A matrix for the cultivation of biological cells and differentiation into neuronal cells consists of a polymer base body having a structured surface with a microstructure and a nanostructure embedded therein.

Provided are a cell culture member having excellent cell culture performance and its long-term stability, and a method for modifying the surface thereof. The cell culture member according to the present invention is a cell culture member having at least a holding region that holds an adherent cell and contains a polymer compound, wherein at least a part of the holding region is a surface-modified region in which a fluorine atom is directly chemically bonded to a part of carbon atoms and/or silicon atoms constituting the polymer compound, and the present invention can provide a cell culture member that improves adhesiveness of the adherent cell to the surface-modified region, suppresses deterioration over time of adhesiveness, and is excellent in cell culture performance and its long-term stability.

The present disclosure relates to, at least, a vacuum-assisted method for infiltrating cadaver bone with a cryoprotectant and a method for rapidly warming the cryopreserved cadaver bone for bone marrow processing.

Provided is a method of preparing a three-dimensional cell spheroid, the method including forming the cell spheroid by co-culturing adipose-derived stem cells or mesenchymal stem cells with hepatocytes. According to the cell spheroid prepared by the method, the secretome secreted by the adipose-derived stem cells affects hepatocyte maturation, and therefore, hepatic functions of the finally formed three-dimensional cell spheroid, i.e., organoid, may be enhanced. Further, a composition including a culture medium of the adipose-derived stem cells may prevent or treat liver diseases including hepatitis, hepatotoxicity, cholestasis, fatty liver, etc., and may enhance hepatic functions.

A demineralized bone matrix is produced by a process in which a bone body is placed in a first processing solution comprising an acid to demineralize the bone body. The bone body is periodically removed from the first solution at specific time intervals to perform at least one test, such as a compression test, on a mechanical property of the bone body. When the test yields a desired result, the bone body is exposed to a second processing solution that is less acidic than the first, thus minimizing the exposure of the bone body to the harsh acidic conditions of the demineralization phase of the process.

The method provides a hyaluronic-acid binding based technique to separate functionally competent and mature sperm. The method for extracting viable sperms from a semen sample comprises incubating functionalized HA with functionalized paramagnetic beads to obtain a plurality of HA coated paramagnetic beads. The method further comprises incubating the plurality of HA coated paramagnetic beads with the semen sample to obtain a first population and a second population of sperm. The first population comprises sperm bound to the plurality of HA coated paramagnetic beads and the second population comprises sperms not bound to the plurality of HA coated paramagnetic beads. The method comprises magnetically separating the first population from the second population and separating sperms from the plurality of HA coated paramagnetic beads in the separated first population to obtain the viable sperms.

Disclosed are a nanofiber mat, a manufacturing method thereof, and applications thereof as a mat for cell culturing or as a barrier membrane for guided bone regeneration (GBR). The nanofiber layer includes a nanofiber layer and a reinforcement pattern that is disposed on the nanofiber layer and adhesively connected with the nanofiber layer. The nanofiber layer and the reinforcement pattern are combined with each other by at least one of the melting-solidification of at least a part of the nanofiber layer together with the reinforcement pattern, the dissolution-solidification of the same, and the penetration of a part of the reinforcement pattern into the nanofiber layer, followed by solidification.

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

The present disclosure relates to a cell culture medium composition and a preparation method therefor. By replacing an animal serum with a Spirulina hydrolysate, cell growth can be induced and cell proliferation can be promoted to a level greater than or equal to that of a medium containing an animal serum, while significantly reducing the added amount of animal serum.

The disclosure relates to coated surfaces suitable for cell culture, to methods for making such surfaces, and to methods for culturing adherent cells on such surfaces. One aspect of the disclosure is a surface suitable for cell culture including an amorphous hydrogenated carbon coating. Another aspect of the disclosure is a method for making a surface suitable for cell culture including an amorphous hydrogenated carbon coating. Another aspect of the disclosure is a method for culturing adherent cells that includes incubating a surface including an amorphous hydrogenated carbon coating with adherent cells and a growth medium.