Millipore) was added. After incubation (20 mins, 25 C.), the cells were lysed on ice by sonication (2 minutes of one-second on/off pulses, 20-30% power). A clarified lysate was prepared by centrifugation (15,000 rpm, 20 min, 4 C.) from which recombinant protein was purified by batch immobilized metal affinity chromatography (IMAC). Resuspended IMAC agarose beads (5 mL: Sigma-Aldrich, P6611) were added to the lysate. After incubation at 4 C. in a Mini LabRoller (Labnet International) for 1 hr, the beads were washed at least five times with binding buffer. The immobilized protein beads were resuspended in labeling buffer (20 mM MOPS, 100 mM NaCl, pH 6.9) and labeled overnight (4 C., rotating end-over-end) with a thiol-reactive fluorophore (5-fold stoichiometric excess over protein). Following two rinses with labeling buffer to remove unincorporated label. For double labeling of Zif fusions, a second thiol-reactive label was added following reduction of the disulfide with 5 mM TCEP. To elute labeled protein from the IMAC beads, 6 mL of elution buffer (400 mM imidazole, 500 mM NaCl, 20 mM MOPS, pH 7.8) was added, incubated for 30 min (4 C., rotating end-over-end), and the beads removed by centrifugation. Following dialysis of the eluate against three changes of assay buffer (20 mM MOPS, 20 mM KCl, pH 7.4), using 10 kDa semi-permeable membrane (Snakeskin tubing, Thermo Scientific), the fluorescent conjugates were concentrated in a 10 kDa cutoff spin concentrator (Vivaspin, GE Healthcare). Protein purity was assessed by SDS/PAGE. Protein concentrations were determined by (Nanodrop1000) at 280 nm (using extinction coefficients calculated from their sequence (Gill and von Hippel 1989, Artimo et al. 2012)), or at the fluorophore absorbance peak (Acrylodan, 391 nm and Badan, 387 nm).

    [0610] Preparation of Titration Series to Measure Ligand-Binding.

    [0611] 12-, 24-, or 48-point logarithmic titration series were prepared on a Tecan Freedom liquid-handling robot, using an in-house program, TitrationPlate, that compiles an abstract description of a multi-component titration series into machine instructions for operating the robot. For bicarbonate titrations in homologs of cyanobacterium Synechocystis PCC 6803, concentrations were varied from 0-1 M in 20 mM KCl, 20 mM MOPS (pH 7.4) supplemented with either 1 mM EGTA or 1 mM CaCl.sub.2. For bicarbonate titrations in homologs of Mannheimia haemolytica, concentrations were varied from 0-1 M in 20 mM KCl, 20 mM MOPS (pH 7.4) in the presence of 10 M FeCl.sub.3. For calcium titrations in homologs of cyanobacterium Synechocystis PCC 6803, concentrations were varied from 0-1 M in 20 mM KCl, 20 mM MOPS (pH 7.4), and for some experiments supplemented with 50 mM NaHCO.sub.3.

    [0612] Determination of Temperature- and Ligand-Dependent Fluorescence Landscapes.

    [0613] 12-, 24-, or 48-point logarithmic titration series were prepared on a Tecan Freedom liquid-handling robot (see above). Temperature-dependent fluorescence emission intensities of 20 L aliquots, each containing 10 M protein, were measured in 384-well microtiter plates in a LightCycler 480 II (Roche) using excitation and emission wavelengths available for this instrument that most closely matched the optical characteristics of the fluorescent conjugate. Temperatures were advanced in 1K steps. At each temperature, data was collected at 1-second intervals for 60 seconds at which point the signal had relaxed to a steady value associated with the new temperature. Under these experimental photobleaching was not observed. The in-house program TitrationMeltPlate was used to convert these observations into time-independent datasets that record fluorescence as a function of temperature for each well and associate wells with their concentration of titrant and additive. Management tools were developed to maintain a database of titrations and their analyses.

    [0614] Determination of Emission Intensity Spectra.

    [0615] Ligand- and wavelength-dependent emission intensities were recorded on a Nanodrop3300 (Thermo Scientific) at room temperature. Using the LED closest to the optimal excitation wavelength of the fluorophore (UV, 365 nm; blue, 470 nm; white, 460-550 nm).

    [0616] Ratiometric Analysis of Ligand Binding.

    [0617] Isothermal ligand titrations were extracted from the fluorescent landscape or emission spectra datasets obtained as described above. Monochromatic emission intensities I.sub. (these intensities correspond to a bandpass intensity, recorded either with a physical filter in the case of the Roche LightCycler, or by integrating in the interval , + in the case of an emission spectrum), were fit to


    I.sub.=.sup.apo.sub.(1y.sub.true)+.sup.sat.sub.y.sub.true1

    where .sup.apo.sub. and .sup.sat.sub. are the fluorescence baselines associated with the ligand-free and ligand-bound states of the protein, respectively, and y.sub.true the fractional saturation of the protein (Layton and Hellinga 2010). Baseline functions can be constant, linear, or a second-order polynomial. For the ligand- and temperature-dependent fluorescence landscapes, we use a constant value for .sup.apo.sub.r, but .sup.sat.sub.r is described by a linear dependence on ligand concentration, [L]:

    [00001] x sat = a x + b x [ L ] 2

    For a single ligand-binding site, the fractional saturation is given by

    [00002] y _ = [ L ] [ L ] + K d 3

    where [L] is the ligand (bicarbonate or calcium) concentration and K.sub.d the dissociation constant, .sup.trueK.sub.d for y.sub.true.

    [0618] A ratiometric signal at a given point in a titration series, R.sub.12(t). is given by the ratio of intensities at two wavelengths, .sup.obsI(.sub.1,t), .sup.obsI(.sub.2,t) in the emission spectrum measured at that point:

    [00003] R 12 ( t ) = a t .Math. obs .Math. I ( 1 , t ) a t .Math. obs .Math. I ( 2 , t ) 4

    where a.sub.t is an attenuation factor that describes the effect of variations in sample size (i.e. the amount of observable fluorophore) in the i.sup.th sample on the wavelength-independent intensity of the entire emission spectrum. This signal removes wavelength-independent emission intensity attenuation effects due to variations in conjugate concentration, photobleaching, fluctuations in excitation source intensities, and detection efficiency (Demchenko 2010, Demchenko 2014). It is a key aspect for high-precision sensing using the reagentless fluorescently-responsive sensors described here. The ratiometric signal also can be fit to a binding isotherm:


    R.sub.1,2=.sup.apo.sub.R(1y.sub.R)+.sup.sat.sub.Ry.sub.R5

    where .sup.apo.sub.R and .sup.sat.sub.R are the baselines, and y.sub.R the apparent fractional saturation of the protein (with .sup.appK.sub.d). In general, .sup.trueK.sub.d.sup.appK.sub.d: if both baselines are constant, a simple relationship can be derived relating .sup.appK.sub.d to .sup.trueK.sub.d (Grimley et al. 2013):

    [00004] K d app = K d true .Math. I .Math. .Math. 2 apo I .Math. .Math. 2 sat 6

    where .sup.apoI.sub.2 and .sup.satI.sub.2 are the emission intensities of the monochromatic signal at wavelength .sub.2 of the ligand-free and ligand-bound protein, respectively.

    [0619] Following a fit of the titration series using equations 4 and 5, .sub.t values can be recovered by taking the average comparison of the observed and calculated intensities at the two wavelengths:

    [00005] a t = 1 2 .Math. ( calc .Math. I ( 1 , t ) obs .Math. I ( 1 , t ) + calc .Math. I ( 2 , t ) obs .Math. I ( 2 , t ) ) 7

    The a.sub.t value can then be applied to all wavelengths to obtain an emission spectrum or integrated intensity of the t.sup.th titration point corrected for variations in sample size:


    .sup.corrI()=a.sub.t.sup.obsI()8

    where .sup.corrI() and .sup.obsI() are the wavelength-dependent intensities of the corrected and observed emission spectra, respectively.

    [0620] The fractional error in the chemometric concentration measurement, depends on the first derivative of the binding isotherm as follows (Marvin et al. 1997):

    [00006] S S = .Math. 1 , 2 S ( dR 1 , 2 d .Math. S ) - 1 9

    Where R.sub.1,2 is the ratiometric signal (equation 5), .sub.1,2 its experimental error, and S is the resulting chemometric error in the concentration. We can then define a relative precision function

    [00007] P ( S ) = S .Math. .Math. S 1 P max 10

    where P(S) is the relative precision at concentration S, which reaches a maximum value (i.e. lowest error), P.sub.max, at the K.sub.d.

    [0621] For a given isothermal titration, values for .sup.appK.sub.d and .sup.trueK.sub.d were obtained using a non-linear fitting algorithm in which these two parameters were simultaneously fit to the three experimental binding isotherms using equations 1 and 5, with the two monochromatic isotherms sharing the same .sup.trueK.sub.d value. Three separate pairs of .sup.apo and .sup.sat were fit in this procedure, corresponding to the two monochromatic and the ratiometric signals, respectively. Two distinct ratiometric response models can be used: coupled (both wavelengths respond to ligand): uncoupled (the second wavelength is non-responsive: i.e. remains constant). Optionally, an attenuation vector, a(t) containing a, values for each titration point (equation 7), can be refined by iterative fit cycles in which the a(t) vector of a previous cycle is used to adjust the integrated intensities of the next cycle. Programs Nanodrop3300 and TitrationMeltAnalysis were developed to analyze wavelength- or temperature-dependent ligand-binding datasets respectively.

    [0622] Analysis of Ligand-Binding Properties Using Thermal Melts.

    [0623] The thermal stability of purified candidate proteins was determined by measuring the temperature-dependence of the fluorescence signal of an extrinsically added dye. SYPRO, using a Roche LightCycler (Layton and Hellinga 2010). The total fluorescence intensity, S, is given by


    S=.sub.Ff.sub.F+.sub.Uf.sub.U11

    where f.sub.F and f.sub.U are the fractions of protein in the folded and unfolded states, respectively, and .sub.F and .sub.U the fluorescence baselines of these two states. To get the fractions of the two states, we have

    [00008] f N = 1 1 + K U ( T ) .Math. .Math. and .Math. .Math. f U = 1 - f N 12

    where K.sub.U(T) is the temperature-dependent unfolding equilibrium constant, which by the vant Hoff approximation is given by

    [00009] K U = e - .Math. .Math. H U ( 1 T - 1 T m ) / R 13

    Where T is the temperature, T.sub.m, the unfolding reaction transition mid-point temperature, and H.sub.U the enthalpy of unfolding.

    [0624] To obtain the temperature dependence of the binding reaction, the K.sub.d values of all the individually determined isotherms were fit the Gibbs-Hemholtz equation (Layton and Hellinga 2010):

    [00010] .Math. .Math. G b ( T ) = ref .Math. H b + .Math. .Math. C p , b ( T - T ref ) - T ( ref .Math. S b + .Math. .Math. C p , b .Math. .Math. ln .Math. .Math. T T ref ) 14

    where G.sub.b*(T) is the standard free energy of binding at 1 M ligand at temperature T,

    [00011] .Math. .Math. G b ( T ) = - RT .Math. .Math. ln .Math. .Math. ( 1 + 1 K d ( T ) ) 15

    .sup.refH.sub.b* and .sup.refS.sub.b* the molar enthalpy and entropy of binding, respectively, at the reference temperature, T.sub.ref, and C.sub.p,b the heat capacity of the binding reaction. This data analysis was carried out using TitrationMeltAnalysis.

    [0625] Mechanisms for Chemical Sensing Based on Non-Geometric Modulation of FRET.

    [0626] The subject matter disclosed herein is not limited to or bound by any particular scientific theory. However, discussions regarding ngmFRET are provided to facilitate the understanding of possible mechanisms involved with ngmFRET signaling in various embodiments described herein. Equations for calculating various values mentioned herein are also provided. ngmFRET is also described in PCT International Patent Application No. PCT/US16/62958, filed Nov. 19, 2016, the entire content of which is incorporated herein by reference.

    [0627] The total signal, S, of a fluorescent sensor (either single-wavelength emission intensities, I.sub., or ratios of intensities at two wavelengths. R.sub.12) is the sum of the fluorescence due to the ligand-free (apo) and ligand-bound states:


    S=(1)+y16

    where and are the fluorescent baselines in the ligand-free and -bound states, respectively, and y is the fractional occupancy of the binding sites (equation 3).

    [0628] Fluorescence quantum yields are the fractions of photons emitted by the excited state relative to the total absorbed, and correspond to the ratio of the radiative decay rate relative to the sum of the rates of all possible decay pathways (FIG. 12). For a single fluorophore:

    [00012] Q = k r k r + k nr 17

    where k.sub.r and k.sub.nr are the radiative and non-radiative decay rates of the excited state, respectively. If we define q as the ratio between the radiative and non-radiative decay rates.

    [00013] q = k nr k r 18

    then the quantum yield can be written as

    [00014] Q = 1 q + 1 19

    [0629] Chemical sensors exploit the ligand-mediated shift of a fluorescent system between the ligand-free and ligand-bound states which each exhibit distinct quantum yields:


    Q.sub.obs=Q.sub.apo(1y)+Q.sub.saty20

    where Q.sub.obs, Q.sub.apo and Q.sub.sat are the quantum yield of the total system, the apo-protein, and the ligand-bound complex, respectively. In a system involving ngmFRET between a donor and acceptor fluorophore, the Q.sub.apo and Q.sub.sat quantum yields each are combinations of their respective donor and acceptor quantum yields:


    Q.sub.apo=.sup.DQ.sub.apo+.sup.AQ.sub.apo and Q.sub.sat=.sup.DQ.sub.sat+.sup.AQ.sub.sat21

    where the superscripts D and A indicate donor and acceptor fluorophores respectively. To understand ngmFRET-based sensors, we therefore need to examine the factors that affect each of these four quantum yields.

    [0630] The intensity of the light emitted by a donor or its acceptor is determined by the rate of photon emission from their respective excited states (FIG. 12A). The excited state of a donor is formed by the incident light from the excitation source, and there are three pathways by which this state decays: radiative and non-radiative decay and resonance transfer (by itself and regardless of the presence of any other fluorophore/parter). By contrast, the rate of formation of the acceptor excited state is determined by the resonance transfer rate from the donor, and there are only two processes that determine its decay rate: the radiative and non-radiative pathways (by itself and regardless of the presence of any other fluorophore/parter). In an ngmFRET system, the patterns of ligand-mediated fluorescence intensity changes therefore depend on whether the fluorophore that responds directly to ligand binding functions as a donor or acceptor. To understand these relationships, we analyze the factors that determine the rates of formation and decay of the donor and acceptor excited states.

    [0631] The rate of resonance energy transfer. k.sub.t, along a non-radiative pathway between donor and acceptor (FIG. 12A) is a fraction of the donor radiative emission pathway rate (by itself and regardless of the presence of any other fluorophore/parter), .sup.Dk.sub.r (the emission rate in the absence of an acceptor) multiplied by the energy transfer coupling factor, , (Lakowicz 2006, Valeur 2012):


    k.sub.t=Q.sub.D.sup.Dn.sub.k22

    where Q.sub.D is the donor quantum yield in the absence of an acceptor.

    [0632] According to the Frster model of weakly coupled oscillators (Lakowicz 2006, Valeur 2012), the energy transfer coupling factor is dependent on the spectral overlap, J, of the donor emission, .sup.D.sub.em, and acceptor excitation spectrum, .sup.A.sub.ex, and the variation of the geometry, G, between the donor and acceptor excited state transition dipoles with distance, r, and orientation factor, .

    [00015] = G ( r , ) .Math. J ( em D , ex A ) .Math. 9000 .Math. .Math. ln .Math. .Math. 10 128 .Math. .Math. 5 .Math. N A .Math. n 4 23 where G ( r , ) = 2 r 6 24 and J ( em D , ex A ) = F ( em D ) .Math. .Math. .Math. .Math. .Math. ( ex A ) .Math. 4 .Math. d .Math. .Math. 25

    with n the refractive index of medium, N.sub.A Avogrado's number. F(.sup.D.sub.em) the normalized donor emission spectrum, and (.sup.A.sub.ex) the absorption coefficient of the acceptor excitation spectrum [this analysis is a re-arrangement of the traditional presentation of the equations describing traditional geometrically-modulated FRET (tgmFRET), separating the different contributions (geometry, spectral overlap, quenching)]. Ligand-mediated modulation of r, and J therefore affects k.sub.t (FIG. 12B-D). leading to changes in donor and acceptor emission intensities (see below).

    [0633] At steady state, the concentration of the donor excited state, [D*], is given by the following rate balance equation (see FIG. 12A):


    N.sub.0k.sub.ex[D*](.sub.Dk.sub.nr+.sup.Dk.sub.r+k.sub.t)=026

    where N.sub.0 is the population of ground state fluorophores, k.sub.ex the rate of excitation photon absorption, the effective illumination, k.sub.t, the resonance energy transfer rate, .sup.Dk.sub.nr and .sup.Dk.sub.r the radiative and non-radiative decay rates of the donor (by itself and regardless of the presence of any other fluorophore/parter) in the absence of acceptor, respectively. Substituting .sup.Dk.sub.r(d+1) for .sup.Dk.sub.r+.sup.Dk.sub.nr (using equation 18, with dq, the ratio of non-radiative to radiative decay rates in the donor), and replacing k.sub.t with equation 22 (with Q.sub.D=1/(1+d), according to equation 23), we obtain

    [00016] N 0 .Math. .Math. k ex - [ D * ] D .Math. k r ( 1 + d + 1 + d ) = 0 27 Hense [ D * ] = N 0 .Math. .Math. .Math. k ex k r D ( 1 + d + 1 + d ) 28

    The intensity of the emitted donor light, I.sub.D, is

    [00017] I D = [ D * ] D .Math. k r = N 0 .Math. .Math. .Math. k ex ( 1 + d + 1 + d ) 29

    The donor quantum yield, Q.sub.D, is this emission intensity relative to the intensity of the excitation, k.sub.exN.sub.0

    [00018] Q D = 1 ( 1 + d + 1 + d ) 30

    [0634] The rate balance equation for the acceptor excited state concentration, [A*], is given by


    D*k.sub.tA*(.sup.Ak.sub.r+.sup.Ak.sub.nr)31

    Consequently, by applying equations 19, 22 and 30, the acceptor quantum yield, Q.sub.A, is

    [00019] Q A = ( 1 + a ) .Math. ( 1 + d ) .Math. ( 1 + d + 1 + d ) 32

    where a is the ratio of the radiative and non-radiative pathways in the acceptor.

    [0635] The ratio of the acceptor and donor quantum yields therefore is

    [00020] Q A Q B = ( 1 + d ) .Math. ( 1 + a ) 33

    This equation clearly shows that any ligand-mediated change in ngmFRET transfer () or quenching of either the donor (d) or acceptor (a) leads to a change in the ratio of donor and acceptor emission intensities, thereby enabling ratiometry.

    [0636] Classical ligand-mediated modulation of tgmFRET is concerned only with ligand-mediated changes in the distance between the donor and acceptor (Clegg 1995, Cheung 1991), and does not take advantage of effects that alter the photophysics of individual chromophores. By contrast, in ngmFRET systems, the directly responsive partner (DRP) responds to ligand binding through ligand mediated changes that alter the ratio of its radiative and non-radiative pathways (quenching, d or a) or its spectral properties (J), whereas the indirectly responsive partner (IRP) changes only as a consequence of the effect that such change have on the resonance energy transfer rate (k.sub.t). It is important to realize that the DRP can function either as a ngmFRET donor an acceptor, depending on how the spectral overlap is set up with the IRP. Regardless of whether the DRP is a donor or acceptor, ligand-mediated alteration of its non-radiative to radiative decay rate ratio (parameter d for a DRP donor; a for an acceptor: by itself and regardless of the presence of any other fluorophore/parter) changes its emission intensity. In DRP donors quenching also alters the ngmFRET transfer rate (see equations 22 and 27), thereby changing the emission intensities of not only itself but also its IRP. By contrast, in DPR acceptors quenching does not alter ngmFRET, and hence do not affect its IRP donor intensity. A DRP acceptor therefore can alter intensities of its donor IRP only if ligand binding changes . If the DRP is a donor, then manipulation of the energy transfer coupling factor, , changes the rate of excited state decay; if it is an acceptor, the rate of excited state formation is altered.

    [0637] Regardless of whether the DRP is a donor or acceptor, a change in any of the two parameters ( and d or a) alters the ratio of the donor and acceptor quantum yields (equation 33), thereby enabling ratiometry. Ligand-mediated donor DRP quenching affects the quantum yields of both the donor, Q.sub.D, and acceptor, Q.sub.A, quantum yields (equations 30, 32). Quenching of an acceptor DRP alters only Q.sub.A (equation 30). Changes in affect quantum yields of both fluorophores, regardless whether the DRP functions as the donor or acceptor (equations 23-25, 30, 32). For systems in which there is no ligand-mediated change in the (average) distance between the two fluorophores, changes only if the DRP switches between two different excited state populations (dipole switching) in response to ligand binding and if the two excited states differ in their spectral properties (emission for donor DRPs; absorption for acceptor DRPs). Excited state dipoles usually also differ in their dipole orientations, so it is likely that changes in spectral overlap involve (re-)orientation effects. They are also likely to differ in the relative rates of their radiative and non-radiative decay rates. Dipole switching therefore is likely to involve a combination of changes in ngmFRET and quenching effects.

    [0638] There are eight possible combinations of ligand-mediated changes in quenching and ngmFRET parameters, which have different outcomes on the two emission intensities and their ratio, depending on whether the DRP is the donor or acceptor. The qualitative behavior of the resulting sixteen possibilities in ngmFRET systems are shown in Table 12. Twelve of these have a predictable outcome on the direction of change in the ratio of the two emission intensities. The effect on the direction of change for both donor and acceptor emission intensities can be predicted for seven models. For the other models, the direction of change of one or both peaks depends on the size of the change in the underlying parameters. Purely geometric effects (changes in inter-dipole distance or orientation) always result in anti-correlated changes in emission intensity changes (i.e. one increases and the other decreases, or vice versa). Correlated (i.e. both intensities increase or decrease) or uncorrelated (one changes, the other remains constant) intensity changes therefore are prima faice evidence for an ngmFRET effect.

    TABLE-US-00020 TABLE 12 Qualitative analysis of the patterns of donor and acceptor emission intensity changes in ngmFRET.sup.a Directly responsive partner Model Q.sub.A/Q.sub.D Q.sub.D Q.sub.A Donor d.sup.0 .sup.+ d.sup.0 .sup. d.sup.+ .sup.0 d.sup.+ .sup.+ * * d.sup.+ .sup. * d.sup. .sup.0 d.sup. .sup.+ * d.sup. .sup. * * Acceptor .sup.0 .sup.+ * .sup.0 .sup. * .sup.+ .sup.0 0 .sup.+ .sup.+ * * .sup.+ .sup. * .sup. .sup.0 0 .sup. .sup.+ .sup. .sup. * *
    .sup.aThe effects of increasing or decreasing quenching in the directly responsive ngmFRET partner (d for donors, a for acceptors) or the energy transfer coupling () between the donor and acceptor are tabulated. The consequences of using a directly responsive donor or acceptor are examined. Changes in quenching and ngmFRET coupling parameters can occur singly or in combination, leading to 16 possible models. The models examine the effects of the direction of change in quenching parameters (no change, d.sup.0 or a.sup.0; increase d.sup.+ or a.sup.+; decrease, d.sup. or a.sup.) and the energy transfer coupling factor (no change, .sup.0; increase, .sup.+; decrease, ) on the patterns in the direction of change of the donor. Q.sub.D (equation 16) or acceptor, Q.sub.A (equation 18) quantum yields, and their ratio, Q.sub.A/Q.sub.D (equation 19): , increase; , decrease; 0, no change; *, response is dependent on precise quantitation rather than direction of change in the underlying parameter values.

    Example 7. Bicarbonate Biosensors, Calcium Biosensors, and Uses Thereof

    [0639] We report the construction of robust, thermostable, reagentless, fluorescently responsive biosensors for bicarbonate and calcium, derived from engineered periplasmic binding proteins. These proteins potentially can be used for high-precision chemometric measurements in the clinical concentration ranges for bicarbonate and ionized calcium, using fluorescence ratiometry measured with straightforward, inexpensive instrumentation.

    [0640] Thermostable homologs of the bicarbonate-binding protein were identified using a bioinformatics search strategy that applied a structure-based sequence filter to identify the subset of sequences that retain the original function within the larger collection of aligned sequence homologs. The homologs tested appeared at sequence identities from 100% to 26% of the probe sequence. At level below 60%, overall identities are weak predictors of biological function (Todd 2001, Tian 2003, George 2005), application of the structure-based filter therefore was essential for accurate identification. The bicarbonate-binding properties of the predicted hits were tested experimentally by constructing synthetic genes optimized for heterologous protein expression in E. coli (Allert et al. 2010) and determining the bicarbonate-binding properties of the expressed proteins. This search resulted in the identification of two thermostable proteins, avBicarbBP5 and teFeBP3, which bind Ca.sup.II- or Fe.sup.III-bicarbonate complexes, respectively.

    [0641] In avBicarbBP5, Pacific Blue conjugates were particularly effective for the construction of bicarbonate sensors. Pacific Blue is a hydroxycoumarin derivative, the phenolate of which corresponds to the excited state (Sun 1998). Without being bound by any scientific theory, it is therefore likely that binding of Ca.sup.2+ stabilizes the excited state, with a concomitant increase in quantum yield. We also found that Ca.sup.2+ and bicarbonate binding functions can be separated. The avBicarbBP5 protein therefore can be engineered to function as either a Ca.sup.IIHCO.sub.3 or a Ca.sup.2+ sensor. The Pacific Blue conjugates exhibited monochromatic responses to ligand binding. These were converted into dichromatic responses that enable ratiometric measurements, using a double labeling strategy in which a second fluorophore was attached site-specifically to a small C-terminal Zif domain. Additional mutations further altered the affinities for either Ca.sup.IIHCO.sub.3 or Ca.sup.2+ to match the clinical concentration ranges of these two analytes. The resulting sensors are well-suited for applications in point-of-care clinical chemistry or continuous monitoring of analyte concentrations.

    [0642] In teFeBP3, several singly labeled Acrylodan and Badan conjugates exhibited good dichromatic responses to Fe.sup.IIIHCO.sub.3 binding. Of these, the teFeBP3 270C-Badan conjugate evinced the largest response, with an apparent K.sub.d value of 48 mM. This sensor is suitable for measurements in the clinical reference concentration range.

    [0643] The biosensors can be incorporated into point-of-care clinical devices to measure ligand (e.g., bicarbonate or Ca.sup.2+) concentrations accurately, and rapidly at the patient bedside. In such a device, a small blood sample (<10 L) is obtained by means of a finger stick using a lancet. This sample droplet is then placed on the aperture of a disposable cartridge containing desiccated, immobilized biosensors inside a small measurement chamber. The sample enters the chamber by virtue of passive capillary action, wetting the sensors upon contact. As soon as the sensors have been wetted, they bind ligand, and report on its concentration by virtue of the engineered fluorescent sensor mechanism. The cartridge is placed inside a small reader (handheld or on a desktop), and their fluorescence signal is measured by the (inexpensive) optoelectronic components of the reader. Excitation light is provided by a light-emitting diode (LED). In the case of Acrylodan or Badan, a commercially available 400 nm blue LED is used, and the emitted light is measured through two bandpass filters. Cartridges can contain multiple sensors, spanning the entire clinical range of possible ligand concentrations. Each sensor is immobilized at a particular, known location inside the cartridge, providing spatial addressability. The intensity at a particular wavelength is then recorded by imagining these sensors using an inexpensive camera, such as a Complementary metal-oxide semiconductor (CMOS) device commonly found in consumer electronics such as cell phones. Each pixel in the camera records the emitted light on a gray scale. Integration of that signal imaged through the two signals, is analyzed by an on-board computer to calculate the ratiometric signal for each immobilized sensor. Pre-recorded hyperbolic binding curves are then used to calculate the ligand concentration in the sample. Recording through multiple sensors, tuned for accurate detection at different ligand concentrations provides a high-accuracy reading. This process is completed in less than a minute.

    [0644] Similar instrumentation can be used for any type of episodic measurements, for instance, using other bodily fluids, or samples obtained from animals, or non-biological samples such as foods and beverages.

    [0645] The FRS biosensors also can be used to monitor ligand levels continuously. For instance, sensors can be immobilized at the tip of a thin optical fiber to construct a ligand-responsive optode. Such an optode can be introduced into the body subcutaneously, using a small needle. Excitation and emission light are passed to and from the immobilized sensor, respectively. The sensor is in continuous contact with the sample. Fluctuations in the ligand sample alter the dynamic equilibrium between the open and closed states of the ligand-binding protein, which is transduced into fluctuations of the fluorescent emission signal, by virtue of the sensing mechanism of the conjugated fluorophore. The emitted light intensities are read through filters by a reader connected to the optode. This reader continuously displays the change in signal, and the corresponding calculated ligand concentrations. Continuous ligand monitoring may be accomplished using a device containing the immobilized biosensor(s), e.g., a fiber optic biosensor, introduced into the subject intradermally or subcutaneously (Judge et al., 2011, Diabetes Technology & Therapeutics 13 (3):309-317; Weidemaier et al., 2011, Biosensors and Bioelectronics 26:4117-4123; hereby incorporated by reference).

    [0646] As was discussed above, the features that distinguish the described constructs, devices, and methods from earlier bicarbonate and Ca.sup.2+ assay systems include: [0647] Self-calibration [0648] Rapid response time [0649] Simple sample-handling fluidic circuitry [0650] No additional components/substrates (reagentless) [0651] No incubation time to develop signal. Reading is near-instantaneous and continuous [0652] Stability (simplifies manufacturing, distribution, storage) [0653] Small sample volume (<10 L). [0654] Capable of precise measurements over extended ligand concentration ranges (e.g., from low to high ranges) [0655] Multiple sensors also provides redundancy, lowering error [0656] Large scope of uses: episodic, continuous, ex vivo, in vivo, optodes, implants.

    REFERENCES

    [0657] Ahmed, M. U., I. Saaem, P. C. Wu & A. S. Brown (2014) Personalized diagnostics and biosensors: a review of the biology and technology needed for personalized medicine. Crit Rev Biotechnol. 34, 180-96. [0658] Allert, M., J. C. Cox & H. W. Hellinga (2010) Multifactorial determinants of protein expression in prokaryotic open reading frames. J Mol Biol. 402, 905-18. [0659] Allert, M. J., Miriyala, J., Bergeron. A., Hellinga. H. W. (2015) Construction of ratiometric biosensors by exploiting ligand-mediated non-geometrical fluorescence Forster resonance energy transfer. In preparation. [0660] Altschul, S. F., W. Gish, W. Miller, E. W. Myers & D. J. Lipman (1990) Basic local alignment search tool. J Mol Biol. 215, 403-10. [0661] Arora, A., G. Simone, G. B. Salieb-Beugelaar, J. T. Kim & A. Manz (2010) Latest developments in micro total analysis systems. Anal Chem. 82, 4830-47. [0662] Artimo, P., M. Jonnalagedda, K. Arnold, D. Baratin, G. Csardi, E. de Castro. S. Duvaud, V. Flegel, A. Fortier, E. Gasteiger, A. Grosdidier, C. Hemandez, V. loannidis, D. Kuznetsov, R. Liechti, S. Moretti, K. Mostaguir, N. Redaschi, G. Rossier, I. Xenarios & H. Stockinger (2012) ExPASy: SIB bioinformatics resource portal. Nucleic Acids Res. 40, W597-603. [0663] Badugu, R., J. R. Lakowicz & C. D. Geddes (2005) A glucose-sensing contact lens: from bench top to patient. Curr Opin Biotechnol, 16, 100-7. [0664] Bandodkar, A. J., W. Jia, C. Yardimci, X. Wang, J. Ramirez & J. Wang (2015) Tattoo-Based Noninvasive Glucose Monitoring: A Proof-of-Concept Study. Anal. Chem. (Washington. D.C. U S.), 87, 394-398. [0665] Berntsson, R P., S. H. Smits. L. Schmitt, D. J. Slotboom & B. Poolman (2010) A structural classification of substrate-binding proteins. FEBS Lett. 584, 2606-17. [0666] Borisov, S. M. & O. S. Wolfbeis (2008) Optical biosensors. Chem Rev. 108, 423-61. [0667] Burtis. C. A., Ashwood. E. R., Bruns, D. E, 2012. Tietz Textbook of Clinical Chemistry and Molecular Diagnostics. Elsevier. [0668] Chenna. R., H. Sugawara, T. Koike, R. Lopez, T. J. Gibson, D. G. Higgins & J. D. Thompson (2003) Multiple sequence alignment with the Clustal series of programs. Nucleic Acids Res. 31, 3497-500. [0669] Cheung, H. C. (1991) Resonance energy transfer. Topics in Fluorescence Spectroscopy. 2, 127-176. [0670] Choleau, C., J. C. Klein, G. Reach, B. Aussedat, V. Demaria-Pesce, G. S. Wilson, R. Gifford & W. K. Ward (2002) Calibration of a subcutaneous amperometric glucose sensor. Part 1. Effect of measurement uncertainties on the determination of sensor sensitivity and background current. Biosens Bioelectron. 17, 641-6. [0671] Clegg, R. M. (1995) Fluorescence resonance energy transfer. Curr. Opin. Biotechnol. 6, 103-110. [0672] Cox, J. C., J. Lape. M. A. Sayed & H. W. Hellinga (2007) Protein fabrication automation. Protein Sci, 16, 379-90. [0673] Cuneo, M. J., L. S. Beese & H. W. Hellinga (2009) Structural analysis of semi-specific oligosaccharide recognition by a cellulose-binding protein of Thermotoga maritima reveals adaptations for functional diversification of the oligopeptide periplasmic binding protein fold. J Biol Chem, 284, 33217-23. [0674] de Lorimier, R. M., J. J. Smith, M. A. Dwyer, L. L. Looger, K. M. Sali, C. D. Paavola, S. S. Rizk, S. Sadigov. D. W. Conrad, L. Loew & H. W. Hellinga (2002) Construction of a fluorescent biosensor family. Protein Sci. 11, 2655-75. [0675] Demchenko, A. P. (2010) The concept of lambda-ratiometry in fluorescence sensing and imaging. J Fluoresc. 20, 1099-128. [0676] Demchenko, A. P. (2014) Practical aspects of wavelength ratiometry in the studies of intermolecular interactions. Journal of Molecular Structure, 1077, 51-67. [0677] George, R. A., Spriggs, R. V., Bartlett, G. J., Gutteridge, A., MacArthur, M. W., Porter, C. T., Al-Lazikani, B., Thornton. J. M., Swindells, M. B. (2005) Effective function annotation through catalytic residue conservation. Proc Natl Acad Sci USA, 102, 12299-12304. [0678] Gill, S. C. & P. H. von Hippel (1989) Calculation of protein extinction coefficients from amino acid sequence data. Anal Biochem. 182, 319-26. [0679] Grimley, J. S., L. Li, W. Wang, L. Wen, L. S. Beese, H. W. Hellinga & G. J. Augustine (2013) Visualization of synaptic inhibition with an optogenetic sensor developed by cell-free protein engineering automation. J Neurosci. 33, 16297-309. [0680] Grunewald, F. S, 2014. Periplasmic binding proteins in biosensing applications. In BIOREV, 205-236. Springer Int., Switzerland. [0681] Gubala, V., L. F. Harris, A. J. Ricco, M. X. Tan & D. E. Williams (2012) Point of care diagnostics: status and future. Anal Chem. 84, 487-515. [0682] Hengen, P. N. (1995) Purification of His-Tag fusion proteins from Escherichia coli. Trends Biochem Sci. 20. [0683] Heo, Y. J. & S. Takeuchi (2013) Towards smart tattoos: implantable biosensors for continuous glucose monitoring. Adv Healthc Mater. 2, 43-56. [0684] Ispas, C. R. C., G.; Andreescu, S. (2012) Review: Recent Developments in Enzyme-Based Biosensors for Biomedical Analysis. Anal. Lett., 45, 168-186. [0685] Judge, K., L. Morrow, A. G. Lastovich, D. Kurisko, S. C. Keith, J. Hartsell, B. Roberts, E. McVey, K. Weidemaier, K. Win & M. Hompesch (2011) Continuous glucose monitoring using a novel glucose/galactose binding protein: results of a 12-hour feasibility study with the becton dickinson glucose/galactose binding protein sensor. Diabetes Technol Ther. 13, 309-17. [0686] Koropatkin, N. M., Koppenaal, D. W., Pakrasi, H. B., Smith, T. J. (2007) The structure of a cyanobacterial bicarbonate transport protein, CmpA. J. Biol. Chem., 282, 2606-2614. [0687] Kozma. P., A. Lehmann, K. Wunderlich, D. Michel, S. Schumacher, E. Ehrentreich-Forster & F. F. Bier (2013) A novel handheld fluorescent microarray reader for point-of-care diagnostic. Biosens Bioelectron, 47, 415-20. [0688] Lakowicz, J. R, 2006. Principles of fluorescence spectroscopy. Springer, New York. [0689] Layton, C. J. & H. W. Hellinga (2010) Thermodynamic analysis of ligand-induced changes in protein thermal unfolding applied to high-throughput determination of ligand affinities with extrinsic fluorescent dyes. Biochemistry. 49, 10831-41. [0690] Liu, D., Evans, T., Zhang, F. (2015) Applications and advances of metabolite biosensors for metabolic engineering. Metabolic Engin., 31, 35-43. [0691] Marvin, J. S., E. E. Corcoran, N. A. Hattangadi, J. V. Zhang, S. A. Gere & H. W. Hellinga (1997) The rational design of allosteric interactions in a monomeric protein and its applications to the construction of biosensors. Proc Natl Acad Sci USA. 94, 4366-71. [0692] Marvin, J. S. & H. W. Hellinga (2001) Manipulation of ligand binding affinity by exploitation of conformational coupling. Nat Struct Biol. 8, 795-8. [0693] Marvin, J. S. H., H. W. (1998) Engineering biosensors by introducing fluorescent allosteric signal transducers: construction of a novel glucose sensor. J. Am Chem Soc, 120, 7-11. [0694] Matzeu, G., Florea, L., Diamond, D. (2015) Advances in wearable chemical sensor design for monitoring biological fluids. Sens Actuators B Chem. 211, 403-418. [0695] Mohammed, M. D., M. P. Y. (2011) Lab-on-a-chip based immunosensor principles and technologies for the detection of cardiac biomarkers: a review. Lab. Chip., 11, 569-595. [0696] Nanavati, D. M., Thirangoon, T., Noll, K. M. (2006) Several archaeal homologs to putative oligopeptide-binding proteins encoded by Thermotoga maritima bind sugards. Appl. Environ. Microbiol., 72, 1336-1345. [0697] Okumoto. S., Jones, A., Frommer, W. B. (2012) Quantitative imaging with fluorescent biosensors. Annu. Rev. Plant Biol., 63, 663-706. [0698] Omata, T., Price, G. D., Badger, M. R., Okamura, M., Gohta. M., Ogawa, T. (1999) Identification of an ATP-binding cassette transporter involved in bicarbonate uptake in cyanobacterium Synechococcus sp. strain PCC 7942. Proc Natl Acad Sci USA, 96, 13751-13576. [0699] Price, G. D., Badger, M. R., Wooddger, F. J., Long, B. M. (2008) Advances in understanding the cyanobacterial CO.sub.2-concentrating-mechanism (CCM): functional components, Ci transporters, diversity, genetic regulation and prospects for engineering into plants. J. Exp. Botany. 59, 1441-1461. [0700] Robinson. T. & P. S. Dittrich (2013) Microfluidic technology for molecular diagnostics. Adv Biochem Eng Biotechnol. 133, 89-114. [0701] Rogers, M. L. & M. G. Boutelle (2013) Real-time clinical monitoring of biomolecules. Annu Rev Anal Chem (Palo Alto, Calif.), 6, 427-53. [0702] Siburt, C. J. P., Mietzner, T. A., Crumbliss. A. L. (2012) FbpAa bacterial transferrin with more to offer. Biochim Biophys Acta. 1820, 379-392. [0703] Smith, J. J., D. W. Conrad, M. J. Cuneo & H. W. Hellinga (2005) Orthogonal site-specific protein modification by engineering reversible thiol protection mechanisms. Protein Sci, 14, 64-73. [0704] Sun, W. C., Gee, K. R., Haugland, R. P. (1998) Synthesis of novel fluorinated coumarins: excellent UV-light excitable fluorescent dyes. Bioorg Med Chem Lett, 8, 3107-3110. [0705] Tian, W., Skolnick, J. (2003) How well is enzyme function conserved as a function of pairwise sequence identity? J. Mol. Biol., 333, 863-882. [0706] Todd, A. E., Orengo, C. A., Thornton, J. M. (2001) Evolution of function in protein superfamilies, from a structural perspective. J. Mol. Biol., 307, 1113-1143. [0707] Urbieta, M. S., E. R. Donati, K. G. Chan, S. Shahar, L. L. Sin & K. M. Goh (2015) Thermophiles in the genomic era: Biodiversity, science, and applications. Biotechnol Adv. [0708] Valeur, B., Berberan-Santos, M. N, 2012. Molecular Fluorescence. Principles and Applications. Weinheim: Wiley. [0709] Wang, H., Nakata, E., Hamachi, I. (2009) Recent progress in strategies for the creation of protein-based fluorescent biosensors. Chembiochem, 10, 2560-2577. [0710] Warrel, D. A., Cox, T. M., Firth, J. D, 2010. Oxford Textbook of Medicine. Oxford University Press. [0711] Weidemaier, K., A. Lastovich, S. Keith, J. B. Pitner, M. Sistare, R. Jacobson & D. Kurisko (2011) Multi-day pre-clinical demonstration of glucose/galactose binding protein-based fiber optic sensor. Biosens Bioelectron, 26, 4117-23.

    Other Embodiments

    [0712] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

    [0713] The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.

    [0714] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.