Carbon-detected NMR for mapping binding sites in intrinsically disordered regions of a protein

10436795 ยท 2019-10-08

Assignee

Inventors

Cpc classification

International classification

Abstract

Carbon-detected NMR is well-suited for mapping binding sites in intrinsically disordered regions of a polypeptides, and for mapping of binding motifs in intrinsically disordered regions with single-residue resolution. Provided are methods of carbon-detected NMR for determining the amino acids that mediate the interaction between an intrinsically disordered polypeptide or protein, or an intrinsically disordered region of a polypeptide, and a biomolecule such as another polypeptide or a nucleic acid.

Claims

1. A method for determining the amino acids mediating an interaction between an intrinsically disordered region of a first polypeptide and a biomolecule, comprising: labeling the intrinsically disordered region of the first polypeptide with C and N, thereby producing a labeled first polypeptide; interacting the labeled first polypeptide with the biomolecule; recording a nuclear magnetic resonance (NMR) spectrum of the labeled first polypeptide interacted with the biomolecule; detecting the decrease in intensity of, a loss of .sup.13CO.sup.15N peaks, or both the decrease in intensity and the loss of .sup.13CO.sup.15N peaks in the recorded NMR spectrum relative to a reference NMR spectrum of the first polypeptide, and from the loss of intensity and/or the loss of .sup.13CO.sup.15N peaks, the amino acids on the first polypeptide that participate in the interaction with the biomolecule are thereby detected and a binding footprint is established for the intrinsically disordered region of the first polypeptide and the biomolecule.

2. The method according to claim 1, wherein the first polypeptide is a protein of about 200 amino acids or less in length.

3. The method according to claim 1, wherein the first polypeptide is an intrinsically disordered protein of about 200 amino acids or less in length.

4. The method according to claim 1, wherein the first polypeptide is phosphorylated.

5. The method according to claim 1, wherein the first polypeptide is acetylated.

6. The method according to claim 1, wherein the first polypeptide is methylated.

7. The method according to claim 1, wherein the first polypeptide comprises a post-translational modification.

8. The method according to claim 1, wherein the first polypeptide has a solubility in an aqueous medium of at least 0.5 mM.

9. The method according to claim 1, wherein the biomolecule comprises a second polypeptide that is not intrinsically disordered.

10. The method according to claim 9, wherein the second polypeptide is a protein.

11. The method according to claim 1, wherein the second polypeptide comprises an antibody.

12. The method according to claim 1, wherein the biomolecule comprises a nucleic acid.

13. The method according to claim 12, wherein the nucleic acid comprises DNA.

14. The method according to claim 12, wherein the biomolecule comprises a protein-nucleic acid complex.

15. The method according to claim 1, wherein the step of recording a nuclear magnetic resonance (NMR) spectrum of the labeled first polypeptide interacted with the second polypeptide is carried out using an NMR spectrometer equipped with a cryogenic probe having a high level of carbon sensitivity.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIGS. 1A and 1B show the effect of conformational exchange on NMR spectra. FIG. 1A shows an exchange between two states, A and B, described by the rate constants in both directions, kA and kB, and chemical shifts of a given nucleus in each state, vA and vB. kex is the total exchange rate, kA+kB, and PA and PB are the population fractions of each state (PA+PB=1). FIG. 1B shows a schematic illustration of the effect of varying kex on NMR spectra, assuming PA=75% and v=100 Hz. Note that the time regime of chemical exchange is defined by the relative magnitudes of kex and v (each in units of Hz=s1). In the slow exchange regime (kexIv1), signals from both states are observed reflecting their distinct chemical shifts, intensities and linewidths. In the fast exchange regime (kexIv1), only one signal is observed reflecting the population-weighted average of chemical shift, intensity and linewidth. In the intermediate exchange regime (kexIv1), only one signal is observed with intermediate chemical shift. Importantly, the linewidth is increased via exchange broadening, which can sometimes render this signal undetectable. In each case, the linewidths reflect the local dynamics of the sites and the rate of their interconversion. (Adapted from Mittertnaier A K et al. (2009) Trends Biochem. Sci. 80:601).

(2) FIGS. 2A-2C show NMR Spectra of NAurA recorded at 37 C. FIG. 2A shows the amino acid sequence of the N-terminal regulatory region of AurA, residues 1-131 MDRSKENICSGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPL QAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEELAASKQ KNEESKKRQWALE (SEQ ID NO:5); note that amino acids, K, L, N, P, Q, S, and V, comprise 69% of the sequence; FIG. 2B shows .sup.1H.sup.15N HSQC of [.sup.13C, .sup.15N]-NAurA. Only about of the expected peaks are observable; FIG. 2C shows the carbon-detected .sup.13CO.sup.15N correlation (CON) spectrum. Most of the peaks, including those from proline residues, are well resolved. Sequence-specific assignments were obtained for 129 out of 131 residues in the CON spectrum.

(3) FIGS. 3A and 3B show the interaction between NAurA and apo-CaM. FIG. 3A shows the CON spectrum of about 1 mM [.sup.13C,.sup.15N]-labeled NAurA in the absence (dark grey) and presence of 0.37 mM unlabeled apo-CaM (light grey). Binding of apo-CaM to NAurA caused a decrease in intensity or complete loss of .sup.13CO.sup.15N peaks for residues involved in binding. FIG. 3B shows relative change in peak intensity for assigned cross peaks of NAurA at a concentration of 1 mM upon addition of apo-CaM to a final concentration of 0.18 mM (light grey) and 0.37 mM (dark grey). At an apo-CaM concentration of 0.18 mM, the peaks for residues 60-62 and 64 disappeared completely and the peak heights for a majority of the remaining residues within the 54-68 segment of NAurA decreased by more than 50%, indicating residues in the core of the binding site. After adding more apo-CaM to reach a molar fraction of 0.37 relative to NAurA, peak heights for residues 23-82 decrease further, indicating more peripheral regions of the binding interface.

(4) FIGS. 4A through 4C show NMR Spectra of C-3DL1. FIG. 4A shows amino acid sequence of C-3DL1, residues 340-423 HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDP EEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKV (SEQ ID NO:6), with two potential SH2-domain binding motifs highlighted/underlined. The peptide VTYAQLD is SEQ ID NO:7 (not shown). The peptide ILYTEL is SEQ ID NO:8 (not shown). FIG. 4B shows .sup.1H.sup.15N HSQC of [.sup.13C, .sup.15N] C-3DL 1. Only of the expected peaks arc observable; (C) carbon-detected .sup.13CO.sup.15N correlation (CON) spectrum (dark: free, light: complex with molar ratio SHP-2-2SH2:C-3DL1:I:0.2). Most of the peaks, including those from proline residues, are well resolved. Sequence-specific assignments for 69 out of 84 residues are shown. Quantitative analysis showed that the first of the two putative SH2 binding motifs (EEVTYAQLDHCVF (SEQ ID NO:4)) is the primary recognition site for the SHP-2 11 phosphatase. The peptide EEVTY is SEQ ID NO:3.

DETAILED DESCRIPTION

(5) Various terms relating to aspects of the present disclosure are used throughout the specification and claims. Such terms are to be given their ordinary meaning in the art, unless otherwise indicated. Other specifically defined terms are to be construed in a manner consistent with the definition provided herein.

(6) As used herein, the singular forms a, an, and the include plural referents unless expressly stated otherwise.

(7) It was observed in accordance with the present disclosure that NMR methods based on direct detection of carbon are especially well suited for investigating interactions between globular proteins and intrinsically disordered proteins (IDP) or intrinsically disordered regions (IDR) of a protein. By recording a directly .sup.13C-detected 2D NMR spectrum, using established techniques that measure the correlation between backbone .sup.13CO and .sup.15N groups, such as the simple CON or proton-start CON techniques, including (HCA)CON and (HN)CON, on a uniformly .sup.13C and .sup.15N-labeled IDR in the presence and absence of a interacting macromolecule (e.g., protein or nucleic acid), binding motifs on IDPs can be identified with single-residue resolution. It was further observed that the high-quality NMR spectra required for this protein footprinting technique can be obtained using standard, commercially available NMR equipment without the need for a specialized and expensive NMR probe optimized for carbon detection. All .sup.13C-detected NMR spectra were recorded with a conventional triple-resonance cryogenic probe optimized for proton detection (Bruker TCI probe). Compared to proton detection methods, direct detection of carbon (.sup.13C) signals is less sensitive, but can result in improved spectral resolution based on: (1) the frequency separation () between two carbon signals in different conformational stales is usually larger than that of the corresponding proton signals, thus, intermediate-exchange conditions in proton NMR can become slow-exchange conditions in carbon NMR, where the NMR signals from one of the states (unfolded/unbounded) will be sharper and more readily detectable (2) NMR signals from IDRs in the unfolded/unbounded state usually have much longer (5-10 fold) transverse (spin-spin) relaxation times (T.sub.2) compared to those of fully ordered proteins. Because the line-width of an NMR signal is inversely related to T.sub.2, NMR signals of IDPs/IDRs are much sharper and have higher intensity; and (3) the spectra are more resolved because of the relatively large carbonyl carbon chemical shift dispersion, even when the complexity in amino acid sequence is low.

(8) To demonstrate effective characterization of the binding motifs in IDRs involved in interactions with another macromolecule, the studies assessed (1) the interaction between the disordered N-terminal domain of aurora kinase A (NAurA) and Calmodulin (CaM) and (2) the interaction between the C-terminal cytoplasmic domain of natural killer cell immunoglobulin-like receptor KIR-3DL I (C-3DL I) and two SH2 domains of Src-homology 2 domain-containing phosphatase 2 (SHP-2 2SH2, residues 1-246).

(9) Prior studies have focused on resonance assignment for totally disordered proteins, which typically yield well-resolved NMR spectra with sharp lines not only in carbon-detected spectra, but also in conventional proton-detected spectra. It is believed there have been no previously described use of .sup.13C direct-detection methods for mapping protein-protein interactions where one of the binding partners is an IDP or IDR. Accordingly, the present disclosure provides methods for determining which amino acids mediate the interaction between an IDR or IDP and another macromolecule by using carbon NMR.

(10) Once a polypeptide and biomolecule binding partner of interest are identified, a reference two dimensional carbon NMR spectrum of the polypeptide of interest, or at least the intrinsically disordered region thereof, is obtained. For example, a NMR spectrum may be recorded. The polypeptide of interest can be labeled with .sup.13C and .sup.15N. Thus, in some embodiments, the recombinant polypeptide of interest is uniformly labeled with .sup.13C and .sup.15N, and a .sup.13C-detected .sup.13CO.sup.15N correlation (CON) spectrum is recorded. The .sup.13C and .sup.15N labeling may be achieved according to any suitable method. In some embodiments, labeling occurs by recombinant expression of the polypeptide by a suitable host cell, with the cell culture including .sup.13C and .sup.15N.

(11) Once the disordered region of the polypeptide is labeled, the labeled polypeptide is interacted with a biomolecule. During the interaction, a CON NMR spectrum of the labeled polypeptide interacted with the biomolecule is recorded. Following the recording of the NMR spectrum of the interaction, the decrease in intensity of, a loss of .sup.13CO.sup.15N peaks, or both the decrease in intensity and the loss of .sup.13CO.sup.15N peaks in the recorded NMR spectrum are detected. Such losses may be detected, for example, by comparison to a reference NMR spectrum of the first polypeptide not interacted with the biomolecule. From the loss of intensity and/or the loss of .sup.13CO.sup.15N peaks, the amino acids on the polypeptide that participate in the interaction with the biomolecule are thereby detected and a binding footprint is established for the intrinsically disordered region of the polypeptide and the biomolecule binding partner. Peak intensity may be determined at sub-stoichiometric concentrations of the biomolecule.

(12) In some embodiments, the polypeptide of interest (that is labeled and whose binding residues are being queried) has about 200 amino acids or less (to a minimum of about 5 amino acids). The polypeptide may be a protein of about 200 or less amino acids in length (to a minimum of about 5 amino acids), or may be a fragment of a protein. The polypeptide may comprise an intrinsically disordered region. The polypeptide may comprise an intrinsically disordered protein, or a fragment thereof comprising amino acids of one or more intrinsically disordered regions of the protein. In some embodiments, the polypeptide comprises an epitope for an antibody that specifically binds to the polypeptide or region thereof.

(13) In some embodiments, the polypeptide comprises one or more post-translational modifications. In some embodiments, the polypeptide is phosphorylated. In some embodiments, the polypeptide is acetylated. In some embodiments, the polypeptide is methylated.

(14) The polypeptide may be substantially water-soluble. In some embodiments, the polypeptide has a solubility in an aqueous medium of at least about 0.5 mM. In some embodiments, the polypeptide is dissolved in an aqueous medium at a concentration of at least about 0.5 mM. In some embodiments, the IDP may be produced with attachment of a solubility-enhancement tag (SET) to its N-terminal to enhance solubility.

(15) In some embodiments, the biomolecule is a known or queried binding partner to the polypeptide. The methods may be used to determine which amino acids in the polypeptide participate in the interaction with the biomolecule. The methods allow the determination of core regions of the interaction site on the polypeptide, as well as peripheral regions of the interaction site.

(16) In some embodiments, the biomolecule comprises an enzyme. In some embodiments, the biomolecule comprises a second polypeptide, which may comprise a protein or portion thereof of any length. In some embodiments, the second polypeptide is not an intrinsically disordered polypeptide or protein.

(17) In some embodiments, the biomolecule comprises an antibody. Thus, the footprinting methods may be used to determine the epitope of the antibody, e.g., epitope mapping, where the labeled/query polypeptide comprises an antigen of the antibody.

(18) The biomolecule may comprise a nucleic acid. The nucleic acid may comprise DNA, RNA, or a combination thereof, or may comprise a complex of a nucleic acid and a polypeptide or protein. The nucleic acid may be single stranded, double stranded, or have multiple strands, and may comprise any conformation.

(19) In some embodiments, the probe is a cryogenic probe. In some embodiments, the cryogenic probe has a high level of carbon sensitivity.

(20) The following examples are provided to describe the present disclosure in greater detail. They are intended to illustrate, not to limit, the present disclosure.

EXAMPLES

Example 1: General Experimental Methods

(21) Technical Requirements and General Procedures.

(22) The NMR instrumentation was a Bruker Avance 600 MHz NMR spectrometer equipped with a triple-resonance cryoprobe (Bruker TCI cyroprobe, but a spectrometer and probe with equivalent or higher carbon sensitivity may be used). The mapping procedures for identifying binding motifs in IDRs are summarized as follows: (1) Prepare a DNA construct for a protein expression system of the soluble IDR to be studied by using standard molecular biology procedures. (2) According to standard protocols, express and purify uniformly-labeled sample of the IDR with the stable isotopes .sup.13C and .sup.15N, then prepare an NMR sample at a protein concentration of 0.5 mM or higher in an appropriate buffer. (3) Record a proton detected .sup.1H.sup.15N HSQC of the IDR as a reference. (4) Record direct carbon-detected CON spectrum. (5) Record a series of direct carbon-detected 3D NMR spectra, such as: C_CBCACON, C_CBCANCO, C_CCCON, C_CANCO, and C_CANCOi, for the sequential assignment of the main-chain .sup.13CO.sup.15N cross peaks in the CON spectrum. (6) Record a .sup.13C-detected 2D NMR spectrum, such as CON or (HCA)CON, of IDR in the absence of another macromolecule. (7) Record a 2D NMR spectrum under identical instrument and sample conditions for the IDR in the in the presence of increasing concentrations of its binding partner, which can be any soluble macromolecule (protein, monoclonal antibody or nucleic acid) without isotopic labeling. (8) Analyze the NMR data in terms of changes in chemical shifts and/or peak intensity due to addition of a binding partner to identify binding motifs.

(23) Protein Expression and Purification.

(24) NAurA DNA sequence encoding residues 1-131 was commercially synthesized (Life Technology, Thermo Fisher Scientific). The gene was subcloned into the expression vector pET49b (Novagen) between the BamH I and Hind III sites. An expression vector for chicken Calmodulin (CaM) was a gift. The gene encoding the cytoplasmic domain of KIR-3DL 1, including residues 340-423, was inserted into expression vector pET32b (Novagen) between the Ncol and BamH I sites. The gene of protein SHP-2, residues 1-247, was subcloned into pET49b between BamH I and Hind III sites. Each protein was purified from the E. coli Rosetta2 (DE3) or BLR(DE3) bacterial cells (Novagen), with corresponding expression systems. The cells were grown from LB media and protein expression was induced using standard protocols. Stable isotopic uniformly .sup.13C and .sup.15N labeled proteins were isolated from bacterial cells grown in M9 media supplement with .sup.15N NH.sub.4CI (CIL) and .sup.13C glucose (CIL). All proteins were purified using a 5 mL HisTrap column (GE Healthcare Life Sciences) according to the manufacturer's directions, except for CaM, which was purified with a hydrophobic column (phenyl-sepharose CL-4B, Sigma). The target proteins were cleavage from the fusion tag with HRV-3C protease (Novagen), except for C-3DL 1, which was cleavage by thrombin (BioPharm, Lab., LLC).

(25) Nmr Spectroscopy.

(26) NMR samples of uniformly .sup.13C- and .sup.15N-labeled NAurA or C-3DL 1 (300 l) were prepared by dissolving 1 mM protein in buffer containing 20 mM HEPES, 20 mM NaCl, 3 mM EDTA, and 3 mM DTT, at pH 7.4 The purified protein contains a 33-amino acid SET attached at its N-terminus with a sequence of GSGMKETAAAKFERQHMDSPDLGT DDDDKAMEF (SEQ ID NO:2) to make the protein soluble. To form the complex of these IDRs with their respective binding partners, the samples were re-concentrated to a volume of 300 l after adding the desired amounts of target protein. All NMR spectra were recorded at 37 C. on a Bruker Avance II 600 MHz NMR instrument equipped with a TCI triple-resonance cryogenic probe. The data were acquired by using standard Bruker pulse sequences.

Example 2: Results

(27) The Interaction Between NAurA and CaM.

(28) Purified NAurA is a 138 residue protein comprising residues 1-131 of AurA and an N-terminal GPGYQDP (SEQ ID NO:1) sequence after cleavage with HRV-3C protease. NAurA has low sequence complexity with seven amino acids (K, L, N, P, Q, S, and V) comprising 69% of the sequence (see, FIG. 2A). As shown in FIG. 2B, less than of the expected peaks were resolved in the conventional proton detected .sup.1H.sup.15N HSQC. The remaining peaks are either severely broadened due to conformational exchange or unresolved due to the redundancy in its sequence.

(29) FIG. 2C shows the .sup.13C-detected .sup.13CO.sup.15N correlation (CON) spectrum. Most of the peaks, including those from proline residues, are well-resolved. The large chemical shift range in the carbon dimension minimizes line broadening due to conformational exchange and signal overlap despite its highly redundant sequence. Using various multidimensional NMR experiments, all involving direct detection of .sup.13C signals, sequence-specific assignments were obtained for the backbone carbons and nitrogens of 129 out of 131 residues as well as most of their side chain carbons.

(30) It was previously shown that CaM binds with high affinity to AurK, by recognizing a binding site in the 33-89 region of NAurA. Addition of unlabeled calcium-free CaM (apo-CaM) to an NMR sample of isotopically labeled NAurA caused a decrease in intensity or complete loss of .sup.13CO.sup.15N peaks for residues involved in binding. In a first experiment, when the molar ratio of apo-CaM to NAurA was 0.18 to 1, the peaks for residues 60-62 and 64 disappeared completely and the peak heights for a majority of the remaining residues within the 54-68 segment ofNAurA decreased by more than 50% (see, FIG. 3A), indicating these residues are at the core of the binding site. After adding more apo-CaM to reach a molar fraction of 0.37 relative to NAmA, further reduction in peak height was observed for residues 23-82, indicating more peripheral regions of the binding interface (see, FIG. 3B). These results are consistent with previous cell-biological data, but provide more detailed structure information in terms of individual residues of NAurA that are recognized by CaM.

(31) Interaction Between C-3DLI and SHP-2 2SH2.

(32) The disordered C-terminal region of KIR-3DL 1 (C-3DL1) contains 84 amino acids. After thrombin cleavage, purified C-3DL1 is a 117 residue-protein with 33 addition amino acids at the N-terminus (GSGMKETAAAKFERQH MDSPDLGTDDDDKAMEF) (SEQ ID NO:2). Previous sequence analysis and cell biological studies identified two potential SH2-domain binding motifs centered on the two tyrosine residues in the sequence of C-3DL1 (see, FIG. 4A). Direct carbon detection NMR techniques were used to determine whether the SH2-domain of SHP-2 preferentially binds to one of these motifs when C-3DL1 is unphosphorylated.

(33) FIG. 4B (dark grey) shows the conventional proton detected .sup.1H.sup.15N HSQC spectrum for C-3DL 1. Although the peaks were sharper than those of NAurA, less than 60% of the expected peaks are resolved; the remaining peaks are either broad due to the conformational exchange or unresolved due to the small proton chemical shift range. In contrast, almost all peaks (including Pro residues) are well resolved in the carbon detected CON spectrum, which minimizes line broadening and signal overlap. After assigning 69 out of 84 residues, the interaction between C-3DL 1 and SH2 domains of SHP-2 was studied by adding purified SHP-2 2SH2 (unlabeled) to the .sup.13C/.sup.15N-Iabeled C-3DL1 sample. FIG. 4C shows the CON spectrum C-3DL 1 in the presence of SHP-2 2SH2 at a molar fraction of 20% (light grey) superimposed on the CON of free C-3DL1 (dark grey). Most of the cross peaks assigned to residues 36-45 are weak or absent in the spectrum of the complex. Quantitative analysis of the changes in peak heights showed that a majority of residues between 33 and 46 experience a decrease in peak intensity of at least 50% (see, FIG. 4C). This region contains the first of the two putative SH2 binding motifs (EEVTYAQLDHCVF (SEQ ID NO:4)), which is thus identified as the primary recognition site for the SHP-2 phosphatase.

Example 3: Summary

(34) Initial applications of the carbon NMR footprinting technique to two different systems: (I) the interaction between the disordered N-terminal domain of aurora kinase A (NAurA) and Calmodulin (CaM); (2) the interaction between the C-terminal cytoplasmic domain of a natural killer cell immunoglobulin-like receptor (C-3DL 1) and the SH2 domains of a tyrosine-protein phosphatase (SHP-2 2SH2), allowed the identification of the specific residues in intrinsically disordered protein regions (IDRs) involved in recognizing an interacting protein. The data show that direct carbon detection NMR techniques are a powerful tool for characterizing the interaction between globular proteins or domains and IDRs despite the fact that the latter are highly dynamic and do not adopt a unique structure. Conformational dynamics on a micro- to millisecond time scale often makes .sup.1H conventional proton-detected NMR spectra uninterpretable. Direct carbon detection methods result in multi-dimensional NMR spectra with dramatically reduced line broadening and can be fully resolved and specifically assigned even for proteins with low sequence complexity. The favorable relaxation properties of carbon nuclei of IDRs make it possible to collect NMR data by using a standard proton-optimized cryoprobe. Upon addition of an unlabeled globular protein to an NMR sample of an isotopically labeled IDR, the binding site can be mapped to specific residues on the IDR by following the changes in intensity for .sup.13CO.sup.15N cross peaks at sub-stoichiometric concentrations of the binding partner. Compared to conventional biochemical and cell-biological techniques, the advantages of this carbon NMR protein footprinting method include (1) allowing mapping of protein interactions with single-reside resolution, and (2) differential effects on peak intensity allow identification of core vs. peripheral regions of the binding site.

(35) Given that protein-protein interactions involving disordered regions of proteins are a ubiquitous feature of cell signaling and other biological systems, it is believed that the technique introduced here will become an important tool for studies of macromolecular interaction networks. Another application of major practical importance in biotechnology and biomedical research is to map epitopes for antibodies recognizing IDRs or IDPs, which includes monoclonal antibodies used in molecular and cellular biology as well as therapeutic antibodies. In addition, the methods can be used to study protein posttranslational modifications, such as phosphorylation, methylation and acetylation. Real-time studies of the kinetics of modification are believed to be possible by using a cryogenic probe with higher carbon sensitivity (such as the Bruker DCH, which has a 2-folcl higher carbon sensitivity than a conventional TC1 probe).

(36) The present disclosure is not limited to the embodiments described and exemplified above, but is capable of variation and modification within the scope of the appended claims.